Logout succeed
Logout succeed. See you again!

Alternating Minimization Algorithms for Hybrid Precoding in Millimeter Wave MIMO Systems PDF
Preview Alternating Minimization Algorithms for Hybrid Precoding in Millimeter Wave MIMO Systems
1 Alternating Minimization Algorithms for Hybrid Precoding in Millimeter Wave MIMO Systems Xianghao Yu, Student Member, IEEE, Juei-Chin Shen, Member, IEEE, Jun Zhang, Senior Member, IEEE, and Khaled B. Letaief, Fellow, IEEE Abstract—Millimeter wave (mmWave) communications has by 2020 [2]. One way to boost the capacity is to improve the beenregardedasakeyenablingtechnologyfor5Gnetworks,asit spectral efficiency through physical layer techniques, such as offersordersofmagnitudegreaterspectrumthancurrentcellular massivemultiple-input-multiple-output(MIMO)andadvanced bands.Incontrasttoconventionalmultiple-input-multiple-output 6 channel coding [3]. Further improvement in area spectral (MIMO) systems, precoding in mmWave MIMO cannot be 1 performedentirelyatbasebandusingdigitalprecoders,asonlya efficiency can be achieved by network densification, such 0 limitednumberofsignalmixersandanalog-to-digitalconverters as deploying small cells [4], [5] and allowing device-to- 2 (ADCs) can be supported considering their cost and power device (D2D) communications [6], and enabling advanced n consumption. As a cost-effective alternative, a hybrid precoding cooperation, such as Cloud-RANs [7], [8]. Nevertheless, the a transceiver architecture, combining a digital precoder and an spectrum crunch in current cellular systems brings a funda- J analog precoder, has recently received considerable attention. 7 However, the optimal design of such hybrid precoders has not mental bottleneck for the further capacity increase. Thus, it 2 beenfullyunderstood.Inthispaper,treatingthehybridprecoder is critical to exploit underutilized spectrum bands, including design as a matrix factorization problem, effective alternating thebandsthathavenotbeenusedforcellularcommunications ] minimization (AltMin) algorithms will be proposed for two yet. T different hybrid precoding structures, i.e., the fully-connected Millimeter wave (mmWave) bands from 30 GHz to 300 I and partially-connected structures. In particular, for the fully- s. connected structure, an AltMin algorithm based on manifold GHz, previously only considered for outdoor point-to-point c optimizationisproposedtoapproachtheperformanceofthefully backhaul links [9] or for carrying indoor high-resolution mul- [ digital precoder, which, however, has a high complexity. Thus, a timedia streams [10], have now been put forward as a prime 1 low-complexity AltMin algorithm is then proposed, by enforcing candidate for new spectrum in 5G cellular systems, with the an orthogonal constraint on the digital precoder. Furthermore, v potential bandwidth reaching 10 GHz. This view is supported forthepartially-connectedstructure,anAltMinalgorithmisalso 0 developed with the help of semidefinite relaxation. For practical byrecentexperimentsinNewYorkCitythatdemonstratedthe 4 implementation, the proposed AltMin algorithms are further feasibility of mmWave outdoor cellular communications [11], 3 extended to the broadband setting with orthogonal frequency [12].Originally,themainobstaclesforthesuccessofmmWave 7 division multiplexing (OFDM) modulation. Simulation results 0 cellular systems are the huge path loss and rain attenuation, will demonstrate significant performance gains of the proposed . as a result of the ten-fold increase of the carrier frequency 1 AltMin algorithms over existing hybrid precoding algorithms. 0 Moreover,basedontheproposedalgorithms,simulationcompar- [11]. Thanks to the small wavelength of mmWave signals, 6 isons between the two hybrid precoding structures will provide mmWave MIMO precoding can leverage large-scale antennas 1 valuable design insights. at transceivers to provide significant beamforming gains to v: Index Terms—Alternating minimization, hybrid precoding, combat the path loss and to synthesize highly directional i low-complexity, manifold optimization, millimeter wave commu- beams. Moreover, spectral efficiency can be further increased X nications, semidefinite relaxation. by transmitting multiple data streams via spatial multiplexing. r For traditional MIMO systems, precoding is typically ac- a I. INTRODUCTION complished at baseband through digital precoders, which can THE capacity of wireless networks has to exponentially adjust both the magnitude and phase of the signals. How- ever, fully digital precoding demands radio frequency (RF) increasetomeettheexplosivedemandsforhigh-data-rate chains, including signal mixers and analog-to-digital convert- multimedia access. In particular, the upcoming 5G networks ers (ADCs), comparable in number to the antenna elements. aim at carrying out the projected 1000X increase in capacity WhilethesmallwavelengthsofmmWavefrequenciesfacilitate Manuscript received June 1, 2015; revised November 6, 2015; accepted theuse ofalarge numberofantennaelements, theprohibitive January 13, 2016. This work was supported by the Hong Kong Research cost and power consumption of RF chains make digital pre- Grants Council under Grant No. 610212. The guest editor coordinating the coding infeasible. Given such unique constraints in mmWave reviewofthispaperandapprovingitforpublicationwasDr.RobertW.Heath. ThisworkwaspresentedinpartatIEEEGlobalCommunicationsConfer- MIMO systems, a hybrid precoding architecture has recently ence,SanDiego,CA,Dec.2015[1]. received much consideration, which only requires a small X.Yu,J.Zhang,andK.B.LetaiefarewiththeDepartmentofElectronicand number of RF chains interfacing between a low-dimensional ComputerEngineering,theHongKongUniversityofScienceandTechnology (HKUST),ClearWaterBay,Kowloon,HongKong(email:{xyuam,eejzhang, digital precoder and a high-dimensional analog precoder [13]. eekhaled}@ust.hk).K.B.LetaiefisalsowithHamadBinKhalifaUniversity, As the analog precoders are still of high dimension, it is Qatar(email:[email protected]). impractical to implement them in the RF domain with power- J.-C. Shen is with MediaTek Inc., Hsinchu City 30078, Taiwan (e-mail: [email protected]). hungryvariablevoltageamplifiers(VGAs)[12].Thisheuristic 2 leads to a rule of thumb, i.e., realizing analog precoders with the computation complexity of the OMP algorithm [21], [25], low-costphaseshiftersattheexpenseofsacrificingtheability e.g., by reusing the matrix inversion result in each iteration. to change the magnitude of the RF signals. Thereareworksinvestigatingsomespecialhybridprecoding According to the mapping from RF chains to antennas, systems.In[26],anoptimalhybridprecoderdesigninaspecial which determines the number of phase shifters in use, the case was identified, i.e., when the number of RF chains is hybrid precoding transceiver architectures can be categorized at least twice that of the data streams. However, the optimal into the fully-connected and partially-connected structures, solution for the general case is unknown. The authors of as illustrated in Fig. 1(b) and Fig. 1(c), respectively. The [28] investigated VGA-enabled hybrid precoding according former structure enjoys the full beamforming gain for each to different design criteria. By removing VGAs from the RF chain with a natural combination between RF chains and RF domain, low-power analog precoders with phase shifters antenna elements, i.e., each RF chain is connected to all were also considered in [28], whose phases are heuristically antennas. On the other hand, sacrificing some beamforming extracted from those of the VGA-enabled solution. gain,thepartially-connectedstructuresignificantlyreducesthe On the other hand, much less attention has been paid hardware implementation complexity by connecting each RF on the partially-connected structure [29]–[34]. In [29], [30], chain only with part of the antennas. codebook-based design of hybrid precoders was presented for In[13],ithasbeenpointedoutthatmaximizingthespectral narrowband and orthogonal frequency division multiplexing efficiency of mmWave systems can be approximated by min- (OFDM) systems, respectively. Although the codebook-based imizing the Euclidean distance between hybrid precoders and design enjoys a low complexity, there will be certain perfor- the fully digital precoder. This renders the hybrid precoder mance loss, and it is not clear how much performance gain design as a matrix factorization problem with unit modulus can be further obtained. By utilizing the idea of successive constraintsimposedbythephaseshifters.Althoughsignificant interference cancellation (SIC), an iterative hybrid precoding amounts of research efforts have been invested in solving var- algorithm for the partially-connected structure was proposed ious matrix factorization problems in recent years [14], [15], in [31]. The algorithm is established based on the assumption with the unique unit modulus constraints, the optimal design that the digital precoding matrix is diagonal, which means of hybrid precoders remains unknown. Existing works often that the digital precoder only allocates power to different data add some extra constraints on analog precoders to simplify streams, and the number of RF chains should be equal to that the analog part design with unit modulus constraints, which of the data streams. However, using only analog precoders to will cause performance loss. This motivates us to reconsider providebeamforminggainsisobviouslyasuboptimalstrategy the hybrid precoder design or, in other words, the matrix [31], [32], which also deviates from the motivation of hybrid factorizationproblemwithunitmodulusconstraintsonanalog precoding. So far there is no study directly optimizing the precoders. In particular, a better way to deal with the unit hybrid precoders without extra constraints in the partially- modulus constraint deserves further delicate investigations. connected structure, which will be pursued in this paper. Inthispaper,byadoptingalternatingminimization(AltMin) B. Contributions asthemaindesignapproach,wewillproposedifferenthybrid precodingalgorithmstoapproachtheperformanceoftheopti- In this paper, we investigate the hybrid precoder design in malfullydigitalprecoder.Basedontheprincipleofalternating mmWaveMIMOsystems.Wewilladoptalternatingminimiza- minimization, three novel algorithms will be proposed to find tion (AltMin) as the main design principle, which helps de- effective hybrid precoding solutions for the fully-connected coupletheprecoderdesignproblemintotwosubproblems,i.e., and partially-connected structures. the analog and digital precoder design. The proposed AltMin algorithms will alternately optimize the digital precoder and the analog precoder. Our major contributions are summarized A. Related Works as follows: Hybridprecodingisanewly-emergedtechniqueinmmWave • For the fully-connected structure, we shall show that the MIMO systems [16]–[20]. So far the main efforts are on the unit modulus constraints of the analog precoder define a fully-connectedstructure[13],[21]–[28].Orthogonalmatching Riemannian manifold. We will thus propose a manifold pursuit(OMP)isthemostwidelyusedalgorithm,whichoften optimizationbasedAltMin(MO-AltMin)algorithm.This offers reasonably good performance. This algorithm requires algorithm does not need any pre-determined candidate the columns of analog precoding matrix to be picked from set for the analog precoder, and it is the first attempt to certain candidate vectors, such as array response vectors of directly solve the hybrid precoder design problem under the channel [13], [21], [22], and discrete Fourier transform the unit modulus constraints. (DFT) beamformers [23], [24]. Hence, the OMP-based hybrid • By imposing an orthogonal property of the digital pre- precoder design can be viewed as a sparsity constrained coder, we then develop an AltMin algorithm using phase matrix reconstruction problem. Though the design problem extraction (PE-AltMin) as a low-complexity counterpart is greatly simplified in this way, restricting the space of of the MO-AltMin algorithm, which will also be more feasible analog precoding solutions inevitably causes some practical for implementation. performanceloss.Additionally,extraoverheadwillbebrought • For the partially-connected structure, we propose a up for acquiring the information of array response vectors in semidefinite relaxation based AltMin (SDR-AltMin) al- advance.Morerecentattentionhasmainlyfocusedonreducing gorithm. This algorithm effectively designs the hybrid 3 AnalogRF PArencaoldoegrRF Precoder AnalogRF PArencaoldoegrRF Precoder RF Chain Digital Mapping Baseband Via Analog Precoder RF Precoder RF Chain (a) MmWaveMIMOtransmitterarchitecture. (b) Themappingstrategyforthe (c) The mapping strategy for the fully-connectedstructure. partially-connectedstructure. Fig. 1. Two structures of hybrid precoding in mmWave MIMO systems using different mapping strategies: each RF chain is connected to Nt antennas in (b)andtoNt/NRtF antennasin(c). precodersbyofferingoptimalsolutionsforbothsubprob- In Section V, the hybrid precoder design for the partially- lems of analog and digital precoders in each alternating connectedstructureisinvestigated.Extensionsoftheproposed iteration, and it is the first effort directly optimizing the algorithms to OFDM systems are provided in Section VI, and hybrid precoders in such a structure. simulationresultswillbepresentedinSectionVII.Finally,we • The three proposed AltMin Algorithms can be gener- will conclude this paper in Section VIII. ally applied to both narrowband and broadband OFDM systems. Simulation results will demonstrate that the D. Notations MO-AltMinalgorithmefficientlyidentifiesanear-optimal The following notations are used throughout this paper. a solution, while the PE-AltMin algorithm with practical and A stand for a column vector and a matrix, respectively; computational complexity outperforms the existing OMP A is the entry on the ith row and jth column of A; algorithm. i,j The conjugate, transpose and conjugate transpose of A are • With the proposed AltMin algorithms, extensive compar- represented by A∗, AT and AH; det(A) and A denote isons are provided to reveal valuable design insights. In (cid:107) (cid:107)F the determinant and Frobenius norm of A; A−1 and A† are particular, the proposed AltMin algorithms for the fully- the inverse and Moore-Penrose pseudo inverse of A; Tr(A) connectedstructurecanhelptoapproachtheperformance and vec(A) indicate the trace and vectorization; Expectation of the fully digital precoder as long as the number of RF chains is comparable to the number of data streams, and the real part of a complex variable is noted by E[·] and []; and denote the Hadamard and Kronecker products which cannot be achieved by the widely applied OMP (cid:60)· ◦ ⊗ between two matrices. algorithm.Ontheotherhand,theSDR-AltMinalgorithm for the partially-connected structure provides significant gains over analog beamforming. Furthermore, by taking II. SYSTEMMODELANDPROBLEMFORMULATION advantage of its low-complexity hardware implementa- In this section, we will first present the system model and tion, the partially-connected structure provides a higher channelmodeloftheconsideredmmWaveMIMOsystem,and energy efficiency than the fully-connected one with a then formulate the hybrid precoding problem. relatively large number of RF chains implemented at transceivers. A. System Model Thus, our results firmly establish the effectiveness of the Consider a single-user mmWave MIMO system1 as shown alternating minimization as a key design methodology for in Fig. 1(a), where N data streams are sent and collected by hybrid precoder design in mmWave MIMO systems. s N transmit antennas and N receive antennas. The numbers t r of RF chains at the transmitter and receiver are respectively C. Organization denoted as Nt and Nr , which are subject to constraints RF RF N Nt N and N Nr N . The remainder of this paper is organized as follows. We s ≤ RF ≤ t s ≤ RF ≤ r The transmitted signal can be written as x = F F s, shallintroducethesystemmodelandchannelmodel,followed RF BB by the problem formulation in Section II. Two alternating where s is the Ns ×1 symbol vector such that E ssH = minimization algorithms for the fully-connected structure are 1Thereceiversideisomittedduetospacelimitation.Moredet(cid:2)ailsca(cid:3)nbe demonstrated in Section III and Section IV, respectively. foundin[13]. 4 1 I . The hybrid precoders consist of an Nt N digital of the lth ray in the ith propagation cluster. We assume bNasseNbasndprecoderF andanN Nt analRoFg×RFpsrecoder that α are i.i.d. and follow the distribution (0,σ2 ) and BB t× RF il CN α,i F(cid:107)bFaRnRFdF.bFTloBhcBek(cid:107)-n2Ffoard=minaNglispz.eroFdpoatrrgasainmtsiompnliitccihptyao,nwwneeerl,ficwroshntisclteorantihsnietdeeixsrtaegnnivsaeironrnowbtoy- (cid:80)E Ni(cid:107)=cH1l σ(cid:107)α22F,i ==γˆN,twNhri.chInisadtdhietionno,rmara(liφzrialt,ioθinrl)faacntdoratto(φstial,tiθsitfly) represent the receive and transmit array response vectors, broadbandOFDMsystemswillbetreatedinSectionVI.Thus, (cid:104) (cid:105) where φr(φt) and θr(θt) stand for azimuth and elevation the received signal after decoding processing is given as il il il il angles of arrival and departure, respectively. In this paper, y=√ρWH WH HF F s+WH WH n, (1) we consider the uniform square planar array (USPA) with BB RF RF BB BB RF √N √N antenna elements. Therefore, the array response whereρstandsfortheaveragereceivedpower,Histhechan- × vector corresponding to the lth ray in the ith cluster can be nel matrix, W is the Nr N digital baseband decoder, BB RF× s written as W istheN Nr analogRFdecoderatthereceiver,and n(i.ii.sRdFt.h)enoi(s0e,vσre×2c)toreRloeFfminendtesp.enIndetnhtisanpdaipdeern,tiwcaellyasdsiusmtriebuttheadt a(φil,θil)= √1N 1,··· ,ej2λπd(psinφilsinθil+qcosθil), CN n (cid:20) (4) perfect channel state information (CSI) is known at both the √ √ T transmitterandreceiver.Inpractice,CSIcanbeaccuratelyand ,ej2λπd(( N−1)sinφilsinθil+( N−1)cosθil) , ··· efficiently obtained by channel estimation [18] at the receiver (cid:21) and further shared at the transmitter with effective feedback where d and λ are the antenna spacing and the signal wave- techniques [13], [35]. The achievable spectral efficiency when length, and 0 p < √N and 0 q < √N are the antenna ≤ ≤ transmitted symbols follow a Gaussian distribution can be indices in the 2D plane. While this channel model will be expressed as usedinsimulations,ourprecoderdesignisapplicabletomore general models. ρ † R=logdet I + (W W ) HF F Ns σ2N RF BB RF BB (cid:18) n s (2) C. Problem Formulation FH FH HH(W W ) . × BB RF RF BB Asshownin[13],[21],thedesignofprecodersanddecoders (cid:19) can be separated into two subproblems, i.e., the precoding Furthermore,theanalogprecodersareimplementedwithphase and decoding problems. They have similar mathematical for- shifters,whichcanonlyadjustthephasesofthesignals.Thus, mulations except that there is an extra power constraint in allthenonzeroentriesofF andW shouldsatisfytheunit RF RF the former. Therefore, we will mainly focus on the precoder modulusconstraints,namely (F ) = (W ) =1for RF i,j RF i,j | | | | design in the remaining part of this paper and the algorithms nonzero elements. proposed in this paper can be equally applied for the decoder. According to different signal mapping strategies from RF The corresponding problem formulation is given by chains to antennas, the transceiver architecture can be catego- rized into the fully-connected and partially-connected hybrid minimize F F F precoding structures, as illustrated in Fig. 1(b) and Fig. 1(c). FRF,FBB (cid:107) opt− RF BB(cid:107)F (5) For the fully-connected structure, the output signal of each F RF subjectto ∈A RwFhilcehtahine pisarstieanltlyt-ocoanlnletchteedansttreuncntausrethornoluyghhasphNase/Nshtiftearns-, (cid:40)(cid:107)FRFFBB(cid:107)2F =Ns, t RF tennas connected to each RF chain. Thus, the fully-connected whereFopt standsfortheoptimalfullydigitalprecoder,while structure enjoys full beamforming gain for each RF chain FRF and FBB are the analog and digital precoders to be with a natural combination between RF chains and antennas, optimized. Additionally, f, p is the feasible set of A ∈ {A A } whereas the hardware implementation complexity is lower in the analog precoder induced by the unit modulus constraints, the partially-connected one by sacrificing some beamforming whichwillbedistinctfordifferenthybridprecodingstructures. gain for each RF chain. The structures of F s and W s It has been shown in [13] that minimizing the objective RF RF will vary for different structures, which will be discussed in function in (5) approximately leads to the maximization of the following sections in detail. the spectral efficiency. It is also intuitively true that the optimal hybrid precoders should be sufficiently “close” to the unconstrained optimal digital precoder. In addition, the B. Channel Model unconstrained optimal precoder and decoder are comprised of Due to high free-space path loss, the mmWave propagation the first N columns of V and U respectively, which are environment is well characterized by a clustered channel s unitary matrices derived from the channel’s singular value model, i.e., the Saleh-Valenzuela model [12]. This model decomposition (SVD), i.e., H=UΣVH. depicts the mmWave channel matrix as We will mainly treat problem (5) as a matrix factorization N N Ncl Nray problem, for which alternating minimization will be adopted H=(cid:115)NcltNrray αilar(φril,θirl)at(φtil,θitl)H, (3) asthemaintool.Alternatingminimizationrepresentsawidely i=1 l=1 applicable and empirically successful approach for the opti- (cid:88) (cid:88) where N and N represent the number of clusters and mization problems involving different subsets of variables. It cl ray the number of rays in each cluster, and α denotes the gain has been successfully applied to many applications such as il 00˙AMS September 23, 2007 38 CHAPTER 3 1. R-linear: (af + bg)= a (f)+ b (g), (a, b R), and D D D ∈ 2. Leibnizian: (fg)= (f)g+ f (g). D D D Every vector field ξ X( ) defines a derivation f ξf. Conversely, every ∈ M 7→ derivation on F( ) can be realizedas a vectorfield. (Viewingvectorfields as M derivations comes in handy in understandingLie brackets; see Section5.3.1.) 3.5.6 Differential of a mapping Let F : be a smooth mapping between two manifolds and . M → N M N Let ξ be a tangent vector at a point x of . It can be shown that the x M mapping DF (x)[ξx] from FF(x)( ) to R defined by N 5 (DF (x)[ξ]) f := ξ(f F ) (3.13) ◦ is a tangent vector to at F (x). The tangent vector DF (x)[ξ ] is realized x matrixcompletion[14],phaseretrieval[36],imagereconstruc- The main obstacles are the unit modNulus constraints, which by F γ, where γ is any curve that realizes ξ . The mapping x tion [37], blind deconvolution [38] and non-negative matrix areintrinsicallynon◦-convex.Tothebestoftheauthors’knowl- factorization [39]. In this paper, the problem formulation (5) edge,thereisnogeneralapproacDhFto(sxo)lv:e T(x8)optimaTlFly(.xI)nth:e ξ DF (x)[ξ] M→ N 7→ is intrinsically a matrix factorization problem involving two following, we will propose an effective manifold optimization is a linear mapping called the differential (or differential map, derivative, or matrix variables F and F . However, jointly optimizing algorithm to find a near-optimal solution of problem (8). RF BB tangent map) of F at x (see Figure 3.5). these two variables is highly complicated due to the element- wise unit modulus constraints of F . By decoupling the RF ξ DF(x)[ξ ] x x optimization of these two variables, alternating minimization sstoalnudtisono.uWt iaths tahne perfifincciiepnlte mofetahlotedrnatotinogbmtaiinnimainzaetifofnec,tiwvee TxM DF(x) TF (x)N F (x) x willalternatelysolveforF andF whilefixingtheother, RF BB which will be the essential idea throughout this paper. III. MANIFOLDOPTIMIZATIONBASEDHYBRID γ F (γ(t)) PRECODINGFORTHEFULLY-CONNECTEDSTRUCTURE The fully-connected structure, in which each RF chain is F N connected to all the antenna elements, is frequently used in mmWaveMIMOsystems,asshowninFig.1(b).Thisstructure M restricts every entry in the analog precoding matrix to be unit modulus,andthiselement-wiseconstraintmakestheprecoder Fig.2. ThetangentspaceandtangentvectoFroigfuarRei e3m.a5n nDianiffmearneinfotlida[l4 m1].ap of F at x. design problem intractable. In this section, by observing that the unit modulus constraints define a Riemannian manifold, We will starNt owtieth tshoamt eFd eifisn iatino nismamndertseiromni n(orleosgpieesctiinvely, submersion) if and only if we will propose an AltMin algorithm based on manifold manifold optDimFiz(xat)io:n .TxMore baTckFg(xro)undiso nanm iannjiefcotlidosna(nrdespectively, surjection) for every M → N optimization to directly solve (5). manifold optxim izatio.n can be found in [41]–[43], and there ∈M For the fully-connected structure, inspired by [40], the au- aresomerecentIfappliciast iao nvseicntworireslpeasscec om,m tuhneinca ttihones c[a44n]o.nical identification TF(x) N E E ≃ E thorsof[26]haveshownthattheFrobeniusnormin(5)canbe As shown inyFieigld.s2 , a manifold is a topological space that M made exactly zero under the condition that Nt 2N . This resembles a Euclidean space near each point [43]. In other RF ≥ s DF (x)[ξ ]= (ξ F i)e , (3.14) means that the hybrid precoders can achieve the performance words, each point on a manifold has a neighboxrhood thatx i of the fully digital precoder in this special case, and the is homeomorphic to the Euclidean space. The tangent Xspia ce optimalhybridprecoderswereobtainedin[26].Thus,wewill TxM at a giwvehnerpeo iFn t(xx)o=n thei mF ai(nxif)oeldi iMs thies dcoemcopmospeodsoitfion of F (x) in a basis (ei)i=1,...,n focus on the region where Ns ≤NRtF <2Ns in this paper. tIhnemtaonsgteanptpvoliefcc IaEtftoi.orsnsξ=,xm Roaf,n ittfhhoPeeldncs uFrfva ells iFγnxtot(hraou)sg,p heacntihadle wcpaeotiesngitmorxpy.ly have A. Digital Baseband Precoder Design of topological mNanifold, namely, ∈a RieMmannian manifold. A Riemannian manifold is equipped with aDnFin (nxe)r[ξpxro]d=uc ξtxF (3.15) We first consider to design the digital precoder F with a BB defined on the tangent spaces T , called the Riemannian fixed analog precoder FRF. Thus, problem (5) can be restated metric, which allows one to measxuMre distances and angles on as minFiBmBize (cid:107)Fopt−FRFFBB(cid:107)F , (6) mRiaenmifaonldnsia.nInmapnairftoicldulawr,ithitthisepRoisesmibalnenitaonumseetrciacl.culus on a which has a well-known least squares solution given by The rich geometry of Riemannian manifolds makes it pos- F =F† F . (7) sible to define gradients of cost functions. More importantly, BB RF opt optimization over a Riemannian manifold is locally analo- Notethatthepowerconstraintin(5)istemporarilyremoved, gous to that over a Euclidean space with smooth constraints. and it will be dealt with in Section III-C. Nevertheless, the Therefore, a well-developed conjugate gradient algorithm in solution in (7) has already offered a globally optimal solution EuclideanspacescanfinditscounterpartonthespecifiedRie- to the counterpart design problem at the receiver side. mannianmanifolds.Inthefollowing,wewillbrieflyintroduce this counterpart. B. Analog RF Precoder Design via Manifold Optimization We first endow the complex plane C with the Euclidean For the fully-connected structure, the feasible set of metric f A the analog precoder can be specified by (FRF)i,j = 1, as x ,x = x∗x , (9) each RF chain is connected to all the ant|ennas. In| the next (cid:104) 1 2(cid:105) (cid:60){ 1 2} alternating step, we fix FBB and seek an analog precoder which is equivalent to treating C as R2 with the canonical which optimizes the following problem2: inner product. Then we are able to denote the complex circle minimize F F F 2 as subFjReFctto (cid:107)(FoRpFt)−i,j =RF1,BBi,(cid:107)jF. (8) Mcc ={x∈C:x∗x=1}. (10) | | ∀ 2ThesquareoftheFrobeniusnormmakestheobjectivefunctionquadratic For a given point x on the manifold Mcc, the directions andsmooth,andwillnotaffectthesolution. along which it can move are characterized by the tangent 6 vectors. Then the tangent space at the point x can Algorithm 1 Conjugate Gradient Algorithm for Analog Pre- cc be represented by ∈ M coding Based on Manifold Optimization Input: F ,F ,x m TxMcc ={z ∈C:z∗x+x∗z =2(cid:104)x,z(cid:105)=0}. (11) 1: d0 =o−ptgradBfB(x00)∈anMd ckc=0; 2: repeat Note that the vector x=vec(F ) forms a complex circle mwhaneriefolmd M=mccN=N{xt ∈. CTmher:e|fxo1r|eR,=Fth|xe2|se=ar·c·h·=spa|xcem|o=f 1th}e, 43:: FCihnodosteheArnmeixjto pboacinkttraxckk+in1gulisninegseraertcrhacsttieopnsiinze(α1k5;): t RF x =Retr (α d ); optimization problem (8) is over a product of m circles in k+1 xk k k the complex plane, which is a Riemannian submanifold of 5: Determine Riemannian gradient gk+1 = gradf(xk+1) according to (13) and (14); Cm with the product geometry. Hence, the tangent space at a 6: Calculate the vector transports g+ and d+ of gradient given point x m can be expressed as k k ∈Mcc gk and conjugate direction dk from xk to xk+1; TxMmcc ={z∈Cm :(cid:60){z◦x∗}=0m}. (12) 78:: CChoomopsuetePolcaokn-jRuigbaiteeredpiareracmtioenterdβkk++11; = gk+1 + Among all the tangent vectors, similar to the Euclidean β d+; − k+1 k space, one of them that is related to the negative Riemannian 9: k k+1; gradient represents the direction of the greatest decrease of 10: until←a stopping criterion triggers. a function. Because the complex circle manifold m is a Mcc Riemannian submanifold of Cm, the Riemannian gradient at x is a tangent vector gradf(x) given by the orthogonal which is accomplished in Step 6. According to Theorem projection of the Euclidean gradient f(x) onto the tangent 4.3.1 in [41], Algorithm 1 is guaranteed to converge to a ∇ space TxMmcc [41]: criticalpoint,i.e.,thepointwherethegradientoftheobjective function is zero. gradf(x)=Proj f(x) x∇ (13) = f(x) f(x) x∗ x, ∇ −(cid:60){∇ ◦ }◦ C. Hybrid Precoder Design where the Euclidean gradient of the cost function in (8) is With Algorithm 1 at hand, the hybrid precoder design via f(x)= 2(F∗ I ) vec(F ) (FT I )x . alternating minimization for the fully-connected structure is ∇ − BB⊗ Nt opt − BB⊗ Nt (14) describedintheMO-AltMin Algorithmbysolvingproblems Solving this Euclidean gradie(cid:2)nt involves some techniques(cid:3) on (6) and (8) iteratively. To satisfy the p√ower constraint in (5), c[4o5m].plex-valuedmatrixderivatives,thedetailscanbefoundin fwoellonworinmgalliezmemFaBBheblpyraevfeaacltotrheofef(cid:107)fFecRtFFoNBfsBt(cid:107)hFisantoSrmteapliz7a.tTiohne. Retraction is another key factor in manifold optimization, whichmapsavectorfromthetangentspaceontothemanifold MO-AltMin Algorithm: Manifold Optimization Based Hy- itself. It determines the destination on the manifold when brid Precoding for the Fully-connected Structure moving along a tangent vector. The retraction of a tangent vector αd at point x m can be stated as Input: Fopt ∈Mcc 1: Construct F(0) with random phases and set k =0; Retrx :TxMmcc →Mmcc : 2: repeat RF αd Retr (αd)=vec (x+αd)i . (15) 3: Fix F(RkF), and F(BkB) =FR(kF)†Fopt; (cid:55)→ x (cid:20)|(x+αd)i|(cid:21) 4: OptimizeF(RkF+1) usingAlgorithm1whenF(BkB) isfixed; Equipped with the tangent space, Riemannian gradient and 5: k k+1; retraction of the complex circle manifold m, a line search ← Mcc 6: until a stopping criterion triggers; based conjugate gradient method [46], which is a classical 7: For the digital precoder at the transmit end, normalize algorithm in the Euclidean space, can be developed to design √ F = Ns F . the analog precoder as shown in Algorithm 1. BB (cid:107)FRFFBB(cid:107)F BB Algorithm 1 utilizes the well-known Armijo backtracking (cid:98) line search step and Polak-Ribiere parameter to guarantee Lemma 1. If the Euclidean distance before normalization is the objective function to be non-increasing in each iteration [47]. In addition, since Steps 7 and 8 involve the operations (cid:107)Fopt−FRFFBB(cid:107)F ≤ δ, then after normalization we have between two vectors in different tangent spaces T m and F F F 2δ. T m, which cannot be combined directly,xakMmacpcping opt− RF BB F ≤ bextkw+e1eMnctwc o tangent vectors in different tangent spaces called (cid:13)(cid:13) Proof: D(cid:98)efine(cid:13)(cid:13)the normalization factor √Ns = 1 (cid:13) (cid:13) (cid:107)FRFFBB(cid:107)F λ transport is introduced. The transport of a tangent vector d and thus F F =λ√N =λ F . (cid:107) RF BB(cid:107)F s (cid:107) opt(cid:107)F from xk to xk+1 can be specified as By norm inequality, we have Transp :T m T m : F F F F F F xk→xk+1 xkMcc → xk+1Mcc (16) (cid:107) opt− RF BB(cid:107)F ≥|(cid:107) opt(cid:107)F −(cid:107) RF BB(cid:107)F | (17) d d d x∗ x , = 1 λ F , (cid:55)→ −(cid:60){ ◦ k+1}◦ k+1 | − |(cid:107) opt(cid:107)F 7 which is equivalent to F 1 δ. digital precoder. Though it will incur some performance loss (cid:107) opt(cid:107)F ≤ |λ−1| When λ=1, which indicates F F F =0, compared to the manifold based algorithm, simulations will (cid:54) (cid:107) opt− RF BB(cid:107)F (cid:54) demonstrate its performance gains over existing algorithms. F F F opt RF BB − F (cid:13) (cid:13) 1 =(cid:13)F F F(cid:98) (cid:13)+ 1 F F A. Digital Baseband Precoder Structure (cid:13) opt RF BB(cid:13) RF BB − − λ (cid:13)(cid:13) (cid:18) (cid:19)1 (cid:13)(cid:13)F (18) Notethatthecolumnsoftheunconstrainedoptimalprecod- ≤(cid:13)(cid:13)(cid:107)Fopt−FRFFBB(cid:107)F + 1− λ (cid:107)FRFFB(cid:13)(cid:13)B(cid:107)F ing matrix Fopt are mutually orthogonal in order to mitigate (cid:12) (cid:12) the interference between the multiplexed streams. Inspired (cid:12) λ (cid:12) 1 δ+ λ 1 F δ(cid:12)+ | −(cid:12) |δ =2δ. by this structure of the unconstrained precoding solution, we ≤ | − |(cid:107) opt(cid:107)F ≤ (cid:12) λ (cid:12) 1 impose a similar constraint that the columns of the digital | − | precoding matrix should be mutually orthogonal, i.e., Lemma1showsthataslongaswecanmaketheEuclidean distance between the optimal digital precoder and the hybrid FH F =αFH αF =α2I , (19) BB BB DD DD Ns precoders sufficiently small when ignoring the power con- straint in (5), the normalization step will also achieve a small where FDD is a unitary matrix with the same dimension distance to the optimal digital precoder. as FBB. Although there is no existing conclusion on the Since the objective function in problem (5) is minimized optimal structure of the digital precoder in hybrid precoding, at Steps 3 and 4, each iteration will never increase it. In it is natural and intriguing to investigate the hybrid precoder addition, the objective function is non-negative. These two design under such an orthogonal constraint of the digital properties together guarantee that the MO-AltMin algorithm precoder. More importantly, this orthogonal constraint creates can converge to a feasible solution. Although the optimality the potential for the analog precoder FRF to get rid of the ofalternatingminimizationalgorithmsforgeneralnon-convex productformwithFBB,whichwillhelpsignificantlysimplify problems is still an open problem [48], simulation results in the analog precoder design. SectionVIIwillshowthattheproposedalgorithmcanprovide near-optimal performance. B. Hybrid precoder design However, the complexity of the MO-AltMin algorithm is relatively high. In each iteration, the update of the analog ByreplacingF withαF ,theobjectivefunctionin(5) BB DD precoder involves a line search algorithm, i.e., Algorithm can be further recast as 1, so the nested loops in the MO-AltMin algorithm will F F F 2 slow down the whole solving procedure. Furthermore, the (cid:107) opt− RF BB(cid:107)F Kronecker products in (14) will result in two matrices of =Tr FHoptFopt −Tr FHoptFRFFBB danimdernessiuolntsNiRntFaNnt×exNposnNetn,tiwalhiicnhcrsecaasleesowfitthhethceoamnpteuntnataiosnizael −T(cid:0)r FHBBFHR(cid:1)FFopt(cid:0)+Tr FHBBFHR(cid:1)FFRFFBB (20) complexity in the MO-AltMin algorithm. Despite the high =(cid:107)Fopt(cid:0)(cid:107)2F −2α(cid:60)Tr (cid:1)FDDF(cid:0)HoptFRF (cid:1) complexity, we note that the MO-AltMin algorithm based +α2(cid:107)FRFFDD(cid:107)2F .(cid:0) (cid:1) on manifold optimization directly solves the hybrid precoder designproblem(5)underunitmodulusconstraints,whichwill Obviously, when α = (cid:60)Tr(FDDFHoptFRF), the objective func- improve the spectral efficiency when compared to existing tion F F F 2 (cid:107)iFnRF(F20D)D(cid:107)h2Fas the minimum value, aolfgtohreithpmersfo.rTmhaenrecfeorine,ttehrimssalogforsipthemctrcaalnefsfiecrvieenacsy,aabnednwchemwairlkl given(cid:107)byo(cid:107)pFt−opt(cid:107)R2FF−{B(cid:60)BT(cid:107)rF(cid:107)(FFRDFDFFDHopDt(cid:107)F2FRF)}2.Notethatthesquare seek a low-complexity algorithm in the next section. of the Frobenius norm F F 2 has the following upper (cid:107) RF DD(cid:107)F bound IV. LOW-COMPLEXITYHYBRIDPRECODINGFORTHE FULLY-CONNECTEDSTRUCTURE (cid:107)FRFFDD(cid:107)2F =Tr FHDDFHRFFRFFDD AlthoughtheMO-AltMinalgorithmcandirectlyhandlethe I =Tr(cid:0) Ns KHF(cid:1)H F K unit modulus constraints, the number of such constraints may 0 RF RF (21) (cid:26)(cid:18) (cid:19) (cid:27) besubstantiallylargeduetothelarge-sizeantennaarray.Thus, Tr KHFH F K the high computational complexity will prevent its practical ≤ RF RF implementation.Itmotivatesustodevelopahybridprecoding =(cid:107)F(cid:8)RF(cid:107)2F , (cid:9) algorithm with lower computational complexity and slight I performance loss. In this section, by utilizing the orthogonal where FDDFHDD = K Ns 0 KH is the SVD of property of the digital precoder, we will propose a low- (cid:18) (cid:19) F FH and the equality holds when Nt =N , i.e., F complexity design for the analog precoder subject to unit DD DD RF s DD isasquarematrix.Hence,theobjectivefunctionin(5)isupper mthoedduilguistalcopnrsetcraoidnetrs,. tThehapnhkassetos othfethoerthanoagloongalprpercoopdeerrtycaonf boundedby(cid:107)Fopt(cid:107)2F−{(cid:60)Tr(F(cid:107)DFDRFFHo(cid:107)p2FtFRF)}2.Inordertomake be extracted from the phases of an equivalent precoder deter- FRF get rid of the product with FBB, we choose to add the mined by the digital precoder and the unconstrained optimal constant term 1 1 F 2 + 1 to the bound and 2(cid:107)FRF(cid:107)2F − (cid:107) opt(cid:107)F 2 (cid:16) (cid:17) 8 multiply it by the positive constant term 2 F 2. Then we where(a)followstheHo¨lder’sinequality, and stand (cid:107) RF(cid:107)F (cid:107)·(cid:107)∞ (cid:107)·(cid:107)1 have for the infinite and one Schatten norms [49]. The equality is F 2 2 Tr F FH F + F 2 established only when (cid:107) opt(cid:107)F − (cid:60) DD opt RF (cid:107) RF(cid:107)F =Tr FH F 2 Tr F FH F F =V UH, (28) RF RF − (cid:0)(cid:60) DD op(cid:1)t RF (22) DD 1 +T(cid:0)r FDDFHo(cid:1)ptFoptFHD(cid:0)D (cid:1) where FH F = UΣVH = USVH, which is the SVD opt RF 1 = Fopt(cid:0)FHDD−FRF 2F . (cid:1) of FHoptFRF, and S is a diagonal matrix whose elements are the first N nonzero singular values σ , ,σ . This Since(cid:13)directly optimizin(cid:13)g the objective function (20) will s 1 ··· Ns (cid:13) (cid:13) result bears some similarity to the solution of the orthogonal stillincurhighcomplexity,weintendtoadopttheupperbound Procrustes problem (OPP) [50], although the formulation is (22) as the objective function rather than the original one. slightly different3. In addition, as we can satisfy the transmit power constraint by normalization after updating the hybrid precoders alter- PE-AltMin Algorithm: A Low-Complexity Algorithm for nately, which has been shown in the MO-AltMin algorithm the Fully-connected Structure and Lemma 1, here we also temporarily remove the power Input: F constraint. Thus, by adopting (22) as the objective function, opt 1: Construct F(0) with random phases and set k =0; the hybrid precoder design problem is given as RF 2: repeat mFiRnFi,mFDizDe (cid:13)FoptFHDD−FRF(cid:13)2F (23) 3: UFix(k)SF(k(R)kVF),(k)cHo;mpute the SVD: FHoptF(RkF) = subjectto (cid:13)|(FRF)i,j|=1,∀(cid:13)i,j 4: F(k) =V(k1)U(k)H; The problem formulati(cid:40)onFHD(4D3F)DimDp=lieIsNsth.at we only need 5: FiDxDF(DkD),1and arg F(RkF+1) =arg FoptF(DkD)H ; to seek a unitary precoding matrix F , and then a corre- 6: k k+1; (cid:110) (cid:111) (cid:18) (cid:19) DD ← sponding precoding matrix F with orthogonal columns can 7: until a stopping criterion triggers; BB be obtained. When applying alternating minimization, it turns 8: For the digital precoder at the transmit end, normalize √ out that the objective function in (43) significantly simplifies FBB = (cid:107)FRFFNDsD(cid:107)FFDD. theanalogprecoderdesign.Morespecifically,sincethematrix F gets rid of the product form with F , it has a closed- (cid:98) RF BB Based on the two closed-form solutions for the analog and form solution digital precoders, we summarize our new design as the PE- arg(F )=arg F FH , (24) AltMin Algorithm. There are several issues involved in the RF opt DD PE-AltMin algorithm that require some further remarks. wherearg(A)generatesamatrix(cid:0)containing(cid:1)thephasesofthe (1) Complexity: In both the MO-AltMin and PE-AltMin entries of A. Thus, it shows that the phases of F can be RF algorithms,theupdatingrulesofthedigitalprecodersaregiven extractedfromthephasesofanequivalentprecoderF FH . opt DD by closed-form solutions and thus these two algorithms are of Thisclosed-formsolutioncanalsobeviewedastheEuclidean comparablecomplexityinthedigitalparts.Furthermore,inthe projection of F FH on the feasible set of the analog opt DD Af hybridprecodingsystem,thedimensionoftheanalogprecoder precoder. is much higher than that of the digital precoder, which makes For the digital precoder design, regarding F as fixed, we RF the complexity of the algorithms predominated by the analog try to solve a digital precoder which optimizes the following part. problem In each iteration of the MO-AltMin algorithm, a conju- minimize F FH F 2 FDD opt DD− RF F (25) gate gradient descent search is needed to update the analog subjectto F(cid:13)H F =I . (cid:13) precoder. In particular, when updating the analog precoder (cid:13)DD DD Ns (cid:13) in each iteration, we need to search on the complex circle Since problem (25) only has one optimization variable F , DD manifoldrepeatedlytofindalocaloptimumwithzerogradient it is equivalent to ofthecostfunction.Additionally,thecomputationofthelarge- maFxDimDize (cid:60)Tr FDDFHoptFRF (26) wsizilel mbeatrinicveosl,vei.de.,inmtahtericgersadoifendtimdeesncseionnt pNroRtcFeNdutr×e dNuseNtto, subjectto FHDDF(cid:0)DD =INs. (cid:1) the use of the Kronecker products. More importantly, the According to the definition of the dual norm, we have conjugate gradient descent, which is an iterative procedure itself, is nested into each alternating minimization iteration. Tr F FH F Tr F FH F (cid:60) DD opt RF ≤ DD opt RF This nested iteration structure will dramatically degrade the (cid:0) (cid:1)(≤a)(cid:12)(cid:12) F(cid:0)HDD ∞· FHoptF(cid:1)R(cid:12)(cid:12)F 1 ccoomntpraurtya,tioinnaelaecfhficiiteenractyioonftohfetMheOP-AEl-tAMltiMnainlgoarlgitohrmit.hOmn, tthhee = (cid:13)(cid:13)FHoptF(cid:13)(cid:13)RF 1(cid:13)(cid:13) (cid:13)(cid:13) (27) update of the analog precoder is simply realized by a phase (cid:13)Ns (cid:13) =(cid:13) σi, (cid:13) 3OPPtriestominimize(cid:107)AΩ−B(cid:107)F,wheretheoptimizationvariableΩ isasquareunitarymatrix. i=1 (cid:88) 9 extractionoperationofthematrixF FH ,whosedimension structure.Surprisingly,optimalsolutionscanbefoundforboth opt DD is N Nt . Compared with the MO-AltMin algorithm, it is subproblems of analog and digital precoders. t× RF safe to conclude that the PE-AltMin algorithm is with a much lower complexity, which is also numerically observed in our A. Analog RF Precoder Design simulations. (2) Accuracy of the approximation: In the formulation of DuetothespecialstructureoftheconstraintonFRF,inthe (43), we try to minimize an upper bound given by (21) product FRFFBB, each nonzero element of FRF is multiplied ratherthandirectlyminimizingtheoriginalobjectivefunction. by a corresponding row extracted from FBB. Thus, the power Therefore, the effectiveness of this strategy depends on how constraint in (5) at the transmit side can be recast as ttioFgh(2t1th),2ewuaepspceFarnbqoKuuanndti2ifsy,wwthhheeenrgeaNKpsb≤eitswNceRtoeFmnp<(cid:107)rFi2seRNdFsFo.fDAtDchc(cid:107)eo2Frridgaihnntgd- (cid:107)FRFFBB(cid:107)2F = NNRttF (cid:107)FBB(cid:107)2F =Ns. (30) m(cid:107)oRstFN(cid:107)Ft (cid:107)NRFcol1u(cid:107)mFns of K. N1ote that when Nt = N , Therefore, the analog precoder design is formulated as RF− s RF s the upper bound is tight, i.e., the equality holds in (21). minimize F F F 2 Furthermore, when increasing NRtF from Ns to 2Ns − 1, FRF (cid:107) opt− RF BB(cid:107)F (31) the gap F K 2 will become larger with increasing Nt , subjectto F . (cid:107) RF 1(cid:107)F RF RF ∈Ap which will result in some performance loss. The impact of Also, due to the same property of F , problem (31) can be adopting this upper bound as the objective will be shown in RF reformulated as Section VII via simulations. of(α3)caCnalbceulfaotuionndotof cαo:nAstlrtuhcotuaghmwaterixhaFvBeBstcaoterdretshpaotnadivnaglutoe m{iθnii}mNi=ti1ze (Fopt)i,:−ejθi(FBB)l,: 22, (32) (cid:13) (cid:13) each FDD, we do not need to actually calculate α in the PE- where l = iNRtF . T(cid:13)his is basically a vector(cid:13)approximation AltMinalgorithmforthefollowingreasons.Atthetransmitter Nt side, even though we compute F = αF in the last problem usi(cid:108)ng pha(cid:109)se rotation, and there exists a closed-form BB DD step of the PE-AltMin algorithm, this digital precoder should expression for nonzero elements in FRF, given by be immediately normalized. Hence, the overall procedure is arg (F ) =arg (F ) (F ) H , equivalent to directly normalizing FDD to satisfy the power { RF i,l} opt i,: BB l,: constraint without knowing α. At the receiver side, we note (cid:110) Nt (cid:111) (33) 1 i N ,l= i RF . that the spectral efficiency (2) will not be influenced by the ≤ ≤ t N (cid:24) t (cid:25) constant factor α multiplied with W . That is because the BB We note that the special characteristic of F simplifies the decoderW takeseffectsonbothreceivedsignalsandnoise, RF BB analogprecoderdesignandmakestheunitmodulusconstraint and thus signal-to-noise ratio (SNR) will not change due to no longer an intractable issue in the partially-connected struc- theconstantfactorα.Moreover,theavoidanceofcalculatingα ture. willfurtherreducethecomplexityofthePE-AltMinalgorithm. V. HYBRIDPRECODINGFORTHEPARTIALLY-CONNECTED B. Digital Baseband Precoder Design STRUCTURE According to (30), the precoder design at the transmit side Different from the fully-connected structure, the partially- can be rewritten as the following problem connected structure shown in Fig. 1(c) [29], [33], [34], also minimize F F F 2 called the array of subarray structure, employs notably less FBB (cid:107) opt− RF BB(cid:107)F phase shifters and is advocated for energy-efficient mmWave Nt N (34) MIMO systems [31], [32]. Particularly, the output signal of subjectto (cid:107)FBB(cid:107)2F = RNF s. each RF chain is only connected with N /Nt antennas, t t RF which reduces the hardware complexity in the RF domain. Problem (34) is a non-convex quadratic constraint quadratic Therefore, the analog precoder F in this structure belongs programming(QCQP)problem,whichcanbereformulatedas RF toasetofblockmatrices ,whereeachblockisanN /Nt a homogeneous QCQP problem: Ap t RF dimensionvectorwithunitmoduluselementsandthestructure minimize Tr(CY) of F can be depicted as Y∈Hn RF Tr(A Y)= NRtFNs p1 0 ··· 0 1 Nt (35) 0 p2 0 subjectto Tr(A2Y)=1 FRF = ... ... ... , (29) Y (cid:23)0, rank(Y)=1, 0 0 ··· pNRtF with Hn being the set ofn=NRtFNs+1 dimension complex T Hermitian matrices. In addition, y= vec(FBB) t T with where p = exp jθ , ,exp jθ an auxiliary variable t, Y =yyH, f =vec(F ), and i (cid:20) (cid:18) (i−1)NNRttF+1(cid:19) ··· (cid:18) iNNRttF(cid:19)(cid:21) (cid:2) opt (cid:3) and θi stands for the phase of the ith phase shifter. In A = In−1 0 ,A = 0n−1 0 , this section, we will propose an AltMin algorithm for this 1 0 0 2 0 1 (cid:20) (cid:21) (cid:20) (cid:21) 10 (I F )H(I F ) (I F )Hf C= Ns ⊗ RF Ns ⊗ RF − Ns ⊗ RF . VI. HYBRIDPRECODINGINMMWAVEMIMO-OFDM fH(I F ) fHf (cid:20) − Ns ⊗ RF (cid:21) SYSTEMS ThederivationandtheformulationofthehomogeneousQCQP In previous sections, we designed hybrid precoders for problem can be found in Appendix A. narrowband mmWave systems. On the other hand, the large In fact, the most difficult part in problem (35) is the rank available bandwidth is one of the unique characteristics of constraint, which is non-convex with respect to Y. Thus, mmWave systems, and therefore the design of the hybrid we first drop it to obtain a relaxed version of (35), i.e., a precodersshouldbeinvestigatedwhenmulticarriertechniques semidefinite relaxation (SDR) problem as follows. such as OFDM are utilized to overcome the multipath fading. minimize Tr(CY) Inthissection,wewillextendtheproposedAltMinalgorithms Y∈Hn to mmWave MIMO-OFDM systems. Tr(A Y)= NRtFNs In conventional MIMO-OFDM systems with sub-6 GHz 1 Nt (36) subjectto Tr(A2Y)=1 carrier frequencies, digital precoding is performed in the Y 0. frequency domain for every subcarrier, which can also be (cid:23) adopted in mmWave MIMO-OFDM systems. Futhermore, Ithasbeen establishedthattheSDRis tight whenthenumber the digital precoding is followed by an inverse fast Fourier of constraints is less than three for a complex-valued ho- transform (IFFT) operation, which combines the signals of all mogeneous QCQP problem [51]. Consequently, problem (36) the subcarriers together. However, since the analog precoding without the rank-one constraint reduces into a semidefinite isapost-IFFTprocessing,thesignalsofallthesubcarrierscan programming(SDP)problemanditcanbesolvedbystandard only share one common analog precoder in mmWave MIMO- convex optimization algorithms [52], from which we can OFDM systems [22], [30]. Under this new restriction, the obtain the globally optimal solution of the digital precoder received signal of each subcarrier after the decoding process design problem (34). Therefore, a step-by-step summary is can then be expressed as provided below as the SDR-AltMin Algorithm. y[k]=√ρWH [k]WH H[k]F F [k]s+WH [k]WH n, BB RF RF BB BB RF SDR-AltMin Algorithm: SDR Based Hybrid Precoding for (39) the Partially-connected Structure where k [0,K 1] is the subcarrier index. H[k] is the ∈ − Input: F frequencydomainchannelmatrixforthekthsubcarrier,which opt 1: Construct F(0) with random phases and set k =0; is given by [22] RF 2: repeat Ncl−1Nray 3: Fix F(RkF), solving F(BkB) using SDR (36); H[k]=γ αilar(φril,θirl)at(φtil,θitl)He−j2πik/K, 4: Fix F(BkB), and update F(RkF+1) by (33); (cid:88)i=0 (cid:88)l=1 (40) 5: k k+1; ← whereγ = NtNr isthenormalizationfactorandK isthe 6: until a stopping criterion triggers. NclNray total number of subcarriers. Then the hybrid precoder design (cid:113) inmmWaveMIMO-OFDMsystemscanbeformulatedas[22] C. Comparison Between Two Hybrid Precoding Structures K−1 minimize F [k] F F [k] 2 turTeshecomnsaiidnerdeidffeinrenthciesbpeatpweereins tthweonhuymbbriedr opfrepchoadsiengshsitfrtuecrs- FRF,FBB[k] k(cid:88)=0 (cid:107) opt − RF BB (cid:107)F (41) F N inuseforgivennumbersofdatastreams,RFchains,and RF PS subjectto ∈A antennas. (cid:40)(cid:107)FRFFBB[k](cid:107)2F =Ns, In terms of spectral efficiency, the fully-connected structure where F [k] is the optimal digital precoder for the kth provides more design degrees of freedom (DoFs) in the RF opt subcarrier. While it does not directly maximize the spectral domain and thus will outperform the partially-connected one. efficiency, similar to the narrowband case, as shown in [13], However, when taking power consumption into consideration, [22], the objective is a good surrogate and it will make the it is intriguing to know which structure has better energy problem tractable. efficiency. Energy efficiency is defined as the ratio between The alternating minimization framework can be adopted to spectral efficiency and total power consumption solve problem (41). In particular, the digital precoders of all R the subcarriers can be updated in a parallel fashion, since η = , (37) P +Nt P +N P +N P we can get rid of the summation in (41) when optimizing common RF RF t PA PS PS the digital precoder for each subcarrier. Hence, the solutions where the unit of η is bits/Hz/J and P is the common common from (7), (28) and (36) still hold for problem (41). Next powerofthetransmitter.P ,P ,andP arethepowerof RF PS PA we will focus on the analog precoder design, which is the eachRFchain,phaseshifter,andpoweramplifier,respectively. main difference from narrowband systems. Then the proposed ThenumberofphaseshiftersN canbeexpressedasfollows, PS AltMin algorithms can be applied to the hybrid precoding in N Nt fully-connected N = t RF . (38) OFDM systems. PS N partially-connected t For the MO-AltMin algorithm, based on the principles of (cid:26) ThenumericalcomparisonwillbeprovidedintheSectionVII. manifold optimization, as mentioned in Section III, we first