Logout succeed
Logout succeed. See you again!

An Analytic Criterion for Turbulent Disruption of Planetary Resonances PDF
Preview An Analytic Criterion for Turbulent Disruption of Planetary Resonances
Draft version January 30, 2017 PreprinttypesetusingLATEXstyleemulateapjv.5/2/11 AN ANALYTIC CRITERION FOR TURBULENT DISRUPTION OF PLANETARY RESONANCES Konstantin Batygin1 & Fred C. Adams2,3 1DivisionofGeologicalandPlanetarySciences,CaliforniaInstituteofTechnology,Pasadena,CA91125 2DepartmentofPhysics,UniversityofMichigan,AnnArbor,MI48109and 3DepartmentofAstronomy,UniversityofMichigan,AnnArbor,MI48109 Draft version January 30, 2017 ABSTRACT Mean motion commensurabilities in multi-planet systems are an expected outcome of protoplane- 7 tary disk-driven migration, and their relative dearth in the observational data presents an important 1 challengetocurrentmodelsofplanetformationanddynamicalevolution. Onenaturalmechanismthat 0 can lead to the dissolution of commensurabilities is stochastic orbital forcing, induced by turbulent 2 density fluctuations within the nebula. While this process is qualitatively promising, the conditions under which mean motion resonances can be broken are not well understood. In this work, we de- n rive a simple analytic criterion that elucidates the relationship among the physical parameters of a the system, and find the conditions necessary to drive planets out of resonance. Subsequently, we J confirm our findings with numerical integrations carried out in the perturbative regime, as well as 6 direct N-body simulations. Our calculations suggest that turbulent resonance disruption depends 2 most sensitively on the planet-star mass ratio. Specifically, for a disk with properties comparable to the early solar nebula with α = 10 2, only planet pairs with cumulative mass ratios smaller than ] − P (m +m )/M (cid:46)10 5 3M /M are susceptible to breaking resonance at semi-major axis of order 1 2 − E a 0.1AU. Although∼turbu⊕lence(cid:12)can sometimes compromise resonant pairs, an additional mecha- ∼ . nism (such as suppression of resonance capture probability through disk eccentricity) is required to h adequately explain the largely non-resonant orbital architectures of extrasolar planetary systems. p - o 1. INTRODUCTION Super-Earths have substantial gaseous envelopes, imply- r st Despiteremarkableadvancesintheobservationalchar- ing that they formed in gas-rich environments, where they could have actively exchanged angular momentum a acterization of extrasolar planetary systems that have [ occurred over the last two decades, planet formation re- with their surrounding nebulae. Establishment of mean motion resonances in multi- mains imperfectly understood. With the advent of data 1 planet systems has long been recognized as a signpost from large-scale radial velocity and photometric surveys v of the planetary migration paradigm. Specifically, the (Howard et al. 2012; Petigura et al. 2013; Batalha et al. 9 notion that slow, convergent evolution of orbits towards 4 2013), the origins of a newly identified census of close- one another produces planetary pairs with orbital peri- 8 in Super-Earths (planets with orbital periods that span ods whose ratio can be expressed as a fraction of (typi- 7 days to months, and masses between those of the Earth cally consecutive) integers, dates back more than half a 0 and Neptune) have emerged as an issue of particular in- century(Goldreich1965;Allan1969,1970;Sinclair1970, . terest. Although analogs of such short-period objects 1 1972). While distinct examples of resonant planetary are absent from our solar system, statistical analyses 0 havedemonstratedthatSuper-Earthtypeplanetsareex- systems exist within the known aggregate of planets1, 7 tremely common within the Galaxy, and likely represent theoverallorbitaldistributionshowslittlepreferencefor 1 thedominantoutcomeofplanetformation(Fressinetal. mean motion commensurabilities (Figure 1). Therefore, : v 2013; Foreman-Mackey et al. 2014; Mulders et al. 2015). taken at face value, the paradigm of orbital migration i An elusive, yet fundamentally important aspect of the predicts consequences for the dynamical architectures of X Super-Earth conglomeration narrative is the role played Super-Earthsthatareinconflictwiththemajorityofob- r by orbital transport. A key question is whether these servations (Fabrycky et al. 2014). Accordingly, the fact a planets experience accretion in-situ (Hansen & Murray that mean motion commensurabilities are neither com- mon nor entirely absent in the observational census of 2015; Chiang & Laughlin 2013; Lee & Chiang 2015, extrasolar planets presents an important challenge to the 2016), or if they migrate to their close-in orbits having formed at large orbital radii, as a consequence of disk- present understanding of planet formation theory. planet interactions (Goldreich & Tremaine1980; Tanaka Prior to the detection of thousands of planetary can- et al. 2002; Crida et al. 2008; Kley & Nelson 2012). Al- didates by the Kepler spacecraft, the expectations of thoughthisquestionremainsasubjectofactiveresearch, largely resonant architectures of close-in planets were anumberrecentstudies(Schlichting2014;Ogiharaetal. firmly established by global hydrodynamic, as well as 2015; D’Angelo & Bodenheimer 2016) have pointed to a N-body simulations (Lee & Peale 2002; Quillen 2006; finiteextentofmigrationasanapparentrequirementfor Terquem & Papaloizou 2007; Cresswell & Nelson 2008). successful formation of Super-Earths. Moreover, struc- tural models (Rogers 2015) show that the majority of 1 Archetypical examples of short-period resonant systems in- clude GJ876 (Rivera et al. 2010), Kepler-36 (Deck et al. 2012), Kepler-79(Jontof-Hutteretal.2014),andKepler-227(Millsetal. [email protected] 2016). 2 2 x 10-4 more massive planet on the outside more massive planet on the inside Npl contrast, the complex interplay between planet-planet interactions,turbulentforcing,anddissipativemigration 2 remains poorly quantified, making the turbulent disrup- 1 x 10-4 3 tion mechanism difficult to decisively confirm or refute M 4 (see e.g., Ketchum et al. 2011). As a result, a key goal m)/2 5 x 10-5 a/a112! 5+ ofofrthwihsiwchortkheissttoocihdaesnttiicfyditshseolruetgioimneofofmpeaarnammeotteironspraecse- + ⌘ 1 ⇠ onances can successfully operate. In doing so, we aim to m ( gain insight into the evolutionary stages of young plan- 2 x 10-5 etary systems during which disk turbulence can prevent the formation of resonant pairs of planets. The paper is organized as follows. In Section 2, we 1 x 10-5 1 1 23 1 43 2 4 present the details of our model. In Section 3, we em- 4: 2: 3:4: 1: 3:2: 1: 1: ploy methods from stochastic calculus to derive an an- Period Ratio alytic criterion for turbulent disruption of mean motion Fig. 1.—ObservedorbitaldistributionofSuper-Earths. Thera- resonances. In Section 4, we confirm our results with tio of orbital periods of confirmed planets is plotted against their cumulative planet-star mass ratio. The period of the more mas- both perturbative numerical integrations and an ensem- siveplanetisadoptedasaunit,suchthatsystemsthatfallonthe ble of full N-body simulations. The paper concludes in left-hand-sideofthe1:1linehavethemoremassiveplanetonthe Section5withasummaryofourresultsandadiscussion outside,whiletheconverseistrueforsystemsthatfallontheright- hand-sideofthe1:1line. Insystemswherenodirectmeasurements of their implications. of the mass (or msin(i)) are available, the mass is inferred using theWeiss&Marcy(2014)mass-radiusrelationship. Suchsystems 2. ANALYTICMODEL are shown with transparent points. The planetary multiplicity, The model we aim to construct effectively comprises N , is color-coded in the following way: systems with 2, 3, and pl three ingredients: (1) first-order (k : k 1) reso- 4 planets are shown with black, blue and red points respectively. − Systemswith5ormoreplanetsaredepictedwithgreenpoints. In nantplanet-planetinteractions,(2)orbitalmigrationand planetarysystemswithmorethantwoplanets, onlyperiodratios damping, as well as (3) stochastic turbulent forcing. In ofneighboringplanetsareconsidered. Verticallinesdenotethelo- this section, we outline our treatment of each of these cationsoffirst-ordermeanmotionresonances. Theoverallsample processes. A cartoon depicting the geometric setup of clearlyshowslittlepreferencefororbitalcommensurabilities. the problem is shown in Figure 2. Throughout much An important distinction was drawn by the work of of the manuscript, we make the so-called “compact” ap- Adamsetal.(2008),whopointedoutthatresonancescan proximation, where we assume that the semi-major axis bedestabilizedbyrandomdensityfluctuationsproduced ratio ξ a1/a2 1. While formally limiting, the agree- ≡ → byturbulencewithintheprotoplanetarydisk. Follow-up mentbetweenresultsproducedunderthisapproximation studiesdemonstratedthatarichvarietyofoutcomescan and those obtained within N-body integrations is well- beattainedasaconsequenceofstochasticforcingwithin knowntobesatisfactory,particularlyfork (cid:62)3(see,e.g., thedisk(Lecoanetetal.2009;Ketchumetal.2011;Horn Deck et al. 2013; Deck & Batygin 2015), where the inte- etal.2012), andthatinspecificcases,turbulencecanbe ger k specifies the resonance (Murray & Dermott 1999; conducive to the reproduction of dynamical architecture Morbidelli 2002). (Rein & Papaloizou 2009; Rein et al. 2010). Being made up of analytic components, the model Whilethepredictionoftheinfrequencyofresonantsys- constructed here cannot possibly capture all of the in- tems made by Adams et al. (2008) was confirmed by tricate details of the dynamical evolution that planets the Kepler dataset, recent work has shown that turbu- are subjected to, within protoplanetary disks. By sac- lent forcing is not the only mechanism through which rificing precision on a detailed level, however, we hope resonances can be disrupted. Specifically, the work of to construct an approximate description of the relevant Goldreich & Schlichting (2014) proposed that a particu- physical processes that will illuminate underlying rela- lar relationship between the rates of eccentricity damp- tionships. These findings can then be used to constrain ing and semi-major axis decay can render resonances the overall regime over which turbulent fluctuations can metastable, while Batygin (2015) showed that probabil- effect the dynamical evolution of nascent planetary sys- ity of resonance capture can be dramatically reduced in tems. slightly non-axisymmetric disks. In light of the ambi- 2.1. Planet-Planet Interactions guity associated with a multitude of theoretical models that seemingly accomplish the same thing, it is of great In the late twentieth century, it was recognized that a interest to inquire which, if any, of the proposed mech- perturbative Hamiltonian that represents the motion of anisms plays the leading role in sculpting the predomi- a massive pair of planets residing on eccentric orbits, in nantlynon-resonantarchitecturesofknownexoplanetary the vicinity of a mean-motion commensurability, can be systems. cast into integrable form (Sessin & Ferraz-Mello 1984; Within the context of the aforementioned models of Wisdom 1986; Henrard 1986). More recently, this for- resonantmetastabilityandcapturesuppression,thenec- malismhasbeenusedtoprovideageometricrepresenta- essary conditions for passage through commensurability tion of resonant dynamics (Batygin & Morbidelli 2013), are relatively clear. Resonant metastability requires the study the onset of chaos (Deck et al. 2013), generalize outer planet to be much more massive than the inner the theory of resonant capture (Batygin 2015), as well planet (Deck & Batygin 2015), while the capture sup- as to elucidate overstable librations (Deck & Batygin pression mechanism requires disk eccentricities on the 2015). Akeyadvantageofthistreatmentisthatittrans- order of a few percent to operate (Batygin 2015). In lates the full, unrestricted three-body problem into the 3 same mathematical form as that employed for the well- protoplanetary disk m1 planets m2 studiedcircularrestrictedproblem(Quillen2006). Here, localsurfacedensityh⌃i we make use of this framework once again. Because de- � � tailedderivationsoftheaforementionedresonantnormal ⌧dmp form are spelled out in the papers quoted above, we will h not reproduce it here, and instead restrict ourselves to ⌧ mig employing the results. The Hamiltonian that describes planet-planet interac- tionsinthevicinityofak :k 1meanmotionresonance turbulent fluctuations convergent migration and can be written as follows: − di↵usioncoe�cient eccentricity damping D x2+y2 x2+y2 2 � host star massM� a r =3 ε+1 2x, (1) h i H 2 − 2 − Fig. 2.—Geo�metric�setupofthedynamicalmodel. Twoplanets (cid:18) (cid:19) (cid:18) (cid:19) (cid:0) (cid:1) with masses m1 and m2 are assumed to orbit a star of mass M where the variables (ε,x,y) are defined below. A Hamil- at an approximate radial distance of r = (cid:104)a(cid:105). The bodies are tonian of this form is typically referred to as the second immersed in a gaseous nebula with scale-height h and a nominal fundamental model for resonance (Henrard & Lamaitre local surface density (cid:104)Σ(cid:105). Tidal interactions between the planets andthediskacttodamptheplanetaryeccentricitiesonatimescale 1983;Borders&Goldreich1984),andbehavesasaforced τdmp, while facilitating orbital convergence on a timescale τmig. harmonic oscillator at negative values of the proximity Simultaneously, turbulent density fluctuations within the nebula parameter, ε, while possessing a pendulum-like phase- generate stochastic perturbations to the planetary orbits, where thefluctuationsaredescribedbyadiffusioncoefficientD. space structure at large positive values of ε. This in- tegrable model approximates the real N-body dynamics where ξ =a /a , and the quantity 1 2 at low eccentricities and inclinations, and formally as- sumes that the orbits do not cross, although this latter e2sin (cid:36)2 e1sin (cid:36)1 ω˜ arctan − (5) assumption is routinely violated without much practical ≡ e cos (cid:36) e cos (cid:36) consequence (see, e.g., Peale 1976; Malhotra 1993; Deck (cid:20) 1 1− 2 2(cid:21) etal.2013). Inthewell-studiedcaseoftherestrictedcir- represents a generalized longitude of perihelion. cular three-body problem, the canonical variables (x,y) The specification of resonant dynamics is now com- are connected to the test particle’s eccentricity and the plete. WhileapplicationofHamilton’sequationstoequa- resonant angle, while ε is a measure of how close the tion (1) only yields the evolution of σ and the cor- orbits are to exact resonance. Within the framework of responding resonant angle, the behavior of the indi- thefullplanetaryresonanceproblem(whereneithermass vidual eccentricities and apsidal lines can be obtained noreccentricityofeithersecondarybodyisassumedtobe from the conserved2 quantity ρ = m1e21 + m2e22 + null), the variables take on slightly more complex physi- m1m2e1e2 cos(∆(cid:36)). In addition, we note that the def- cal meanings. initions of the variables (4) are independent of the indi- InordertoconvertbetweenKeplerianorbitalelements vidualplanetarymassesm1,m2,anddependonlyonthe and the dimensionless canonical variables used here, we cumulative planet-star mass ratio (m1 +m2)/M. This first define a generalized composite eccentricity apparent simplification is a consequence of taking the limit ξ a /a 1, and is qualitatively equivalent to 1 2 ≡ → σ = e2+e2 2e e cos(∆(cid:36)), (2) the O¨pik approximation (O¨pik 1976). 1 2− 1 2 (cid:113) where subscripts 1 and 2 refer to the inner and outer 2.2. Planet-Disk Interactions planets respectively, e is eccentricity, and (cid:36) is the longi- Dating back to early results on ring-satellite interac- tudeofperiastron. Additionally,wedefineunitsofaction tions (Goldreich & Tremaine 1982), it has been evident and time according to thatplanetscanexchangeorbitalenergyandangularmo- mentum with their natal disks. For planets that are not 2/3 1 15 kM [A]= sufficiently massive to open gaps within their nebulae, 2(cid:18) 4 m1+m2(cid:19) this exchange occurs through local excitation of spiral 2/3 density waves (i.e., the so-called “type-I” regime), and 1 5 M [T]= , (3) proceeds on the characteristic timescale: n(cid:18)√6k2m1+m2(cid:19) 4 1 M M h where m is planetary mass, M is stellar mass, and n = τ = , (6) wave n m Σa2 r M/a3 is the mean motion. Then, in the compact (cid:18) (cid:19)(cid:18) (cid:19)(cid:18) (cid:19) G limit, the variables in the Hamiltonian become (Deck & whereΣisthelocalsurfacedensity,andh/ristheaspect (cid:112)Batygin 2015): ratio of the disk. For an isothermal equation of state and a surface density profile that scales inversely with 1/3 15 kM theorbitalradius(Mestel1963),thecorrespondingrates x=σ cos kλ (k 1)λ ω˜ 4 m +m 2− − 1− of eccentricity and semi-major axis decay are given by (cid:18) 1 2(cid:19) 1/3 (cid:0) (cid:1) 15 kM 2 When the system is subjected to slow evolution of the prox- y =σ sin kλ (k 1)λ ω˜ 4 m +m 2− − 1− imity parameter ε, ρ is no longer a strictly conserved quantity. (cid:18) 1 2(cid:19) Instead,ρbecomesanadiabaticinvariantthatisnearlyconstant, 2/3 (cid:0) (cid:1) exceptwhenthesystemencountersahomocliniccurve(Batygin& 1 15 kM ∆ξ ε= σ2 , (4) Morbidelli2013). 3 4 m +m − k (cid:18) 1 2(cid:19) (cid:18) (cid:19) 4 (Tanaka et al. 2002; Tanaka & Ward 2004): 3.1. Diffusion of Semi-major Axes 1da 1 4f h 2 Inthecompactlimita1 ≈a2,thetimeevolutionofthe parameter χ can be written in the approximate form a dt ≡−τ (cid:39)−τ r mig wave(cid:18) (cid:19) dχ 3 da da 1de 1 3 1 1 2 , (9) . (7) dt (cid:39) 2 a dt − dt e dt ≡−τdmp (cid:39)−4τwave (cid:104) (cid:105)(cid:18) (cid:19) where a is a representative average semi-major axis. A different, routinely employed approach to modeling (cid:104) (cid:105) For the purposes of our simple model, we treat a and disk-driven semi-major axis evolution is to assume that 1 a asuncorrelatedGaussianrandomvariableswithdiffu- it occurs on a timescale that exceeds the eccentricity de- 2 sion coefficients ; we note however, that in reality sig- cay time by a numerical factor . To this end, we note a D thatthevalueof 102 adopteKdbymanypreviousau- nificant correlations may exist between these quantities K∼ and such correlations could potentially alter the nature thors(Lee&Peale2002;Ketchumetal.2011)isinrough oftherandomwalk(Rein&Papaloizou2009). Addition- agreement with equation (7) which yields (h/r) 2. WhileeccentricitydampingobservedinnKum∼ericals−im- ally, for comparable-mass planets, we may adopt τmig as a characteristic drift rate, replacing m with m +m in ulations (e.g., Cresswell & Nelson 2008) is well matched 1 2 equation (7). Note that this assumption leads to the by equation (7), state-of-the-art disk models show that maximum possible rate of orbital convergence. both the rate and direction of semi-major axis evolution With these constituents, we obtain a stochastic differ- can be significantly affected by entropy gradients within ential equation of the form thenebula(Bitsch&Kley2011;Paardekooper2014). Al- though such corrections alter the migration histories on 3 3 χ dχ= 2 dw dt, (10) a detailed level, convergent migration followed by reso- ξ 2 D − 2τ mig nant lockingremains anexpected resultin laminar disks (cid:112) (Coleman & Nelson 2016). For simplicity, in this work, where w represents a Weiner process (i.e., a continuous- we account for this complication by introducing an ad- time random walk; Van Kampen 2001). The variable χ justable parameter f into equation (7). will thus take on a distribution of values as its evolu- In addition to acting as sources of dissipation, proto- tion proceeds. Adopting the t standard deviation → ∞ planetary disks can also drive stochastic evolution. In of the resulting distribution function as a characteristic particular, density fluctuations within a turbulent disk measure of progress in χ, we have: generatearandomgravitationalfield,whichinturnper- turbs the embedded planets (Adams et al. 2008). Such 3 τ 1h 3αΣ a 2 ξ mig δχ= D = (cid:104) (cid:105) . (11) perturbations translate to effectively diffusive evolution (cid:114) 2 4r(cid:115)f(m1+m2) of the eccentricity and semi-major axis (Laughlin et al. 2004; Nelson & Papaloizou 2004). In the ideal limit of The approximate extent of stochastic evolution that MRI-driven turbulence, the corresponding eccentricity thesystemcanexperienceandstillremaininresonanceis and semi-major axis diffusion coefficients can be con- givenbytheresonantbandwidth, ∆χ. Atitsinception3, structed from analytic arguments (e.g., see Johnson et the width of the resonance (Batygin 2015) is given by al. 2006; Adams et al. 2008; Okuzumi & Ormel 2013) to obtain the expressions √k(m +m ) 2/3 1 2 ∆χ 5 . (12) α Σa2 2 (cid:39) (cid:20) M (cid:21) a = D 2 n, (8) Dξ a2 ∼ De ∼ 2 M Accordingly,aroughcriterionforturbulentdisruptionof (cid:18) (cid:19) the resonance is where α is the Shakura-Sunayev viscosity parameter (Shakura & Sunyaev 1973). Although non-ideal effects δχ 1 h M 3α can modify the above expressions on the quantitative ∆χ ∼ 20r m +m f level (Okuzumi & Hirose 2011), for the purposes of our 1 2(cid:114) 1/3 simple model we neglect these explicit corrections. We Σ a 2 Σ a 2 note, however, that suchdetails canbetriviallyincorpo- (cid:104) (cid:105) (cid:104) (cid:105) (cid:38)1. (13) rated into the final answer by adjusting the value of α ×(cid:34) kM (cid:115)m1+m2 (cid:35) accordingly. Keep in mind that δχ is a measure of the width of the 3. CRITERIONFORRESONANCEDISRUPTION distributioninthevariableχduetostochasticevolution, With all components of the model specified, we now whereas ∆χ is the change in χ necessary to compromise evaluatethestabilityofmeanmotionresonancesagainst the resonance. stochastic perturbations. In order to obtain a rough es- Theaboveexpressionforresonancedisruptiondepends timate of the interplay between turbulent forcing, or- sensitively on the planet-star mass ratio. This relation- bital damping, and resonant coupling, we can evalu- ship is illustrated in Figure 3, where the expression (13) ate the diffusive progress in semi-major axis and eccen- is shown as a function of the quantity (m1 + m2)/M, tricity against the width of the resonance. Specifically, 3 A resonance can only be formally defined when a homoclinic the quantities, whose properties we wish to examine are curve(i.e.,aseparatrix)existsinphase-space. ForaHamiltonianof χ n2/n1 k/(k 1) and x. Keep in mind that this theform(1),aseparatrixappearsatε=0,alongwithanunstable ≡ − − latterquantityisdirectlyproportionaltothegeneralized (hyperbolic)fixedpoint,thatbifurcatesintotwofixedpoints(one eccentricity σ (see equation [4]). stableandoneunstable)atε>0. 5 analytical criterion Similarly, the damping timescale takes the form 10 n 1/3 4 e 128 kM kM h k 3 ��/�� nce bro ⌃/ ⌃ τx (cid:39) (cid:18)225m1+m2(cid:19) Σ(cid:104)a(cid:105)2(cid:18)r(cid:19) , (15) na h i where,asbefore,weadoptedthetotalplanetarymassas o 1 s re 0.9 an an approximation for m in the expression (7). 1 0.8 In direct analogy with equation (10), we obtain the e disk evolution e captur 000...765 stochastic equation for the time evoxlution of x, 0.3 stabl 00..43 dx= 2Dxdw− τx dt, (16) 0.2 (cid:112) sothatthedistributionofxischaracterizedbythestan- 0.1 0.1 dard deviation δx=√ τ . At the same time, we take 1 x 10-6 3 x 10-6 1 x 10-5 3 x 10-5 1 x 10-4 x x D the half-width of the resonant separatrix to be given by (m +m )/M 1 2 ∆x = 2 (e.g., Batygin & Morbidelli 2013; Deck et al. Fig. 3.—Analyticcriterionforresonancedisruption. Expression 2012). Combining these two results, we obtain a second (13)isshownasafunctionofthecumulativeplanet-starmassratio, criterion for resonance disruption, i.e., (m1+m2)/M. Resonancesarestableagainststochasticperturba- tionsintheregionofthegraphwhereδχ/∆χ(cid:28)1andareunstable where δχ/∆χ(cid:29)1. Notably, δχ/∆χ∼1 represents a transitional δx h 2 √2k 1/3 Σ a 2 regime, where resonance capture may successfully occur, but will α (cid:104) (cid:105) ∆x ∼ r 15 M generally not be permanent. In this example, the disk viscosity (cid:18) (cid:19) (cid:18) (cid:19) (cid:114) parameterandthediskaspectratioaretakentobeα=10−2 and 5/6 M h/r = 0.05, respectively. The planets are envisioned to reside at (cid:38)1. (17) (cid:104)a(cid:105)=0.1AU,inanebulawithanominallocalsurfacedensity(cid:104)Σ(cid:105) × m +m =17,000gcm−2. Afamilyofcurvescorrespondingtolowervalues (cid:18) 1 2(cid:19) ofthesurfacedensityarealsoshown,andcolor-codedaccordingly. 3.3. Semi-major Axis vs Eccentricity Finally, the migration parameter and the resonance index are set tof =1andk=3,respectively. In order to construct the simplest possible model that stillcapturesthedynamicalevolutionadequately,itisof interest to evaluate the relative importance of stochastic assuming system properties α = 10 2, h/r = 0.05, evolution in the degrees of freedom related to the semi- − a =0.1AU,f =1,andk =3. Thediskprofileistaken major axis and eccentricity. Expressions (13) and (17) (cid:104)to(cid:105)have the form Σ = Σ (r /r), with Σ = 1700g/cm2 both represent conditions under which resonant dynam- 0 0 0 icsofaplanetarypairwillbeshort-lived, evenifcapture and r = 1AU, such that the local surface density at 0 occurs. To gauge which of the two criteria is more strin- a is Σ = 17,000g/cm2. Notice that the disruption (cid:104) (cid:105) (cid:104) (cid:105) gent, we can examine the ratio criterion (13) also depends on (the square root of) the surface density of the disk. A family of curves cor- δx/∆x h k2(m +m ) 1/3 1 2 responding to lower values of the surface density (i.e., 5 f 1. (18) δχ/∆χ ∼ r M (cid:28) 0.1,0.2,...0.9,1 Σ ) are also shown, and color-coded (cid:18) (cid:19)(cid:20) (cid:21) × (cid:104) (cid:105) (cid:112) accordingly. The fact that this expression evaluates to anumber sub- While Figure 3 effectively assumes a maximal rate of stantially smaller than unity means that diffusion in orbital convergence, we reiterate that hydrodynamical semi-majoraxes(equation[13])dominatesoverdiffusion simulations suggest that both the speed and sense of in eccentricities (equation [17]) as a mechanism for dis- type-Imigrationcanhaveawiderangeofpossiblevalues ruption of mean-motion commensurabilities. Although (Paardekooper 2014). To this end, we note that setting the relative importance of compared to is not ob- a e f = 0 in equation (13) yields > 1, meaning that in vious a priori, it likely stemDs in large part fDrom the fact ∞ the case of no net migration, an arbitrarily small turbu- that the orbital convergence timescale generally exceeds lentviscosityissufficienttoeventuallybringtheresonant the eccentricity damping timescales by a large margin. angles into circulation. Furthermore, a negative value of f,whichcorrespondstodivergentmigration,rendersour 4. NUMERICALINTEGRATIONS criterionmeaningless,sinceresonancecapturecannotoc- In order to derive a purely analytic criterion for tur- cur in this instance (Peale 1976). bulent disruption of mean motion resonances, we were forced to make a series of crude approximations in the 3.2. Diffusion of Eccentricities previous section. To assess the validity of these approxi- mations,inthissectionwetestthecriterion(13)through An essentially identical calculation can carried out for numerical integrations. We first present a perturbative stochastic evolution of x (or y). To accomplish this, we approach(Section4.1)andthencarryoutaseriesoffull assume that the generalized eccentricity σ diffuses with N-body simulations (Section 4.2). the coefficient √2 . Accounting for conversion factors e D between conventional quantities and the dimensionless 4.1. Perturbation Theory coordinates (given by equation [3]), we obtain The dynamical system considered here is described by Σ a 2 2 M 4/3 three equations of motion, corresponding to the varia- α (cid:104) (cid:105) . (14) tions in x, and y, and ε. Although the resonant dy- x D (cid:39) (cid:18) M (cid:19) (cid:18)√k(m1+m2)(cid:19) namics itself is governed by Hamiltonian (1), to account 6 0.2 0.4 0.6 0.8 1 full equations of motion are then given by: ⌃/⌃ h i 4 dx x 0� = 3y 1+ε +y x2+y2 1 dt − − τ /[T] = dmp M dy (cid:0) (cid:1) (cid:0) (cid:1) y / = 2+3x 1+ε x x2+y2 ) dt − − − τ /[T] 2 dmp m " + dε 2 [A(cid:0)] (cid:1) x2+(cid:0) y2 (cid:1) = + . (19) 1 m dt 3 kτ /[T] − τ /[T] F ( (cid:18) mig dmp (cid:19) stable resonance capture In the above expression, represents a source of (low libration amplitude) F stochastic perturbations. For computational conve- ⌧ nience, we implemented this noise term as a contin- mig uous sequence of analytic pulses, which had the form 2ζsin(πt/∆t)/∆t, where ζ is a Gaussian random vari- able. The pulse time interval was taken to be ∆t = 0.1, 5� andthestandarddeviationofζ waschosensuchthatthe temporary resonance capture 10 resulting diffusion coefficient = σ2/∆t matched that (large libration amplitude) = Dζ ζ given by equation (8). M resonance broken / Note that here, we have opted to only implement ) m2 stochastic perturbations into the equation that governs + the variation of ε. Qualitatively, this is equivalent to " m1 only retaining semi-major axis diffusion and neglecting ( eccentricity diffusion. To this end, we have confirmed that including (appropriately scaled) turbulent diffusion into equations of motion for x and y does not alter the dynamical evolution in a meaningful way, in agreement with the discussion surrounding equation (18). Turbulent fluctuations aside, the equation of mo- tion for the parameter ε indicates that there exists an 6� equilibrium value of the generalized eccentricity σeq = 0 rneesvoenra snuccec ecsaspftuulre culation M=1 r(cid:112)esτodnmapn/c(e2.kAτmniagl)ogthouatslcyo,rtrheespeoqnudislibtoriustmabvlealcuaeptoufrxeeiqnt=o "eq int. cir m)/2 σtoenqian2[(A1]).pAarsaallerlessuthlte,siftrwicetlnyegreleacltfitxheedsmpoailnltdoisfsHipaamtivile- " + con(cid:112)tributions and set dx/dt=0,dy/dt=0,x=xeq,y = n m1 0 in the first and second equations in expression (19), o ati ( wefindanequilibriumvalueoftheproximityparameter, ul circ εeq, that coincides with resonant locking. An ensuing ext. crucial point is that if resonance is broken, the system willattainvaluesofεsubstantiallyabovetheequilibrium value ε . eq In order to maintain a close relationship with the re- time ( ⌧ w a v e ) sults presented in the preceding section, we retained the Fig. 4.— Evolution of the resonance proximity parameter. The samephysicalparametersforthesimulationsasthosede- top,middle,andbottompanelsoftheFigurecorrespondtocumu- picted in Figure 3. In particular, we adopted α = 10−2, lativeplanet-starmassratiosof(m1+m2)/M =10−4,10−5,and h/r = 0.05, a = 0.1AU, f = 1, and k = 3. Addi- 10−6respectively. Oneachpanel,tensimulationscorrespondingto tionally, we a(cid:104)ga(cid:105)in chose a surface density profile with differentlocalsurfacedensities(0.1,0.2,...0.9,1×(cid:104)Σ(cid:105);color-coded Σ = 1700g/cm2 at r = 1AU, that scales inversely accordingly) are shown. In agreement with the analytic criterion 0 0 (equation13),systemslessmassivethan(m1+m2)/M (cid:46)10−5are with the orbital radius, such that the nominal surface susceptible to turbulent resonance disruption, while systems with density at r = a is Σ = 17,000g/cm2. We also per- (m1+m2)/M (cid:38) 10−5 experience stable resonance capture. Two formed a series(cid:104)o(cid:105)f sim(cid:104)ul(cid:105)ations that span a lower range outoftensimulationswith(m1+m2)/M =10−5 showresonance of surface densities (0.1,0.2,...,0.9,1 Σ ). All of breaking, implying that for the adopted set of physical parame- × (cid:104) (cid:105) the integrations were carried out over a time span of ters,thismassratiocorrespondstocriticalbehavior. Importantly, systemsofthistypecanemergefromtheprotoplanetarydiskwith τmig = 100τwave, with the system initialized at zero ec- largeresonantlibrationamplitudes. centricity (x = y = 0), on orbits exterior to exact 0 0 commensurability ((cid:15) = 1). 0 − Wecomputedthreesetsofevolutionarysequences,cor- forthestochasticanddissipativeevolution,wemustaug- responding to planet-star mass ratios (m1 +m2)/M = mentHamilton’sequationswithtermsthatdescribedisk- 10 6,10 5, and 10 4. As can be deduced from Fig- − − − driven evolution. As before, we adopt τ as the decay ure 3, the qualitative expectations for the outcomes of dmp timescale for the generalized eccentricity, σ, and take these simulations (as dictated by equation [13]) are un- τ as the characteristic orbital convergence time. The equivocally clear. Resonances should be long-term sta- mig 7 (m1+m2)/M=10�6 "eq=36.1 (m1+m2)/M=10�5 "eq=6.9 (m1+m2)/M=10�4 "eq=0.4 small libration amplitude eccednatrimcipityn g separatrix internal y y y circulation resonant large libration domain amplitude external circulation x x x Fig. 5.— Numerically determined phase-space evolution of the dynamical system. As in Figure 4, the left, middle, and right panels correspond to cumulative planet-star mass ratios of (m1+m2)/M =10−6, 10−5, and 10−4 respectively. Simulation results for Σ=(cid:104)Σ(cid:105) (black) and Σ = 0.3(cid:104)Σ(cid:105) (blue) are shown. In each plot, the solid black line depicts the separatrix of the Hamiltonian (1), evaluated at the equilibrium proximity parameter, εeq, while the color scale denotes level curves of H. In the left panel, the trajectories are initially advected to large actions, but eventually break out of resonance and begin decaying towards the fixed point at the center of the internal circulation region of the dynamical portrait. The middle panel shows a critical evolution where stochastic excursions of the trajectories are limited by dissipation to fill a substantial fraction of the resonant phase-space, without breaking out of resonance. Systems in this parameterrangecanemergefromthenebulawithlargeresonantlibrationamplitudes,potentiallyleadingtochaoticevolution. Theright panelshowsanevolutionarysequencewherestochasticforcingplaysanessentiallynegligiblerole,i.e.,theproximityparameterequilibrates andtheorbitcollapsesontotheresonantequilibriumundertheactionofdissipativeeffects. ble for (m +m )/M =10 4 and long-term unstable for tem approaches a null libration amplitude under the ef- 1 2 − (m +m )/M =10 6. Meanwhile, temporary resonance fect of dissipation. In the middle panel (for mass ratio 1 2 − locking,followedbyturbulentdisruptionofthecommen- (m +m )/M = 10 5), resonant capture is shown, but 1 2 − surability should occur for (m +m )/M =10 5. the libration amplitude attained by the orbit is large, 1 2 − Figure 4 depicts numerically computed evolution of ε particularly in the case of Σ = Σ . In the left panel (cid:104) (cid:105) for the full range of local surface densities under consid- (for mass ratio (m +m )/M = 10 6), the trajectory 1 2 − eration (color-coded in the same way as in Figure 3) as is initially advected to high values of the action, but in- a function of time. These numerical results are in ex- evitably breaks out of resonance and decays towards the cellentagreementwithourtheoreticalexpectationsfrom fixedpointatthecenteroftheinternalcirculationregion Section 3. The proximity parameter always approaches of the portrait. its expected equilibrium value ε for large mass ratios eq (m +m )/M =10 4 (toppanel), butneverexperiences 4.2. N-body Simulations 1 2 − long-term capture for small mass ratios (m +m )/M = 1 2 In order to fully evaluate the approximations inherent 10−6 (bottom panel). Resonance locking does occur to the perturbative treatment of the dynamics employed for the intermediate case (m1 +m2)/M = 10−5 (mid- thus far, and to provide a conclusive test of the analytic dle panel). However, two evolutionary sequences corre- criterion (13), we have carried out a series of direct N- spondingtoΣ=0.7 Σ andΣ=0.9 Σ showthesystem body simulations. The integrations utilized a Burlisch- (cid:104) (cid:105) (cid:104) (cid:105) breaking out of resonance within a single orbital conver- Stoer integration scheme (e.g., Press et al. 1992) that gence time, τmig. It is sensible to assume that other included the full set of 18 phase space variables for the evolutionary sequences within this set would also break 3-body problem consisting of two migrating planets or- away from resonance if integrations were extended over biting a central star. For the sake of definiteness, the a longer time period. physical setup of the numerical experiments was chosen Figure5showsthephase-spacecounterpartoftheevo- to closely mirror the systems used in the above discus- lution depicted in Figure 4. Specifically, the x-y projec- sion. Specifically,twoequal-massplanetswereplacedon tions of the system dynamics are shown for cases with initially circular orbits slightly outside of the 2:1 mean surfacedensitiesΣ=0.3 Σ (blue)andΣ= Σ (black), motion resonance, so that the initial period ratio was (cid:104) (cid:105) (cid:104) (cid:105) wherethebackgrounddepictsthetopologyoftheHamil- 0.45. The planets were then allowed to evolve under the tonian (1). In each panel, the black curve designates the influence of mutual gravity, as well as disk-driven con- separatrix of , given the equilibrium value of the prox- vergent migration, orbital damping, and turbulent per- H imity parameter ε = εeq. The background color scale is turbations. ameasureofthevalueof . Thetheeequilibriumpoints Following Papaloizou & Larwood (2000), we incorpo- H of the Hamiltonian are also shown, as transparent green rated the orbital decay and eccentricity damping using dots. accelerations of the form: As in Figure 4, three representative ratios of planet d(cid:126)v (cid:126)v 2(cid:126)r ((cid:126)v (cid:126)r) mass to stellar mass are shown. In the right panel = · , (20) (for mass ratio (m1 + m2)/M = 10−4), turbulent dif- dt −τmig − τdmp ((cid:126)r·(cid:126)r) fusion plays an essentially negligible role and the sys- where(cid:126)v and (cid:126)r denote the orbital velocity and radius re- 8 spectively.4 While both planets were subjected to ec- centricity damping, inward (convergent) migration was 10�6 al onlyexperiencedbytheouterplanet. Simultaneously,for o ers computational convenience, the semi-major axis of the al period rati 1:1 MMR 7:6 MMR 10�5 orbit rev itwtniimcenareeelrkpsptehelpyaptsn5ice.cotanTlwshptaeaasnrcarthe,ma-gnreiaotvecrertmnseraboilysiftzeitecqhduettaimdotiieosaskn1ca(t=7ole)s0,th.aτ1odmAsoiegpUteaimanntdgpeliτodvdyeemerndyp- bit above. Finally, following previous treatments (Adams et or 3:2 MMR 10�4 al. 2008; Rein & Papaloizou 2009; Lecoanet et al. 2009), turbulentfluctuationswereintroducedintotheequations of motion through random velocity kicks, whose ampli- tude was tuned such that the properties of the diffusive evolutionofanundampedisolatedorbitmatchedtheco- efficients from equation (8). For completeness, we have m +m 1 2 = 10�4 10�5 10�6 alsoincludedtheleadingordercorrectionsduetogeneral M relativity (Nobili & Roxburgh 1986). ✓ ◆ As in the previous sub-section, we computed the or- ntricity braittaiolse(vmol1u+timon2)o/Mf th=re1e0−re4p,r1e0s−en5,taatnidve10c−as6e(scowrirtehspmonadss- e ing to migration timescales of τ 1.5 103,104, and ecc 105 yearsrespectively)overatimmige(cid:39)spano×f0.1Myr. The numerical results are shown in Figure 6, and show ex- cellent agreement with the analytic criterion from equa- tion (13). In particular, the system with mass ratio (m +m )/M =10 4 exhibits long-term stable capture 1 2 − into a 3:2 mean motion resonance, as exemplified by the ensuing low-amplitude libration of the resonant angles [3:2] [7:6] φ[3:2] = 3λ 2λ (cid:36) and ψ[3:2] = 3λ 2λ (cid:36) , 2 1 1 2 1 2 − − − − shown in red and blue in the bottom panel of Figure 6. g) Correspondingly, both the period ratio (top panel) and e d theeccentricities(middlepanel)rapidlyattaintheirreso- e ( nant equilibrium values, and remain essentially constant gl n throughout the simulation. a nt The case with mass ratio (m1 +m2)/M = 10−5, for na which equation (13) yields δχ/∆χ 1, perfectly ex- o ∼ s emplifies the transitory regime. As shown in the top e r panelofFigure6,wherethisexperimentisrepresentedin �[3:2] �[7:6] gray, the system exhibits temporary capture into the 3:2 as well as the 4:3 commensurabilities, and subsequently locks into a meta-stable 7:6 resonance at time 15,000 time (years) ∼ years. Although evolution within this resonance is rela- Fig. 6.— Results of direct N-body simulations. This figure tivelylong-lived,thebottompanelofFigure6showsthat shows the time series of the orbital period ratio (top), eccentric- thecorrespondingresonantanglesφ[7:6]=7λ 6λ (cid:36) ities (middle), and resonant angles (bottom) for a pair of plan- 2− 1− 1 (green)andψ[7:6]=3λ 2λ (cid:36) (gray)maintainlarge ets subject to convergent migration, eccentricity damping, and 2 1 2 − − stochastic forcing. The disk is assumed to be comparable to amplitudesoflibration,duetothenearlyperfectbalance the minimum mass solar nebula and the planetary orbits lie at between orbital damping and turbulent excitation. As a a ∼ 0.1AU. Three representative sets of evolutionary tracks are result, the system eventually breaks out of its resonant sInhotwhnetwoipthpamnaels,strhaeticousrv(mes1co+rrmes2p)o/nMdin=g1to0−p4la,n1e0t−-s5t,aarnmda1ss0−ra6-. state. After a period of chaotic scattering, the orbits tios of (m1+m2)/M =10−4,10−5, and 10−6 are shown in blue, switch their order, and the period ratio increases. gray, and purple respectively. In the middle panel, the eccentric- Finally, the case with mass ratio (m + m )/M = ities for (m1+m2)/M = 10−4 are shown as blue (outer planet) 10 6 represents a system that never ex1perienc2es reso- and red (inner planet) curves. Similarly, the gray and green as − wellaspurpleandorangecurveddenotetheeccentricitiesofouter nant locking. As the period ratio evolves towards unity and inner planets for (m1+m2)/M =10−5 and 10−6. The bot- (purple curve in the top panel), encounters with mean tom panel shows resonant arguments φ[3:2] = 3λ2 −2λ1 −(cid:36)1 motion commensurabilities only manifest themselves as (red) and ψ[3:2] = 3λ2 −2λ1 −(cid:36)2 (blue) corresponding to the impulsive excitations of the orbital eccentricities (pur- systemwith(m1+m2)/M =10−4 aswellasresonantarguments φ[7:6] = 7λ2 −6λ1 −(cid:36)1 (green) and ψ[7:6] = 3λ2 −2λ1 −(cid:36)2 ple/orange curves in the middle panel) of the planets. (gray) corresponding to the system with (m1+m2)/M = 10−5. As such, the planets eventually experience a brief phase In agreement with the analytic criterion (13), the system with of close encounters, and subsequently re-enter an essen- (m1 +m2)/M = 10−4 exhibits stable capture into a 3:2 reso- nance,whilethesystemwith(m1+m2)/M =10−5 onlybecomes 4 Note that we have neglected disk-induced damping of the or- temporarily trapped into a 7:6 commensurability before breaking bitalinclination,becauseoftheplanarsetupoftheproblem. out due to turbulent perturbations. Conversely, the system with 5Qualitatively,thisprocedureisequivalenttochangingtheunit (m1+m2)/M = 10−6 never locks into resonance and eventually oftimeateverytimestep(Deck&Batygin2015). suffersorbitreversal. 9 tially decoupled regime, after the orbits reverse. 10 5 10 4 (Figure 1), the majority of these planets − − − We note that because turbulence introduces a funda- aresufficientlymassivethattheirresonancescansurvive mentallystochasticcomponentintotheequationsofmo- in the face of turbulent disruption, provided that the tion,eachrealizationoftheN-bodysimulationsisquan- perturbations operate at the expected amplitudes (this titatively unique. However, having carried out tens of result also assumes that the stochastic fluctuations act integrationsforeachsetofparametersconsideredinFig- over a time scale that is comparable to the migration ure6,wehaveconfirmedthatthepresentedsolutionsare time). indeed representative of the evolutionary outcomes. As Given critical combinations of parameters (for which a result, we conclude that the analytic expression (13) equation [13] evaluates to a value of order unity), reso- represents an adequate description of the requirement nant systems can ensue, but they routinely come out of for resonance disruption, consistent with the numerical thediskevolutionphasewithlargelibrationamplitudes. experiments. Thiseffecthasalreadybeenpointedoutinpreviouswork (Adamsetal.2008;Rein&Papaloizou2009;Lecoanetet 5. CONCLUSION al. 2009; Ketchum et al. 2011), which focused primarily While resonant locking is an expected outcome of mi- on numerical simulations with limited analytical char- gration theory (Cresswell & Nelson 2008; Ogihara et al. acterization. Importantly, this notion suggests that the 2015),thecurrentsampleofexoplanetsshowsonlyamild stochastic forcing mechanism may be critical to setting tendency for systems to be near mean motion commen- up extrasolar planetary systems like GJ876 and Kepler- surabilities (Winn & Fabrycky 2015). Motivated by this 36 that exhibit rapid dynamical chaos (Deck et al. 2012; observational finding, this paper derives an analytic cri- Batygin et al. 2015). terion for turbulent disruption of planetary resonances Although this work has mainly focused on the evolu- and demonstrates its viability through numerical inte- tion of sub-Jovian planets, we can reasonably speculate grations. Our specific results are outlined below (Sec- that turbulent fluctuations are unlikely to strongly af- tion 5.1), followed by a conceptual interpretation of the fect mean motion resonances among giant planets. In calculations (Section 5.2), and finally a discussion of the addition to having mass ratios well above the critical implications (Section 5.3). limit, the influence that the disk exerts on large planets isfurtherdiminishedbecauseofgap-opening(Cridaetal. 5.1. Summary of Results 2006;Duffell&MacFadyen2013). However, onecompli- The main result of this paper is the derivation of the cation regarding this issue is that the damping rate of constraint necessary for turbulent fluctuations to com- eccentricity is also reduced due to the gap (e.g., Duffell promisemeanmotionresonance(givenbyequation[13]). & Chiang 2015). Since both the excitation and damping This criterion exhibits a strong dependence on the ratio mechanisms are less effective in the gap-opening regime, of planetary mass to stellar mass, but also has signifi- a minority of systems could in principle allow for excita- cant dependence on the local surface density. That is, tion to dominate. turbulence can successfully disrupt mean motion reso- 5.2. Conceptual Considerations nances only for systems with sufficiently small mass ra- tios and/or large surface densities (see Figure 3). The analysis presented herein yields a practical mea- The analytic estimate (13) for the conditions required sure that informs the outcome of dynamical evolution forturbulencetoremoveplanetpairsfromresonancehas of multi-planetary systems embedded in turbulent pro- been verified by numerical integrations. To this end, toplanetary disks. While numerical experiments confirm we have constructed a model of disk-driven resonant dy- that the analytic theory indeed provides an acceptable namics in the perturbative regime, and have calculated representation of perturbed N-body dynamics, the phe- the time evolution of the resonance promiximity param- nomenological richness inherent to the problem calls for eter ε (Section 4.1). The results confirm the analytical an additional, essentially qualitative account of the re- prediction that given nominal disk parameters, systems sults. This is the purpose of the following discussion. with mass ratios smaller than (m +m )/M 10 5 Within the framework of our most realistic descrip- 1 2 − ∼ ∼ 3M /M are forced out of resonance by turbulence, tionoftherelevantphysics(i.e.,theN-bodytreatment), whe⊕reas(cid:12)systems with larger mass ratios survive (Fig- the effect of turbulent fluctuations is to provide impul- ure 4). We have also performed full N-body simulations sive changes to the planet velocities. The turbulence of the problem (Section 4.2). These calculations further has a coherence time of order one orbital period, so that indicate that planetary systems with small mass ratios the fluctuations provide a new realization of the random are readily moved out of resonance by turbulent fluctu- gravitationalfieldonthistimescale(Adamsetal.2008). ations, whereas systems with larger mass ratios are not Withtheseimpulses, theorbitalelementsoftheplanets, (Figure 6). Accordingly, the purely analytic treatment, specifically the semi-major axis a and eccentricity e, ex- simulations performed within the framework of pertur- ecute a random walk. In other words, as the elements bation theory, and the full N-body experiments all yield vary, the changes in a and e accumulate in a diffusive consistent results. manner (Rein & Papaloizou 2009). Simultaneously, the For circumstellar disks with properties comparable to interactionsbetweenplanetsandthespiraldensitywaves the minimum mass solar nebula (Hayashi 1981), the re- they induce in the nebula lead to smooth changes in the sults of this paper suggest that compact Kepler-type orbital periods, as well as damping of the planetary ec- planetary systems are relatively close to the border-line centricities (Kley & Nelson 2012). forstochasticdisruptionofprimordialmeanmotioncom- Incontrastwithaforementioneddisk-driveneffects,the mensurabilities. Nonetheless, with a cumulative mass bandwidthofaplanetaryresonanceistypicallydescribed ratio that typically lies in the range of (m +m )/M in terms of maximal libration amplitude of a critical an- 1 2 ∼ 10 gle φ that obeys d’Alembert rules (e.g., see Chapter 8 ities and merge, instead of forming resonant chains. In of Murray & Dermott 1999). Thus, the conceptual dif- essence, this type of dynamical behavior is seen in the ficulty lies in connecting how the extrinsic forcing of or- large-scale numerical experiments of Horn et al. (2012). bital elements translates to the evolution of this angle. For much of this work, the system parameters that we Within the framework of our theoretical model, this link use effectively assume a maximum rate of orbital con- is enabled by the Hamiltonian model of mean motion vergence. Because the quantitative nature of migration resonance (equation [1]; Wisdom 1986). can change substantially in the inner nebula, the ac- In the parameter range relevant to the problem tual rate of orbital convergence may be somewhat lower at hand, the behavior of Hamiltonian (1) is well- (Paardekooper 2014; Bitsch et al. 2015). This change approximated by that of a simple pendulum (Henrard would make planetary resonances more susceptible to & Lamaitre 1983). Specifically, the equilibrium value of stochastic disruption. At the same time, we have not εdictatesthevalueofthependulum’saction,Φ,atwhich taken into account the inhibition of the random grav- zero-amplitudelibrationoftheangleφcanoccur,aswell itational field through non-ideal magnetohydrodynamic as the location of the separatrix. Correspondingly, oscil- effects (Ormel & Okuzumi 2013), which would weaken lationoftheangleφtranslatestovariationsoftheaction the degree of stochastic forcing. Both of these effects Φ,whichisinturnconnectedtotheeccentricities(equa- can be incorporated into the criterion of equation (13) tions[4])aswellasthesemi-majoraxes,throughconser- by lowering the migration factor f and the value of α vation of the generalized Tisserand parameter (Batygin accordingly. However, because both of these quantities & Morbidelli 2013). appear under a square root in the expression, the sensi- In this picture, there are two ways to drive an initially tivity of our results to these corrections is not expected stationary pendulum to circulation: one is to perturb to be extreme. the ball of the pendulum directly (thereby changing the Thisworkassumesthatturbulenceoperatesincircum- energy-level of the trajectory), and the other is to later- stellar disks at the expected levels. The presence of tur- ally rock the base (thus modulating the separatrix along bulence is most commonly attributed to the magneto- the Φ-axis). These processes are directly equivalent to rotational-instability (Balbus & Hawley 1991), which in the two types of diffusion considered in our calculations. turn requires the disk to be sufficiently ionized. Al- That is, [1] diffusion in the dynamic variables x and y though the innermost regions of the disk are expected themselves(explicitlyconnectedtoeccentricitiesandres- to be ionized by thermal processes, dead zones could onant angle) is analogous to direct perturbations to the exist in intermediate part of the disk (Gammie 1996; ball of the pendulum, while [2] diffusion in the proxim- see also Bai & Stone 2013), and ionization by cosmic ity parameter ε (explicitly connected to the semi-major rays can be suppressed in the outer disk (Cleeves et al. axes) corresponds to shaking the base of the pendulum 2013). Indeed,suppressedlevelsofionizationarenowin- back and forth. ferred from ALMA observations of young star/disk sys- Meanwhile, consequences of eccentricity damping and tems(Cleevesetal.2015),implyingthattheassumption convergent migration are equivalent to friction that acts of sufficient ionization — and hence active MRI turbu- to return the ball of the pendulum back to its undis- lence — is not guarenteed. At the same time, our model turbedstate,andrestoretheseparatrixtoitsequilibrium is agnostic towards the origins of turbulent fluctuations position, respectively. In the type-I migration regime themselves, andcanbeemployedequallywellifapurely however, eccentricitydampingbythediskisfarmoreef- hydrodynamic source of turbulence were responsible for ficient than orbital decay (Tanaka & Ward 2004), mean- angular momentum transport within the nebula (Nelson ingthattheballofthependulumiseffectivelysubmerged et al. 2013; Lin & Youdin 2015). in water, while the base of the pendulum is only subject In light of the aforementioned uncertainties inherent to air-resistance (in this analogy). As a result, the latter to the problem at hand, it is of considerable interest to process—diffusioninproximityparameterε—endsup exploreifsimplyadjustingtheparameterscan,inprinci- beingmoreimportantforpurposesofmovingplanetsout ple, yield consistency between the model and the obser- of mean motion resonance (see equation [18]). vations. Thatis,canreasonablechangestothemigration rate,etc.,generateagreementbetweentheturbulentres- 5.3. Discussion onancedisruptionhypothesisandthedata? Usingequa- The work presented herein suggests that turbulent tion(13),wefindthatincreasingthelocalsurfacedensity forcing is unlikely to be the single dominant effect that by an order of magnitude (Σ=10 Σ =170,000g/cm2) sculpts the final orbital distribution of exoplanets. At while lowering the orbital converg(cid:104)en(cid:105)ce rate a hundred- the same time, the functional form of expression (13) fold (f = 0.01) and retaining h/r = 0.05, a = 0.1AU, yields important insight into the evolutionary aspects of α=0.01yields(m +m )/M 2 10 4 (cid:104)60(cid:105)M /M as 1 2 − the planet formation process. Particularly, because the the critical mass ratio, thus e(cid:39)xpla×ining t∼he full⊕rang(cid:12)e of resonancedisruptioncriteriondependsonthediskmass, values shown in Figure 1. Correspondingly, rough agree- it implies a certain time-dependence of the mechanism ment between observations and the stochastic migration itself(asthenebuladissipates,thecriticalmassratiobe- scenarioisreproducedintheworkofRein(2012), where lowwhichthemechanismoperatesdecreasesfromavalue theamplitudeofturbulentforcingwastunedtogivecon- substantiallyabovetheEarth-Sunmassratio,toonebe- sistency with data. low). Thismeansthateventhoughtheturbulentdisrup- Althoughthislineofreasoningmayappearpromising, tionmechanismbecomesineffectiveinaweaningnebula, it is important to note that as the disk accretes onto the it may be key to facilitating growth in the early stages star, the local surface density will diminish, causing the of evolution of planetary systems, by allowing pairs of critical mass ratio to decrease as well. Meanwhile, even proto-planets to skip over mean-motion commensurabil-