loading

Logout succeed

Logout succeed. See you again!

ebook img

Almond milk fermented with different potentially probiotic bacteria improves iron uptake by ... PDF

pages13 Pages
release year2015
file size0.79 MB
languageEnglish

Preview Almond milk fermented with different potentially probiotic bacteria improves iron uptake by ...

International Journal of Food Studies OFFICIAL JOURNAL OF THE ISEKI_FOOD ASSOCIATION ISSN: 2182-1054 Almond milk fermented with different potentially probiotic bacteria improves iron uptake by intestinal epithelial (Caco-2) cells Copyright Notice Authors who publish in the International Journal of Food Studies agree to the following terms:  Authors retain copyright and grant the journal right of first publication with the work simultaneously licensed under a Creative Commons Attribution License that allows others to share the work with an acknowledgement of the work's authorship and initial publication in this journal.  Authors are able to enter into separate, additional contractual arrangements for the non-exclusive distribution of the journal's published version of the work (e.g., post it to an institutional repository or publish it in a book), with an acknowledgement of its initial publication in this journal.  Authors are permitted and encouraged to post their work online (e.g., in institutional repositories or on their website) prior to and during the submission process, as it can lead to productive exchanges, as well as earlier and greater citation of published work. DOI : 10.7455/ijfs/4.1.2015.a4 International Journal of Food Studies IJFS April 2015 Volume 4 pages 49–60 Almond milk fermented with different potentially probiotic bacteria improves iron uptake by intestinal epithelial (Caco-2) cells Neus Bernata*, Maite Cha´fera, Amparo Chiralta, Jose´ Moise´s Laparrab, and Chelo Gonza´lez-Mart´ıneza a Instituto de Ingenier´ıa de Alimentos para el Desarrollo. Universitat Polit`ecnica de Val`encia, Camino de Vera s/n, 46022 Valencia, Spain bMicrobial Ecophysiology and Nutrition Laboratory. Instituto de Agroqu´ımica y Tecnolog´ıa de Alimentos (CSIC). Av. Agust´ın Escardino, 7. 46980 Paterna, Valencia, Spain *Corresponding author [email protected] Tel: +34 963 877 056 Fax: +34 963 877 956 Received: 6 Mars 2014; Published online: 18 April 2015 Abstract Newfermentedalmondmilksweredeveloped,usingdifferentpotentiallyprobioticbacteria,inorder to meet the current demand for healthy, versatile non-dairy products. An in vitro digestion/Caco- 2 cell model was used to evaluate the effect of both non-fermented and fermented almond milks on the mitochondrial enzymatic activities of enterocytes. Moreover, macrophages were challenged with the in-vitro digested samples and the production of pro-inflammatory biomarkers TNF-α and IL-6 was quantified. Enzymatic activities of cell cultures seemed to be stimulated by the exposure to both fermentedandnon-fermentedalmondmilks. Bothbiomarkersdecreased(p<0.05)infermentedalmond milkswitheitherB.bifidum orB.longum. Resultsshowedthatfermentedalmondproductsfavoredthe energeticmetabolismofenterocytesandhadalowerinflammatoryresponsethannon-fermentedalmond milk, suggesting its benefits for the management of allergies/intolerances. Moreover, the fermentation process enhanced the uptake of iron by Caco-2 cells, especially when using L. rhamnosus and either B. bifidum or B. longum as starters, thus improving the product bioactivity. Therefore, new non- dairy fermented products with functional properties were developed, which might be positioned as alternativestocow-milkproductsforsensitizedgroupsofpopulation(allergicand/orintoleranttocow milk or anemic population, among others). Keywords: Almond milk; Fermentation; Probiotics; Iron availability; Inflammation 1 Introduction to a reduced exposure to a variety of microbes, which, early in life, is a crucial factor in the The current alarming increase in the incidence development of allergies (Bj¨orkst´en, 2009). In- of allergic diseases in both children and adults deed, several prospective follow-up studies have in developed countries has been attributed to found that alterations in gut microbiota precede the so-called “hygiene hypothesis”; this theory allergy development (Kalliom¨aki, 2010). Hence, suggests that the increased level of hygiene in recentclinicalallergyresearcheshaveprincipally both the environment and the food supply leads focused their attention on the manipulation of Copyright '2015 ISEKI-Food Association (IFA) 10.7455/ijfs/4.1.2015.a4 50 Bernat et al. gut microbiota composition (Kalliom¨aki et al., 2006), which might improve the bioavailability 2010). Nowadays, probiotics, prebiotics and of dietary iron. As it has been reviewed, synbiotics (combination of pre- and probiotics) although non-heme iron is easily oxidized (not are considered as good tools with which to bioavailable) due to the rise of pH in the elicit changes in the gut biomass composition, lumen, the presence of reductants from food can since they can improve and stimulate beneficial maintain this micronutrient in its reduced form gut microflora, among other effects that are and, therefore, positively improve its absorption beneficial for the health. Since the late 1990s, (Miret, Simpson, & McKie, 2003). Moreover, over 30 randomized clinical trials have been almond milk is considered an appropriate alter- published, in which probiotics have been used native to cow-milk, since, besides the healthy either in the treatment or prevention of allergies lipid profile, it has a low ratio of Na/K and a (mainly atopic diseases) (Kalliom¨aki et al., balanced ratio of Ca/P (Luengo, 2009). 2010). Hence, considering the high prevalence of Nevertheless, with regards to the inflammatory atopic disease in childhood in the industrialized response, there is lack of data concerning nut countries (Anandan, Nurmatov, van Schayck, & beverages, and least when it comes to derivative Sheikh, 2010), the use of yoghurt-type foods as fermented products. Only recently has data carriers of probiotics and/or synbiotics would appeared on almonds (Rajaram, Connell, & be helpful as a means of attaining the either Sabate, 2010), in which the authors studied preventive or prophylactic treatment in this whether, in addition to the lowering of blood targeted population. Moreover, despite the lipids, monounsaturated fat-rich almonds influ- little known and untrustworthy concept of enced other coronary heart disease risk factors, functional food, consumers are familiar with such as inflammation. The study concluded yoghurt-type products and consider them as that incorporating about 68 g almonds in a 2000 healthy (Annunziata & Vecchio, 2011), which kcal cholesterol-lowering diet decreased serum would facilitate the inclusion of such functional E-selectin (molecules which are indicative of fermented products in their diets. endothelial dysfunction) and C-reactive protein The immunomodulatory effects of fermented (sensitive marker of inflammation that, in high dairy-milks, casein hydrolysates and soy- concentrations, is strongly linked with coronary beverage caused by lactic acid bacteria have events, stroke and peripheral vascular disease) been widely reported (Baroja, Kirjavainen, in healthy men and women. Hekmat, & Reid, 2007; Sutas et al., 1996; Although around 50% of almond composition is Wagar, Champagne, Buckley, Raymond, & fat, intakes of 7g per day of this nut have been Green-Johnson, 2009). However, in addition shown to reduce low-density lipoprotein choles- to the allergenic proteins, both matrices might terol concentration by 1% (Sabat´e, Haddad, provoke iron deficiencies in infants and toddlers. Tanzman, Jambazian, & Rajaram, 2003) and up On the one hand, the calcium together with to84gperdaycanbeconsumedwithoutweight the casein provided by cow-milk are seen to gain (Chen et al., 2006). In addition, these nuts inhibit the absorption of dietary non-heme iron, havealowglycemicindex(theydonotadversely in addition to the intestinal blood loss observed impact insulin sensitivity) (Chen et al., 2006) in approximately 40% of infants during feeding and have been found to possess prebiotic effects, with cow-milk and/or its derivatives (Agostoni since they stimulated the growth of gut bifi- & Turck, 2011). On the other hand, soya-based dobacteria and Eubacterium rectale (Mandalari, products contain phytates, which negatively Nueno-Palop, Bisignano, Wickham, & Narbad, interfere in the absorption of iron, among other 2008). Hence, taking into account the health minerals (Artazcoz, 2007). benefitsofalmondintake, almondmilkmightbe By contrast, almond milk has not been reported considered as a good food matrix with which to to interfere negatively in iron absorption. In- obtain healthy fermented products. Moreover, deed, almonds have high anti-oxidant activity if the fermentation process is carried out by owing to the α-tocopherol and polyphenolic potentially probiotic bacteria, the developed constituents (Chen, Lapsley, & Blumberg, fermented product could be useful as a means IJFS April 2015 Volume 4 pages 49–60 Fermented almond milks improve bioavailability of iron 51 of preventing some immunomodulatory diseases, perature). such as allergies. Lactobacillus rhamnosus CECT 278, Lactobacil- The Caco-2 cell line, commonly used in con- lus plantarum 3O9, Bifidobacterium bifidum junction with in vitro digestion techniques, is CECT870,Bifidobacteriumlongum CECT4551, a useful model for studying intestinal human Streptococcus thermophilus CECT 986, Lacto- iron uptake, which it allows to occur simulta- bacillusdelbrueckii subs. Bulgaricus CECT4005 neously with food digestion, and is generally were used as starters, pure or mixed, as shown regarded as the best available intestinal cell inTable2. Allthebacteriawerepurchasedfrom model for studying the mechanisms associated CECT (Paterna, Spain), with the exception of with vectorial iron transport (Glahn, Lee, the L. plantarum 3O9 strain, which was isolated Yeung, Goldman, & Miller, 1998). In addition, from Guirra sheep milk and selected as a probi- the macrophage-derived RAW 264.7 cell line otic in previous studies (Amorocho Cruz, 2011). expresses key genes and proteins of principal For the preparation of starters inoculum, the pathways for the production of regulatory strains were independently incubated for 24 h cytokines (Novak, Babcock, Jho, Helton, & in their selective broths and then centrifuged at Espat, 2003) and constitutes a cell model used 100 g (Medigriger-BL-S, JP-Selecta; Barcelona, worldwide and a useful tool with which to study Spain) for 10 min at 4 ◦C to re-suspend the pel- the inflammatory response(s) and metabolic let in PBS-1x buffer (10 mmol/L phosphate, 137 activity promoted by food-derived components mmol/L NaCl, 2.7 mmol/L KCl, pH 7.4) until while still maintaining a rapid and inexpensive reaching strain concentrations of 108 cfu/mL. system (Deepika, Rastall, & Charalampopoulos, For each formulation, 1% (v/v) of starter sus- 2011; Kabeerdoss et al., 2011). pension was added to the almond milk and sub- The aim of this study, therefore, was to evaluate sequently incubated at 37 ◦C until pH values of whether almond milk, fermented with different 4.4-4.6werereached,whichwascontrolledbyus- potential probiotic bacteria, affects both the ing a GLP 21+ pH-meter (Crison Instruments energetic metabolism in intestinal cells and the S.A.; Barcelona, Spain). The fermented samples production of pro-inflammatory biomarkers in were frozen and stored at -22 ◦C prior to anal- order to gain insights into the potential benefits ysis. A non-fermented almond sample was used of the designed products for the consumer’s gut as a control (C). health. 2.2 Simulated gastrointestinal 2 Materials and Methods digestion 2.1 Preparation and fermentation The human gastrointestinal digestion process of almond milk was simulated by using porcine pepsin (800- 2, 500 units/mg protein), pancreatin (activity, Almond milk was produced by soaking and 4 USP specifications) and bile, as previously de- grindingalmonds(PrunusamygdalusL. cv. dul- scribedbyLaparra,Barbera,Alegria,Glahn,and cis) supplied by Frutos Secos 3G S.L. (Valen- Miller (2009). All reagents were purchased from cia, Spain). The extraction was carried out in Sigma-Aldrich Co. (St Louis, MO, USA). Prior the Sojamaticfi 1.5 (Barcelona, Spain), equip- to the in vitro digestion, 1.5 mL aliquot of each ment specifically designed for the production assayed sample was diluted in 5mL of a saline of vegetable milks, using a nut:water ratio of solution (140 mmol/L NaCl, 5 mmol/L KCl ad- 8:100. The milky liquid obtained was then mi- justed to pH 3). For gastric digestion (pepsin in crofluidized in a high pressure homogenizer (M- 0.1 mol/L HCl adjusted to pH 3; 1 h), samples 110P model; Microfluidics International Corpo- were placed on a rocking platform shaker in an ration, Westwood, MA, USA) by applying 172 incubator (37 ◦C; 5% CO ; 95% relative humid- 2 MPa, sterilized (121 ◦C/15 min) and subse- ity). Theintestinaldigestion(pancreatin-bileex- quentlycooleddownto37◦C(fermentationtem- tractin0.1mol/LNaHCO adjustedtopH6.9-7; 3 IJFS April 2015 Volume 4 pages 49–60 52 Bernat et al. 2 h) was carried out in the upper chamber of a tures grown in MEM averaged 4.2 ng/mg cell two-chamber system in 6-well plates. protein. Thesampleswereanalyzedintriplicate. The upper chamber was formed by fitting the bottom of an appropriately sized Transwell in- 2.4 Mitochondria enzyme sert ring (Corning B.V. Life Sciences, Amster- activities dam, The Netherlands) with a 15,000 molecu- lar mass cut-off dialysis membrane (Spectra/Por These activities were evaluated in Caco-2 2.1, Spectrum Medical, Gardena, CA, USA). cell cultures by monitoring MTT (3-(4,5- Aliquots (1.5 mL) of the gastrointestinal digest dimethylthiazol-2-yl)-2,3-diphenyl tetrazolium were loaded into the upper chambers and incu- bromide) conversion on exposed cultures after bated for 2 h. Afterwards, the inserts were re- an incubation period of 3 h, following the movedandthe dialysateswerediluted(1:4, v/v) method described by Laparra et al. (2009). This withculturemediaandincubatedwithintestinal colorimetric method is based on the reduction epithelial (Caco-2) or macrophage (RAW 264.7) of the tetrazolium ring of MTT by mitochon- cells. dria dehydrogenases yielding a blue formazan product, which can be measured spectropho- 2.3 Ferritin analysis in intestinal tometrically. For the assays, Caco-2 cells were epithelial cell monolayer seeded at 50,000 cell/cm2 in 24-well culture plates(Costar,Cambridge,MA,USA),andwere grown with DMEM for 12 days. Control cells Caco-2 cells were obtained from the American (basal) exposed to digests containing enzymes Type Culture Collection (Rockville, MD, USA) but not samples were used throughout each at passage 17 and used in experiments at pas- assay. Four replicates were analyzed. sages 33 to 38. Cells were maintained with Dulbecco’s modified Eagle’s medium (DMEM) (Gibcofi, Madrid, Spain) under conditions pre- 2.5 Analysis of pro-inflammatory viously described by Glahn et al. (1998). markers Fortheassays,Caco-2cellswereseededat50,000 cell/cm2 incollagen-treated6-wellcultureplates The inflammatory analyses were carried out (Costar,Cambridge,MA,USA),andweregrown following the method described by Novak et with DMEM for 12 days. On the day prior to al. (2003). For the assays, RAW 264.7 cells the experiments, the DMEM medium was re- were seeded at 50,000 cell/cm2 and were grown placed by 2 mL of minimum essential medium with Roswell Park Memorial Institute (RPMI) (MEM) (Gibcofi, Madrid, Spain) and then the medium (Gibcofi, Madrid, Spain) for 24 hours. cells were returned to the incubator. 50 µmol/L Tumor Necrosis Factor-α (TNF-α) and inter- ofFeCl wereaddedtothedigestedalmondmilk 3 leukin 6 (IL-6) (eBioscience Ltd., Hatfield, UK) samples and the ferritin formation by Caco-2 were determined by ELISA, following the man- cells over a 24 h period was proportional to the ufacturer’s instructions, on exposed RAW 264.7 cell iron uptake. A latex-enhanced turbidimet- cell cultures after an incubation period of 3 h. ric immunoassay (Ferritin-turbilatex; Spinreact, Results were expressed as picograms per mL of Girona, Spain) was used to measure the Caco-2 media. Four replicates were analyzed. cell ferritin content, as Glahn et al. (1998) de- scribed. The concentrations of ferritin were nor- malizedbythedeterminationofthetotalprotein 2.6 Statistical analysis content in cell cultures by using a microLowry kit (TP0200) (Sigma-Aldrich, St. Louis, MO, Each of the experiments was conducted on four USA). The control cells (basal), exposed to in independent replicates. A one-way analysis of vitro digestions of control solutions containing variance (ANOVA) and the Tukey post hoc test digestive enzymes but not sample, were moni- were applied. Statistical significance was estab- tored throughout. Base-line cell ferritin in cul- lished at a confidence level of 95% for all the IJFS April 2015 Volume 4 pages 49–60 Fermented almond milks improve bioavailability of iron 53 comparisons. SPSS v.15 software (SPSS Inc., 3.2 Bacterial fermentation effects Chicago, IL, USA) was used for the statistical on TNFα and IL-6 production analysis. Figure 1 shows the Tumor necrosis factor (TNF)-α and interleukin (IL)-6 production in 3 Results and Discussion macrophage (RAW 264.7 cells) cultures exposed to digests of fermented milks. A non-fermented almond milk was used as a control (C). 3.1 Almond milk and their Focusingonthecellstreatedwithdialyzablefrac- fermented-derivative products tionsamplesnotfermentedbyusingbifidobacte- ria (F1 to F5) (Table 2), fermentation with ei- ther L. rhamnosus (F2) or L. plantarum (F3) The use of high pressure homogenization (HPH) decreased the TNF-α production (p< 0.05) by a contributed to a better stability of the almond similar amount with respect to the control (C). milk, since this emergent microfluidization tech- When the standard yoghurt bacteria was used nology is able to reduce the size of fat glob- (F1), the TNF-α production was similar to the ule particles, greatly delaying the flocculation control. Oppositeeffectswereobservedwhenthe andcoagulationphenomena(LujanCapraetal., fermentation was developed by combining those 2009; Cruz et al., 2009). lactobacilli with standard yoghurt bacteria (F4 The chemical composition of the almond milk and F5, respectively), since the TNF-α produc- used for fermentations, which is subsequently tion increased (p< 0.05) compared to the con- codified as control (C), is summarized in Table trol (Figure 1). As regards the IL-6, and con- 1. Taking into account the nut:water ratio used, trarytothatobservedinTNF-α,allsampleshad these values are similar to those found in the lit- a positive effect in the production of this pro- erature (Yada, Lapsley, & Huang, 2011). inflammatorymarkerwithrespecttothecontrol, The initial pH of the almond milk (C) was 6.61 especially when the almond milk fermentation ±0.08. AsignificantdeclineinpHto4.60±0.02 was done by using mixed-cultures (F4 and F5). after 20 h at 37 ◦C of incubation, took place in These samples exhibited the lowest IL-6 concen- thedevelopedproductsalongwithacorrespond- trations (p< 0.05), showing 55-70% of inhibition ing increase in acidity caused by fermentation. (p< 0.05) of the initial IL-6 production induced by non-fermented almond milk (C) (Figure 1). Withrespecttothesamplesfermentedusingthe Table 1: Chemical composition of almond milks bifidobacteria (F6 to F11), all the cells exposed used in the study. Values (mean ± standard de- to those dialyzed samples exhibited a very low viation) are expressed as grams per 100 mL of TNF-α production in comparison to the con- beverage. trol (p< 0.05). When considering IL-6 produc- Compound Concentration tion, different patterns were observed depending on the type of bifidobacteria present in starter. Dry matter 6.64 ± 0.5 As Figure 1 shows, the fractions from fermented Lipids 3.96 ± 0.2 samples with B. bifidum (F6, F8 and F10) in- Proteins 1.37 ± 0.03 duced cells to produce IL-6 amounts similar to Total sugars 0.41 ± 0.002 that obtained in fermented samples with stan- Ashes 0.325 ± 0.012 dard yoghurt bacteria (F1). However, with B. Fiber 0.58* longum (F7, F9 and F11) lower (p< 0.05) IL-6 concentrations were quantified, especially when *Fiberconcentrationwasobtainedbysubtractingthe it was combined with either standard yoghurt dry matter content from the sum of the rest of com- bacteria (F7) or L. plantarum (F11). pounds shown. TNF-α is a pro-inflammatory factor produced by macrophages that exerts important effects on IJFS April 2015 Volume 4 pages 49–60 54 Bernat et al. Figure 1: Tumor necrosis factor (TNF)-α and interleukin (IL)-6 production in macrophage (RAW 264.7 cells) cultures exposed to digests of fermented milks. C: non-fermented almond milk. Basal: cells not exposed to samples.*a-e DifferentsuperscriptlettersindicatesignificantdifferencesbetweensamplesinTNF-α production (p< 0.05). * w-z Different superscript letters indicate significant differences between samples in IL-6 production (p< 0.05). Table 2: Microbial strains used to produce the different fermented almond milks. Formulation Starters inoculum C - - - F1 - - S. thermophilus + L. delbrueckii F2 L. rhamnosus - - F3 L. plantarum - - F4 L. rhamnosus - S. thermophilus + L. delbrueckii F5 L. plantarum - S. thermophilus + L. delbrueckii F6 - B. bifidum S. thermophilus + L. delbrueckii F7 - B. longum S. thermophilus + L. delbrueckii F8 L. rhamnosus B. bifidum - F9 L. rhamnosus B. longum - F10 L. plantarum B. bifidum - F11 L. plantarum B. longum - L.: Lactobacillus B.: Bifidobacterium S.: Streptococcus IJFS April 2015 Volume 4 pages 49–60 Fermented almond milks improve bioavailability of iron 55 systemic inflammation and induces the produc- deed,previousinvitroandinvivostudiescarried tion of other inflammatory cytokines such as IL- out by using these bacteria species also showed 6 orIL-8 (Hu, Kobayashi, Zenda, & Shimamura, positive effects in immunomodulatory responses 1997). The observed bacterial fermentation ef- (Laparra, Olivares, Gallina, & Sanz, 2012; La- fects could have important consequences on the parra & Sanz, 2010). Nevertheless, despite the intestinal barrier function because TNF-α plays results, the differences from different probiotic a crucial role by increasing paracellular perme- strains used are yet to be investigated in detail. abilityandimpairingtightjunctionfunctionality (Maetal.,2004)andleukocyteinfiltrationinthe 3.3 Bacterial fermentation effects intestinal wall (Hoffman, 2000). In addition, the reduction in TNF-α production might also have on energetic metabolism of importantphysiologicalconsequencespreventing intestinal cells allergic inflammatory processes. Almonds are known to have several nutritional Resultsofthepossibletoxicityoffermentedsam- benefits, including that of lowering cholesterol ples in intestinal epithelial (Caco-2) cells, which and protection against diabetes (Rajaram et al., was quantified by monitoring the mitochondrial 2010; Sabat´e et al., 2003). Furthermore, sci- enzyme (MTT test) activities, are shown in Fig- entific studies have pointed to their potential ure 2. The intestinal epithelium constitutes prebiotic and anti-inflammatory activities (Ra- the first physiological barrier to exogenous com- jaram et al., 2010; Mandalari et al., 2008). Al- pounds and nutrient absorption. Mitochon- mond lipids and carbohydrates available for fer- dria and endo-lysosomal enzyme activities were mentation have been associated with increasing proven to be sensitive biomarkers of changes in both the number of bifidobacteria strains and cellular metabolism in response to internalized the short chain fatty acids (SCFA) content, es- food-derived compounds (Laparra et al., 2009; pecially in butyrate concentrations (Mandalari Wu et al., 2010). This MTT assay showed et al., 2008). Butyric acid has the potential that none of the dialysates exposed to cell cul- to benefit colonic health, since it reduces hy- tures seem to cause toxic effects, as concluded drogen peroxide in cells and maintains their in- from the fact that the MTT values were similar tegrity (Scott, Martin, Duncan, & Flint, 2014). (p< 0.05) to those calculated for basal culture Although bifidobacteria strains are not able to (cells not exposed to almond milk samples). As produce butyrate, they synthesize other SCFA mentionedabove,possiblesynergismbetweenal- such as acetate which can be used by other bac- mondconstituents(prebiotics)andstarterbacte- teria (i.e. lactobacilli) in their metabolic route riamighthaveproducedcellprotectivebioactive to synthesize this cells’ protective acid (Falony, compounds (i.e. butyrate) (Falony et al., 2006; Vlachou, Verbrugghe, &DeVuyst, 2006). More- Scott et al., 2014) which prevented alterations over, this butyric production may be enhanced oftheCaco-2mythocondriaandendo-lyososomal in the presence of prebiotics (i.e. almond fibers) enzymatic activity. (Falony et al., 2006; Scott et al., 2014). These Particularly, the MTT values showed that facts are coherent and might explain the marked dialysates from samples fermented with L. plan- positive effects observed in the inflammatory re- tarum 3O9 (F3) (Table 2) stimulated the en- sponses induced by dialysates from samples in- ergetic cell metabolism, similar to that of non- oculated with bifidobacteria. Nevertheless, the fermented almond milk (C) (p< 0.05). How- active components above mentioned (SCFA and ever, when these bacteria were used in combina- prebiotics) have not been analysed since they tionwithstandardyoghurtbacteria,theresulted were beyond the objective of this study. dialysates (F4 and F5) did not have this signifi- As the results suggest, the involvement of ei- cant stimulatory effect. ther B. bifidum or B. longum in the develop- Both MTT results (Figure 2) and the ones ob- mentoffermentedalmond-basedproductsmight tainedintheproductionofpro-inflammatorycy- be of interest in order to reduce inflammatory tokinesbyimmunecells(Figure1)indicatedthat intestinalprocessesofatargetedpopulation. In- almond fermented products might exert benefi- IJFS April 2015 Volume 4 pages 49–60 56 Bernat et al. Figure 2: MTT conversion percentages in Caco-2 cell cultures exposed to digests of fermented milks. (C: non-fermented almond milk; Basal: cells not exposed to samples). * a,b Different superscript letters indicate significant differences(p< 0.05) between samples. cialeffectsonhumanguthealth,especiallywhen trices, such as carrot juice (Bergqvist, Andlid, using standard yoghurt bacteria with B. longum & Sandberg, 2006), maize (Proulx & Reddy, (F7) and L. rhamnosus with B. longum (F9) as 2007) or beans (Laparra, Tako, Glahn, & Miller, starters. 2008). This study, hence, extends the bacterial- mediatedpositiveeffectsonironuptakefromfer- mented vegetable products, particularly those in 3.4 Iron uptake in the presence of which the starter culture contains bifidobacte- fermented almond milk ria strains. In addition, it has been reported that almond extracts exhibited excellent metal Ferritin concentrations in cell cultures exposed ion chelation efficacies (ability to maintain oli- todifferentdialyzedfermentedalmondmilks are goelements such as iron in the reduced form shown in Figure 3. Apparently, the fermenta- needed to be absorbed by the epithelial cells), tion process improved the bioavailability of iron, owingtoitssourceofbioactivepolyphenolswith since the resultant Caco-2 iron uptake in every antioxidant activity (Garrido, Monagas, Gomez- fermented formulation was higher than that ob- Cordoves, & Bartolome, 2008; Wijeratne, Abou- tained in the cells exposed to non-fermented al- Zaid, & Shahidi, 2006). These almond-derived mond milk dialysates (C) (p< 0.05). In par- components with functional characteristics may ticular, samples fermented with L. rhamnosus, also be present in the fermented samples and with either B. bifidum (F8) or B. longum (F9), might explain, at least in part, the effects ob- were the ones which induced the most iron up- served. take(p<0.05). Previousstudieshavealsoshown Therefore, as Figure 3 suggested, fermented the in vitro enhancing effect of probiotic bacte- almond milk may provide health benefits to ria on iron uptake in fermented vegetable ma- IJFS April 2015 Volume 4 pages 49–60 Fermented almond milks improve bioavailability of iron 57 Figure 3: Ferritin concentration in Caco-2 cultures exposed to digested fermented milks with added FeCl (50 µmol/L). (MEM: Minimum Essential Medium; C: non-fermented almond milk; Basal: cells 3 not exposed to samples).* a,e Different superscript letters indicate significant differences (p< 0.05) between samples. consumers owing to its ability to increase the lialcells,especiallywhenthisvegetablemilkwas bioavailability of dietary iron. Moreover, this fermented with either standard yoghurt bacte- positive effect observed could have important ria and B. longum CECT 4551 or L. rhamnosus consequences as fermented almond milk might CECT278andB.longum. Moreover,somecom- preserve the nutritional iron status in the pedi- binationsofspecificstrainshadmarkedlysignifi- atric community which appears to be the most cantpositiveeffectsontheironuptakebyintesti- susceptible population to the negative effects of nalepithelialcellsthatcouldhelptoimprovethe cow-milk. Furthermore, the intake of this type nutritionalstatusoftargetedconsumers. Inpar- ofproductcouldreduceallergiesandintolerances ticular, samples inoculated with L. rhamnosus derivedfromtheconsumptionofcow-milkbythis CECT 278 and either B. bifidum CECT 870 or population (Agostoni & Turck, 2011). B. longum CECT4551exhibitedthehighestfer- ritin concentrations in Caco-2 cultures. The ob- tainedresultsalsosuggestanimprovementinthe 4 Conclusions bioactivity of almond milk due to fermentation; nevertheless, theidentificationofbiologicallyac- This study has shown that almond milk fer- tive components is needed and will provide fur- mented with potentially probiotic bacteria ex- ther insights into the potential nutritional and erted positive immunomodulatory effects on healthbenefitsoffermentedalmond-basedprod- macrophages and did not impair negative effects ucts. Tosumup,theresultssuggestthatalmond on the energetic metabolism of intestinal epithe- milk fermented with potentially probiotic bacte- IJFS April 2015 Volume 4 pages 49–60

See more

The list of books you might like