loading

Logout succeed

Logout succeed. See you again!

ebook img

Anaerobic digestion of the microalga Spirulina at extreme alkaline conditions PDF

pages21 Pages
release year2015
file size2.94 MB
languageEnglish

Preview Anaerobic digestion of the microalga Spirulina at extreme alkaline conditions

ORIGINALRESEARCH published:22June2015 doi:10.3389/fmicb.2015.00597 Anaerobic digestion of the microalga Spirulina at extreme alkaline conditions: biogas production, metagenome, and metatranscriptome VímacNolla-Ardèvol1*, MarcStrous1,2,3 andHalinaE.Tegetmeyer1,3,4 1InstituteforGenomeResearchandSystemsBiology,CenterforBiotechnology,UniversityofBielefeld,Bielefeld,Germany, 2DepartmentofGeoscience,UniversityofCalgary,Calgary,AB,Canada,3MicrobialFitnessGroup,MaxPlanckInstitutefor MarineMicrobiology,Bremen,Germany,4HGF-MPGGroupforDeepSeaEcologyandTechnology,AlfredWegenerInstitute, HelmholtzCentreforPolarandMarineResearch,Bremerhaven,Germany A haloalkaline anaerobic microbial community obtained from soda lake sediments was Editedby: used to inoculate anaerobic reactors for the production of methane rich biogas. The MarkAlexanderLever, ETHZürich,Switzerland microalga Spirulina was successfully digested by the haloalkaline microbial consortium Reviewedby: atalkalineconditions(pH10,2.0MNa+).Continuousbiogasproductionwasobserved AharonOren, and the obtained biogas was rich in methane, up to 96%. Alkaline medium acted TheHebrewUniversityofJerusalem, as a CO scrubber which resulted in low amounts of CO and no traces of H S Israel 2 2 2 RonaldOremland, in the produced biogas. A hydraulic retention time (HRT) of 15 days and 0.25g UnitedStatesGeologicalSurvey,USA SpirulinaL−1day−1organicloadingrate(OLR)wereidentifiedastheoptimaloperational *Correspondence: parameters. Metagenomic and metatranscriptomic analysis showed that the hydrolysis VímacNolla-Ardèvol, InstituteforGenomeResearchand of the supplied substrate was mainly carried out by Bacteroidetes of the “ML635J-40 SystemsBiology,Centerfor aquaticgroup”whilethehydrogenotrophicpathwaywasthemainproducerofmethane Biotechnology,UniversityofBielefeld, inamethanogeniccommunitydominatedbyMethanocalculus. OfficeG2-152,Universitätstraße27, D-33615Bielefeld,Germany Keywords:haloalkaline,biogas,methanerich,microalgae,alkalinelake,Spirulina,Methanocalculus [email protected] Specialtysection: Introduction Thisarticlewassubmittedto ExtremeMicrobiology, Extremophilic microorganisms are bacteria and archaea which inhabit, thrive in and colonize asectionofthejournal FrontiersinMicrobiology environmentscharacterizedbyextremelyharshconditions(BerlemontandGerday,2011;Gupta et al., 2014). Haloalkaline microorganisms are a specific group of extremophiles which have Received:13March2015 the ability to thrive at high concentrations of salt, up to 7.0M and high pH, up to pH 11, Accepted:31May2015 Published:22June2015 and high carbonate concentration (Grant et al., 1990; Baumgarte, 2003; Sorokin et al., 2014). Their specific abilities to withstand high alkalinity and high salinity have pawned multiple Citation: Nolla-ArdèvolV,StrousMand biotechnologicalapplications,suchasenzymesforthedetergentindustryandthebioremediation TegetmeyerHE(2015)Anaerobic andbiotransformationofwastefromhaloalkalineprocesses(Horikoshi,1999;VanLieretal.,2001; digestionofthemicroalgaSpirulinaat Zhaoetal.,2014). extremealkalineconditions:biogas production,metagenome,and Abbreviations:HRT,Hydraulicretentiontime;OLR,Organicloadingrate;OM,Organicmatter;CODT,Totalchemical metatranscriptome. oxygendemand;CODS,Solublechemicaloxygendemand;VFAs,Volatilefattyacids;SMP,Specificmethanepotential;BDCH4, Front.Microbiol.6:597. percentageofsubstrateconversiontomethane;Alk-HRT,AlkalineHRTreactor;Alk-OLR,AlkalineOLRreactor;Alk-Opt, doi:10.3389/fmicb.2015.00597 AlkalineOptimalreactor;CDS,CodingDNASequence;CFB,Cytophaga-Flavobacteria-Bacteroidesgroup. FrontiersinMicrobiology|www.frontiersin.org 1 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina Haloalkaline microorganisms have also been proposed to be between the involved microbial populations can contribute to applied in the production of biofuels such as hydrogen and the optimization of the anaerobic digestion of the desired ethanol(Zhaoetal.,2014).VanLeerdametal.(2008)showedthat substrate. Therefore, the metagenome and metatranscriptome itwaspossibletouseahaloalkalineconsortiumtoproducebiogas of the haloalkaline anaerobic community responsible for the undercontrolledconditions.Theabilityofhaloalkalinebacteria degradation of OM and the production of methane is also andarchaeatoliveinalkalineenvironmentscouldbeexploited presented. to produce biogas rich in methane. At alkaline conditions, the carbonate system, CO /HCO−/CO2−/OH−, shifts toward the 2 3 3 Materials and Methods formation of bicarbonate, CO2−, therefore, the CO released 3 2 duringthedecompositionoforganicmatter(OM)wouldremain BioreactorSet-up trappedinsolutionas(bi)carbonateresultinginbiogascomposed A 2.0 L semi-continuous stirred tank reactor (S-CSTR) with mainly of methane. This methane rich biogas could directly be ◦ a working volume of 1.5 L operating at 35 C and at high used as biomethane for vehicles or for the national gas grid pH (∼10) and high salt concentration (2.0M Na+) was set (Perssonetal.,2006;Weiland,2010). up and operated at anaerobic conditions. The same reactor In order to produce biogas at alkaline conditions, it is was used in three different experiments: (i) determination of necessary to use a haloalkaline microbial consortium which, the optimal Hydraulic Retention Time (HRT) (Alk-HRT); (ii) for example, can be obtained from soda lakes which are determinationoftheoptimalOrganicLoadingRate(OLR)(Alk- natural ecosystems with pH values of up to 12 and high OLR)and(iii)operationatoptimalidentifiedparameters(Alk- salt concentrations (Grant, 2006). Some studies have already Opt).Thesubstrate,freezedriedSpirulina(SonnenmachtGmbH, demonstrated the presence of methanogenic archaea as well Germany) and the alkaline medium, in g L−1: Na CO , 95.0; 2 3 as the production of methane in soda lakes and in soda lake NaHCO ,15.0;NaCl,16.0andK HPO ,1.0;werethesameforall 3 2 4 sediments(Sorokinetal.,2004,2015;Nolla-Ardèvoletal.,2012). threeexperiments.Twodifferentmicronutrientssolutionswere Spirulinaisamicroalgaknowntogrowinsuchsodalakes(Jones used throughout the different experiments (Table1). Solution- and Grant, 1999) and has already been used as substrate for 1wasusedinreactorsAlk-HRTandAlk-OLRwhileSolution-2 biogas production at mesophilic pH conditions (Samson and was used in Alk-Opt. The medium was prepared in lots of 1.0 LeDuy,1986;Vareletal.,1988;Mussgnugetal.,2010). ◦ ◦ L, its pH was adjusted to 10.0 at 35 C, and was stored at 37 C Metagenomics has become a common technique to study until use. Feed was prepared fresh every day by dissolving the taxonomy and gene composition in uncultured microbial appropriate amount of Spirulina in alkaline medium in order communities (Simon and Daniel, 2011). The binning of to obtain the desired organic loading rate. The daily purge and assembled contigs (based on tetranucleotide frequencies) into feed were performed manually with a syringe and through a provisionalwholegenomesequencescangiveinformationabout the most abundant and relevant community members (Strous et al., 2012). Moreover, provisional whole genome sequences enable the inference of an ecological function for each major TABLE1|Micronutrientsolutioncomposition. community member (e.g., biomass hydrolysis, fermentation, Solution-1* Solution-2** methanogenesis etc.). Metatranscriptomics, the sequencing and analysis of mRNAs, can give information about the actual Reactors Alk-HRT/Alk-OLR Alk-Opt activefunctionsofagivenmicrobialcommunity(Gilbertetal., Compound mgL−1 mgL−1 2008; Urich et al., 2008). The combination of the binning FeSO4·7H2O – 2000 approach, where provisional whole genome sequences of the FeCl2·4H2O 2000 – abundantcommunitymembersaregenerated,withthemapping MnCl2·4H2O 500 500 of transcriptome reads to these provisional genomes, can give H3BO3 50 300 firsthand information about the ecological function of each of ZnCl2 50 – themostabundantorganismspresentinamicrobialcommunity CoCl2·6H2O – 200 (Chistoserdova,2014). Na2SeO3·5H2O 164 164 The anaerobic digestion of OM is a complex process that NiCl2·6H2O – 92 involvestheparticipationofbothbacteriaandarchaea(Schlüter ZnSO4·7H2O – 100 et al., 2008; Wirth et al., 2012). Under alkaline conditions this AlCl3·8H2O – 90 likelyalsoappliesbuttodate,thedifferentfunctionalgroupshave (NH4)6Mo7O24·4H2O 50 50 only been addressed individually (Sorokin and Kuenen, 2005b; KivistöandKarp,2011;Antonyetal.,2012;Sorokinetal.,2015). CuCl2·6H2O 38 38 Yeastextract 200 200 In this work we present, to the best of our knowledge, VitaminsRPMI-1640*** 1.0ml the first study of biogas production from organic biomass at alkaline conditions (pH ∼10; 2.0M Na+) in a semi- Solution was prepared in 1 L batch and added to the macronutrient solution at a continuous stirred tank reactor inoculated with a strict concentrationof10mLperliter. *ModifiedfromVidaletal.(1997). haloalkaline microbial consortium. A good understanding of **Dr.DimitryYSorokinpersonalcommunication. the taxonomic composition and the functional interactions ***SigmaAldrich. FrontiersinMicrobiology|www.frontiersin.org 2 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina settler. To avoid excessive loss of microorganisms, the biomass Where, a, b, c, d, and e come from the empirical formulae was settled before purging by stopping the stirring for at least (C H O N S ) and Bo—Exp is the experimental methane a b c d e 2h. Periodically thepurged sludge was sampled for analysis; in production(CH gVS−1)andBo—ThistheBMP ofSpirulina. 4 Th that case the stirring was not stopped. pH and redox potential inthereactorsweremonitoredwithaMettlerToledopHprobe DeterminationoftheOptimalHydraulicRetention (HA405-DPA-SC-S8/225) and a Mettler Toledo Redox probe Time(HRT) (Pt4805- DPA-SC-S8/225) respectively (Mettler Toledo GmbH, ReactorAlk-HRTwasinoculatedwith1,200mlofalkalinesludge Germany).Mesophilictemperatureconditionsweremaintained obtained from a start-up alkaline reactor inoculated with a withaPt-1000temperaturesensorandaheater. mixture of soda-lake sediments obtained from the Kulunda steppe(Russia)in2010andalsofedwithfreezedriedSpirulina. AnalyticalMethods Additionally 300ml of fresh alkaline medium were added resultinginatotalvolumeof1,500ml.Thereactorwasoperated In addition to continuous measurements of pH and redox with an OLR of 1.0g Spirulina L−1 day−1 (dry weight) and at potential, alkalinity and total and volatile solids (TS and VS) fivedifferentHRT,5,10,15,20,and30days.Aninitial25days in the digesters were periodically analyzed. Biogas production adaptation period was performed during which the purge and was determined by measuring the pressure build up with a feeding of the reactor was done every 2 days at 1.0 g Spirulina pressure-meter(WAL-BMP-Testsystem3150,WAL,Germany) and normalizing to standard conditions (0◦C; 1.0 atm). Biogas L−1 day−1 (dry weight) and with a 20 day HRT. Subsequently the feeding was shifted to daily feeding while the HRT was composition (CH , CO , and H S) was analyzed once a week 4 2 2 maintainedat20daysandtheexperimentstarted.Table2shows by means of a Shimadzu GC-2010 plus Gas Chromatograph the duration of the test periods and the amount of medium (Shimadzu Corp, Japan) equipped with an Agilent GS-Gaspro exchanged daily for each of the tested HRTs. After 215 days of capillarycolumn(part#113-4362)(AgilentTechnologies,USA). continuousbiogasproductiontheexperimentwasconcludedand Samples for biogas composition were obtained using a gas- thereactorstopped. tight syringe and were kept in 3.0ml gas-tight vials (Labco Limited,UK)untilanalysis.Analysestocharacterizethedigester DeterminationoftheOptimalOrganicLoading effluentwerecarriedoutperiodicallydirectlywiththerawsample Rate(OLR) and with the soluble fraction by centrifuging the samples at OnethousandtwohundredmilliliterofsludgefromtheAlk-HRT 4600rpm for 5min and filtering the supernatant through a reactorplus300mlofalkalinemediumwereusedtoinoculatethe RotilaboCME0.45µmnylonfilter(CarlRothGmbH,Germany). sameS-CSTR,nowAlk-OLR.TheAlk-OLRreactorwasoperated Once a week, TS and VS were analyzed following the 2540B at15daysHRTandatdifferentOLR,0.25,0.5,and1.0gSpirulina and2540EmethodsoftheAmericanPublicHealthAssociation L−1 day−1 (dry weight) (Table2). Before the experiment was (APHA, 2005) standard methods. Alkalinity, OM, measured started,thereactorwasfedevery2daysandoperatedataloading as total chemical oxygen demand (COD ), and ammonium + T rate of 0.25g Spirulina L−1 day−1 for a period of 15 days. The nitrogen (NH -N) were analyzed using colorimetric methods 4 Alk-OLRexperimentlastedfor141daysafterwhichthereactor (HachLangeGmbH,Germany).SolubleCOD(COD )andtotal S wasstopped. nitrogen(TN)wereanalyzedonceevery2weeksalsowithHach Lange colorimetric methods. Free ammonia nitrogen (NH -N) 3 OperationatOptimalHRTandOLRConditions concentrationwascalculatedasinAstalsetal.(2012).Samplesfor Alk-Opt reactor was operated at the optimal HRT, 15 days, measuring specific volatile fatty acids (acetate, propionate, iso- and optimal OLR, 0.25 g Spirulina L−1 day−1 (dry weight). butyrate,n-butyrate,iso-valerate,andn-valerate)wereprepared The inoculum for Alk-Opt consisted of 1.5L of alkaline sludge according to the APHA (2005) 5560D procedure and analyzed obtainedfromasecondalkalinereactor(Alk-Sed-2)whichwas using a Shimadzu GC-2010 plus Gas Chromatograph coupled inoculatedwithasecondbatchoffreshsedimentsobtainedfrom to an FID detector and equipped with a Macherey-Nagel the same soda lakes in 2012 and used within 6 months of the Optima FFA plus capillary column (Macherey-Nagel GmbH & sampling date and had been operating for over 190 days with Co. Germany). Theoretical biomethane potential (BMP ) of Th Spirulina,627mlCH gVS−1,wascalculatedwithEquation(1) constantbiogasproduction.Thestart-upoftheAlk-Optreactor 4 consistedofa15daysperiodduringwhichSpirulina(0.25gL−1 based on the chemical composition C4H7O1N0.8S0.02 (Ortega- day−1)feedingwasperformedevery2dayswitha15daysHRT. Calvo et al., 1993). The percentage of substrate conversion to Afterthestart-upperiodtheexperimentstartedandthefeeding methane,BD (%),wascalculatedwiththeEquation(2). CH4 was set to a daily basis. The reactor was operated for 67 days (Table2). BMP = h(cid:0)a2(cid:1)+(cid:16)b8(cid:17)−(cid:0)4c(cid:1)−(cid:16)38d(cid:17)−(cid:0)4e(cid:1)i∗22,400 MetagenomeandMetatranscriptomeAnalysis Th 12a+b+16c+14d+32e DNAandRNAExtraction (cid:0) (cid:1) 15.0mLofsludgeobtainedfromreactorAlk-Sed-2wereusedfor (Raposoetal.,2011) (1) DNA extraction. DNA was extracted according to Zhou et al. BD (%)= Bo−Exp∗100(Raposoetal.,2011) (2) (1996)withminormodificationsinordertooptimizetheDNA CH4 Bo−Th extraction.Thesamplewasfirstwashedthreetimeswitha1.0M FrontiersinMicrobiology|www.frontiersin.org 3 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina TABLE2|Alkalineanaerobicreactors. Anaerobicbioreactors Alk-HRT Alk-OLR Alk-Opt Periods I II III IV V I II III – Duration(Days) 20 25 40 38 92 52 46 41 67 From–To(Days) 1–20 21–44 45–84 85–123 124–215 1–53 54–99 100–141 1–67 HRT(Days) 20 5 10 30 15 15 15 15 15 Purge/Feed(mlday−1) 75 300 150 50 100 100 100 100 100 OLR(gSpirulina(LRday)−1)* 1.0 1.0 1.0 1.0 1.0 0.25 0.50 1.0 0.25 Operationalparametersanddurationofeachdifferentperiodforthethreeanaerobicbioreactorsused,Alk-HRT,Alk-OLR,andAlk-Opt. *Dryweight. NaCl solution to reduce the alkalinity. Additionally, during the template preparation was performed using the OneTouch Lysozyme incubation period, 200µL of 200mM AlNH (SO ) Instrument.EnrichedISPparticlesweresequencedwiththeIon 4 4 2 solution was added to precipitate humic acids (Braid et al., PGM™400SequencingKit(LifeTechnologies,USA)ona318™ 2003;Fotietal.,2008).ExtractedDNAwaspurifiedwithanion Chipwith1,000flowsforboththeDNAandcDNAsequencing, exchangecolumn(Macherey-Nagel,Germany)andre-suspended followingthemanufacturer’sinstructions. inTEbuffer. Automated quality control of the sequenced reads was RNA was extracted from the same anaerobic reactor 2 days performed with the Torrent Suite™ Software v3.2 using aftertheDNAextraction.Between12and16mloffreshsludge default settings. Additional quality filtering was done using the ◦ was obtained from the reactor, centrifuged for 10min at 4 C Trimmomatictoolv3(http://www.usadellab.org/cms/index.php? and14,000rpm.Supernatantwasremovedandforeachmilliliter page=trimmomatic)(Lohseetal.,2012)withsettingsforremoval of remaining pellet, 3.0ml of “Life Guard Soil Preservation of trailing bases of a q-value lower than 20, and removal of Solution”(MoBio#12868-100)(LGPS)wereadded.Themixture remainingreadsshorterthan100bpandlongerthan450bpfor ◦ wasvortexed,stored2daysat4 Ctoallowpreservationofcells DNAandshorterthan20bpandlongerthan350bpforcDNA. andsubsequentlystoredat−20◦CuntilusedforRNAextraction. RNA was extracted following Smith et al. (2007) protocol with MetagenomeAnalysis minormodifications.Toreducealkalinityandsaltconcentration RemovalofSpirulinaReads ofthestoredsamples,apreliminarywashingstepwasperformed Quality trimmed reads were uploaded to the MGX platform, ◦ (5mincentrifugationat4 Cand14,000rpmtopelletandremove a metagenomics platform currently being developed at the supernatant,followedbyadditionof2.0mlLGPSandasecond CeBiTec (Bielefeld University), for a rapid prescreening of the centrifugation step). The supernatant was removed and 1.0ml reads. A preliminary taxonomic analysis revealed over 30% of of TRI reagent was added to the pellet. From this point, the reads assigned to Spirulina which were removed as follows: Smithetal.(2007)protocolwasfollowed.18µgoftotalextracted First,3,125sequences,fromallgenomesandcuratedsequences RNA were treated with DNase and Riboblock RNase inhibitor (RefSeq)fromtheNCBIdatabase(November2013)classifiedas (Fermentas, Thermo Fisher Scientific GmbH, Germany) and Spirulina/Arthrospira,weredownloaded.Next,qualitytrimmed purified with Qiagen RNeasy MiniElute Cleanup kit (Qiagen reads were blasted (Altschul et al., 1990) against these 3,125 GmbH, Germany). Ribo-zero rRNA removal kit (Bacteria) was sequencesinordertoidentifyreadsoriginatingfromSpirulina. usedtoremoveribosomalRNAfromthepurifiedRNAsample. Blastn was performed with an e-value of 1e-10, a maximum of Purified mRNA was stored at −80◦C until sequencing library onetargetpersequenceandwithaminimumof98%ofidentity. preparation. AnyreadthathadablasthittoanyofthedownloadedSpirulina sequenceswasremovedfromthedataset. DNAandcDNALibraryPreparation 2.5µg of purified extracted DNA were used to prepare a 400 AnalysisofSequencingReads bp insert size sequencing library for the Ion Torrent Personal Analysisofassembledreads Genome Machine (PGM) platform (Life Technologies, USA). Quality trimmed, Spirulina filtered reads were assembled into The instructions according to the Ion Xpress™—Plus gDNA contigs using the Genome Sequencer De Novo Assembler FragmentLibraryPreparationmanualwerefollowed,exceptfor Software v2.8 (Roche Applied Science, Germany). Two the initial DNA fragmentation, which was done using a GS assemblies(AandB)wereperformed:assemblyAwasdonewith FLXStandardNebulizerKit(RocheAppliedScience,Germany), defaultsettingsforgenomicDNA,andassemblyBwasdonewith nebulizationfor3minat32psi. morestringentsettings,accordingtoFanetal.(2012),forbetter For cDNA library preparation, the “Ion Total RNA-seq kit assemblyof16SrRNAsequences. v2forwholetranscriptomelibraries”wasused.20ngmRNAof Contigs from assembly A were binned into provisional thesamplewereusedtopreparethecDNAlibrary.Sequencing whole genome sequences of abundant populations in order to FrontiersinMicrobiology|www.frontiersin.org 4 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina taxonomically analyze the microbial population. Contigs were the mapping of transcripts was done using the–very-sensitive binned,usingtheMetawattv1.7pipeline(http://sourceforge.net/ option (see http://bowtie-bio.sourceforge.net/bowtie2/manual. projects/metawatt)(Strousetal.,2012).Binningoptionswereset shtml#setting-function-optionsfordetails). as follows: read length 200 nt; minimum bin size 100kb and AnalysisofTranscriptMappings minimum contig size 500 bp. Generated bins were manually revised and assigned to a taxon by blasting all contigs from Genbank files containing the CDS sequences obtained with the selected bins against the 16S rRNA SILVA database (Quast GenDB, and SAM files generated with Bowtie2 were uploaded et al., 2013). Coverage and bin size of each particular bin were to ReadXplorer for analysis of the mapped transcripts (Hilker usedtoestimatetheabundanceofeachpopulation.Furthermore, etal.,2014).The“RPKM”optionwithdefaultsettingswasused transfer-RNAs of each bin were identified with ARAGORN todeterminetheexpressionoftheidentifiedCDSineachsuper- (Laslett and Canback, 2004) and the genome completeness for contig.The“FeatureCoverageAnalysis”toolwasusedtoremove each population was estimated by the identification of 139 those CDS with mapped mRNA transcripts with less than 1× conservedPfamsasdescribedbyCampbelletal.(2013). meancoverageandcoveredlessthan50%ofthegivenCDS.In some particular cases, CDS mapped with transcripts were not Phylogenyofassembled16SrRNAsequences assigned to any function by GenDB. In this case, the 10 most To identify 16S rRNA sequences among the assembled contigs, activeCDSaccordingtotheirRPKMvaluewereblastedagainst allcontigsfromassembliesAandBweresubmittedtoablastn the protein RefSeq database (April 2015) and the top hit was search against the RDP database (v11-2) (Cole et al., 2013). assignedastheCDSfunction.Forcomparisonbetweendifferent Sequencepartswithahitwereextractedandalignedpartswitha bins, the RPKM values were normalized to the assembly depth minimumlengthof1,000bpforbacteriaandarchaeaand500bp (sequencingcoverage)ofeachbin. forBacteroideteswereusedtocreatephylogenetictrees. DetectionofGenesandTranscriptsSpecificfor The assembled 16S rRNA sequences were submitted both Methanogenesis to the RDP classifier (Wang et al., 2007) and the SINA classifier (Pruesse et al., 2012) with the confidence threshold AllDNAsequencesassignedtothethreedifferentmethanogenic or minimum sequence similarity set to 80%, respectively. The pathways (modules M00567, M00356, and M00357) were sequences were also submitted to a blastn search against the downloadedfromtheKEGGdatabase(KanehisaandGoto,2000) May 2014 NCBI nucleotide collection (nr/nt), and reference in April 2015 and blasted (blastn; cutoff e-value 3e-03) against RNA sequences (refseq_rna). For both blastn searches the theCDSsequencesobtainedwithGenDBfromthemethanogen top blast hit for each query sequence was obtained. All super-contigandagainstallunbinnedcontigs.RPKMvalueofthe sequences (16S rRNA contig parts and blast search hits), mappedmRNAtranscriptswasusedtoevaluatetheactivityofthe were aligned with muscle (Edgar, 2004). Phylogenetic trees identifiedenzymes. were generated with FastTree (Price et al., 2010) with the Metagenomic and metatranscriptomic reads and assembled GTR+CAT model, bootstrapping (500 reps.) was done using contigs are accessible via NCBI under the Bioproject seqboot[v3.67,http://evolution.genetics.washington.edu/phylip. PRJNA281982. The Whole Genome Shotgun project has html (Felsenstein, 2005)]. Bootstrap values were implemented been deposited at DDBJ/EMBL/GenBank under the accession into the main tree using the CompareToBootstrap.pl script numbers LCWY00000000 and LCWZ00000000. The versions (Price M. N., http://www.microbesonline.org/fasttree/treecmp. described in this paper are versions LCWY01000000 and html).Finally,treesweredrawnusingDendroscope(Husonetal., LCWZ01000000. The sequenced reads were submitted to 2007). the Sequence Read Archive with sample accession numbers SRS923957 for the metagenomic reads and SRS923955 for the metatranscriptomic reads. The 17 16S rRNA sequences used MetatranscriptomeAnalysis for the generation of the phylogenetic trees were submitted FunctionalAnnotationofSelectedBins to GenBank under the sample number SAMN03565345, with Selected bins generated as described in (Section Analysis of accessionnumbersKR476494toKR476510. AssembledReads)werefunctionallyannotated.First,allcontigs fromagivenbinwereconcatenatedintoonesuper-contigusing the linker sequence CTAGCTAGCTAG. Each super-contig was Results uploaded to GenDB and automatically annotated (Meyer et al., 2003).Thesameprocedurewasdonewithallcontigsthatwere Inthiswork,theanaerobicdigestionofthemicroalgaeSpirulina notassignedtoanybin,UnbinnedContigs. atalkalineconditions,pH∼10,2.0MNa+,60–95gCaCO3L−1, wasstudiedincombinationwiththeanalysisofthemetagenome MappingofTranscripts and metatranscriptome of the anaerobic haloalkaline microbial Bowtie2 v2.2.4 (Langmead and Salzberg, 2012) was used to community. alignqualitytrimmedtranscriptreadstoeachannotatedsuper- contig. To ensure that a particular transcript was only aligned BiogasRichinMethane once, first, all super-contigs, including the UnbinnedContigs The anaerobic digestion at alkaline conditions produced, as were combined into one single file. Subsequently Bowtie2 was expected, biogas rich in methane throughout the different used to create indexes from the combined super-contigs and experiments. In the Alk-HRT reactor, the composition of the FrontiersinMicrobiology|www.frontiersin.org 5 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina biogaswasnotconstantandvariedwiththechangesintheHRT. Themeanpercentageofmethanethroughouttheexperimentwas 83%whilethecarbondioxidecontentwas12%(Figure1A).The highestmethanecontentwasobtainedinP-IV,day93,with96% CH andinP-V,day171,with94%CH ,whiletheCO content 4 4 2 onthese2dayswas2and5%respectively.Thedropinmethane percentageonday123(P-IV)wasduetoamaintenanceopening of the reactor. From this day on, the methane content rapidly increasedfrom67to86%andthenfurtherto94%onday171. Atthesametime,thecarbondioxideintheheadspacegradually decreased(Figure1A). ThebiogasproducedintheAlk-OLRreactorwasalsorichin methane,withameanvalueof82%throughoutthethreeperiods (Figure1B).Thehighestmethanepeakwasobtainedonday116 with92%ofCH .Carbondioxidepresentintheheadspacevaried 4 between 16 and 1% with its mean value at 6%. As in the other tworeactors,methanecontentinAlk-Optreactorwasalsohigh, withpeaksupto90%andtheCO waspracticallyabsentfrom 2 the headspace of the bioreactor (Figure1C). It is worth noting that in all three experiments, Alk-HRT, Alk-OLR and Alk-Opt, H S gas was never detected in the headspace of the reactors 2 (Figure1). DeterminationoftheOptimalHydraulicRetention Time(HRT) In Alk-HRT reactor, five different HRT were tested, 20, 5, 10, 30, and 15 days, periods P-I to P-V respectively (Table2). In thecourseoftheexperimenttheHRTwasadjustedtoimprove the biogas production rate: it was reduced when accumulation ofpotentiallyharmfulammoniaandvolatileacidswasobserved, anditwasincreasedwhentheconcentrationofthesecompounds was low and biomass washout was more likely to be the cause of reduced biogas production. The initial 20 days HRT was chosenbasedonourexperiencewiththeanaerobicdigestionof Spirulina at neutral pH. Biogas production in Alk-HRT reactor was continuous and the produced biogas was rich in methane (Figure1A). Changes in the HRT had a clear effect on the daily biogas production (Figure1A). Changing the HRT from 20 to 5 days (P-ItoP-II)resultedinadecreaseinthedailybiogasproduction while doubling the HRT to 10 days (P-III) did not result in a marked increase in the biogas production (Figure1A). IncreasingtheHRTto30days(P-IV)initiallyledtoanincrease inthebiogasproduction,however,onday99(day14ofperiodP- IV),asuddendropfrom27to11mlofgasperdaywasobserved. In the subsequent days, the daily biogas production gradually recovereduntilday115whenitdroppedto1.9ml(Figure1A). After 2 days of almost zero biogas production, accumulated FIGURE1|Biogasproductionandcomposition.Dailybiogasproduction potentially inhibitory substances were removed by pausing the (grayline—leftaxis)andbiogascomposition(rightaxis):CH4(•)andCO2((cid:4)), Spirulinafeedingandbyreplacing50mlofsludgeeachdaywith fromtheanaerobicdigestionofSpirulinaatalkalineconditionsin:(A)Alk-HRT fresh alkaline medium. After 5 days the feeding was resumed reactor.Dashedverticallinesindicateachangeinthehydraulicretentiontime: 20(P-I),5(P-II),10(P-III),30(P-IV),and15days(P-V);(B)Alk-OLRreactor. at 1.0 g Spirulina L−1 day−1 and the HRT was set to 15 days Dashedverticallinesindicateachangeintheorganicloadingrate:0.25(P-I), (P-V). The 5 days exchange of sludge for fresh medium had a 0.5(P-II)and1.0gSpirulinaL−1day−1(P-III),and(C)Alk-Optreactor.Inall positiveeffectandthedailybiogasproductionwasresumedand threecases,theremainingpercentageofgastoreach100%correspondsto increasedfrom27ml(day123)to60mlofbiogasperday(day nitrogengas. 162) during period P-V. From this point forward, the biogas FrontiersinMicrobiology|www.frontiersin.org 6 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina production was stable at around 50ml of gas per day until the replacingsludgeforfreshmedium[seeSectionDeterminationof endoftheexperiment(Figure1A). the Optimal Hydraulic Retention Time (HRT)]. This approach From the five different HRT tested, 15 days appeared to be reduced the free NH content to 850mg L−1, as well as 3 theoptimalaswiththisHRT,thehighestbiogasproductionand the concentration of VFAs, allowing the anaerobic microbial thehighestpercentageofsubstrateconversiontomethanewere communitytorecoverandforthebiogasproductiontoresume achieved(Table3). (Figure2). By setting the HRT to 15 days the accumulation of NH ,andVFAswaspreventedandtheinhibitoryeffectreduced, 3 DeterminationoftheOptimalOrganicLoading whichresultedinastablebiogasproduction. Rate ThebiogasproductionintheAlk-OLRwasinfluencedbythe TheoptimalOLRwasdeterminedwithalkalinereactorAlk-OLR accumulation of OM (measured as CODT and CODS) which which was operated at 15 days HRT. The starting OLR was set drastically affected its performance (Figure3). When the OLR to0.25gSpirulinaL−1 day−1 andwasgraduallyincreaseduntil was increased to 1.0 g Spirulina L−1 day−1, the CODT rapidly reactorfailure.AsinAlk-HRT,thepHwasconstantatpH10and increased,from10to17gO2L−1.Asimilartrendwasobserved the alkalinity high. As expected, an increase in the OLR led to for the soluble organic matter (CODS) which increased from 6 anincreaseinthebiogasproduction(Figure1B).Increasingthe to 10g O2 L−1. This accumulation of both OM, in the form of OLRfrom0.5to1.0gSpirulinaL−1 day−1,however,eventually CODTandCODS,leadtotheinhibitionofbiogasproductiondue hadanegativeeffectonthebiogasproduction.Afteraninitialrise tosubstrateoverload(Figure3). inbiogasproductionto60mlperdayagradualdecreaseto30ml In contrast to what was observed in Alk-HRT, in Alk-OLR per day was observed (Figure1B). Two strategies for removal free NH3 and VFAs did not reach levels as high as in the Alk- ofinhibitorysubstancesandrecoveryofbiogasproductionwere HRT reactor. The NH3 concentration in Alk-OLR reached its appliedbutwereunsuccessfultorecoverthebiogasproduction maximum, 0.73 g L−1, in P-III when 1.0g Spirulina L−1 day−1 (datanotshown).Atthispointthereactorwasstopped. wasfedassubstratewhiletheconcentrationsofVFAsremained From the three different OLR, setting the OLR to 0.25 g low throughout the experiment with a slight increase in P-III Spirulina L−1 day−1resulted in the highest Specific Biogas when1.0gSpirulinaL−1day−1wasfed. Production (SBP), 26ml biogas g VS−1, as well as the highest When the reactor was operated under optimal conditions, Spirulinaconversiontomethane7%(Table3). Alk-Opt,noaccumulationofNH3,VFAs,orOMwasobserved duringthe67daysofoperation.Thethreeparametersremained BiogasProductionatOptimalOperational under controlled levels throughout the experiment and did not Parameters affectthebiogasproduction(Figure4). Alk-Opt was operated with the optimal HRT, 15 days and the optimalOLR,0.25gSpirulinaL−1day−1identifiedwithreactors Binningand16srRNATaxonomyAnalysisof Alk-HRT and Alk-OLR. As can be seen in Figure1C, constant AssembledContigs biogas production was obtained during the 67 days that the DNA was extracted from a running alkaline reactor (Alk- reactorwasoperativeandthemethanecontentintheheadspace Sed-2) on day 111 of operation (70mL biogas day−1; 92% was extremely high. Ammonia (NH ), total and soluble OM 3 (measured as COD and COD ) and acetic and propionic T S acid remained under controlled levels and did not accumulate throughouttheexperiment. ParametersAffectingtheBiogasProduction SeveralparameterssuchasfreeNH ,VFAs,andOMaffectedthe 3 biogasproductioninreactorsAlk-HRTandAlk-OLR. Changes in the HRT, and therefore in the amount of sludge exchanged daily, had a clear effect on the levels of free NH , 3 andVFAspresentintheAlk-HRTmedium(Figure2).Agradual accumulation of these compounds occurred, especially in P-IV (30 days HRT). At the end of this period, the NH reached 3 1200mg L−1 (Figure2A), a concentration much higher than the previously reported inhibitory thresholds, between 150 and 900mg L−1 (Angelidaki and Ahring, 1993; Calli et al., 2005). At the same time, the acetic acid concentration reached its maximum, over 4.0 g L−1 (Figure2B). This accumulation of VFA,butespeciallyofNH3,resultedinasharpdropofthedaily FIGURE3|ParametersaffectingtheanaerobicdigestionofSpirulina biogasproductioninAlk-HRTduetoinhibitionoftheanaerobic atalkalineconditionsintheAlk-OLRreactor.Organicmatterprofile(right microbial community. To recover the biogas production it was axis):Total(•)andSoluble((cid:4))Chemicaloxygendemand.Dashedverticallines indicateachangeintheorganicloadingrate:0.25,0.5,and1.0gSpirulina necessary to reduce the levels of inhibitory substances present L−1day−1.Dailybiogasproduction(grayline—leftaxis). in the reactor’s sludge by stopping the feeding and gradually FrontiersinMicrobiology|www.frontiersin.org 7 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina methane).Qualitytrimmedreadswereassembledintwodifferent phylogeneticprofileofthebinswiththephylogeneticaffiliation assemblies, A and B, which were used for the detection of of the identified 16S sequences (Table4). The nine identified ribosomal16Sgenestotaxonomicallycharacterizethemicrobial bins recruited 60% of the assembled contigs, indicating that community (see Materials and Methods for details). Assembly together these populations accounted for 60% of the microbial Aproducedlongerandfewercontigsduetothemorestringent communitypresentinthealkalinereactoronday111.Bacteria settings of assembly B (Supplementary Table 1). The same clearlydominatedwitheightoftheninebinsrepresentingover 16S rRNA gene sequences were all assembled in each of the 95% of the total binned populations, while only one of the two assemblies. Assembly A yielded a higher number of 16S binned populations belonged to Archaea. Among the Bacteria, sequenceslongerthan1,000bp.However,assemblyBproduced Firmicutes and Bacteroidetes were dominant, representing 28 the longest 16S sequences assigned to Bacteroidetes. The 16S and 27% of the total microbial community respectively, while sequences assigned to Methanomicrobiales where identical in methanogenic Archaea represented 4.5% of the total microbial lengthinbothassemblies.AssemblyAwasselectedforbinning community. usingtheMetawattv1.7pipelinetoinvestigatethemostabundant Members of the Bacteroidetes phylum were the most populationsofthemicrobialconsortiuminmoredetail. abundantpopulationsaccountingfor27%ofthetotalabundance Automatic binning yielded nine good bins that contained (Table4). Bin A (21% abundance) contained three contigs provisional genomes of abundant populations, based on encoding 16S rRNA sequences, which were all assigned to consistent phylogenetic profiles, presence of a complete set of “ML635J-40 aquatic group” by the SILVA classifier and to encodedtRNAmoleculesandpresenceofanearcompletesetof Bacteroidetes Incertae Sedis, Flavobacteria and Bacteroidia conservedsinglecopygenes.Fragmentsof16SrRNAsequences by the RDP classifier, all members of the Cytophaga- were assigned to each of the bins based on correlation of the Flavobacterium-Bacteroidetes group (CFB) (Supplementary TABLE3|BiogasproductionandbiodegradabilityofSpirulina. Reactor Period HRT(days) OLR(gL−1day−1) Biogas(mlbiogasday−1) SBP*mlbiogas(daygVS)−1 CH4(%) CO2(%) BDCH4(%)** Alk-HRT I 20 1.0 35±9 26±7 79±6 19±5 3 II 5 1.0 21±5 15±4 89±3 10±2 2 III 10 1.0 18±6 14±4 81±7 12±7 2 IV 30 1.0 17±10 13±8 86±13 9±8 2 V 15 1.0 50±8 37±6 83±9 14±6 5 Alk-OLR I 15 0.25 18±5 56±15 77±4 5±6 7 II 15 0.50 32±5 48±7 80±4 9±4 6 III 15 1.0 40±9 31±7 88±3 3±3 4 Alk-Opt – 15 0.25 27±4 84±14 86±5 4±3 11 Dailybiogasproduction,SpecificBiogasProductionandbiodegradabilityofSpirulinaobtainedineachperiodofthedifferentalkalineanaerobicreactors. *SBP,SpecificbiogasproductionperVSadded. **PercentageofbiodegradabilitycalculatedasinRaposoetal.(2011)andbasedonthetheoreticalmethanecontentofSpirulina:627mlCH4gVS−1. FIGURE2|Parameters affecting the anaerobic digestion of Ammonia Nitrogen (NH3) (N). (B) Volatile fatty acids profile (right axis): Spirulina at alkaline conditions in the Alk-HRT reactor. Daily Acetic (•) and propionic ((cid:4)) acid. Dashed vertical lines indicate a biogas production (gray line—left axis). (A) Nitrogen profile (right axis): change in the hydraulic retention time: 20, 5, 10, 30, and 15 days. Total Nitrogen (•), Total Ammonium Nitrogen (TAN) ((cid:4)), and Free Gray area corresponds to the 5 day non-feeding period. FrontiersinMicrobiology|www.frontiersin.org 8 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina TABLE4|Selectedmicrobialbins. Bincharacteristics Bin Contigs(#) Size(Mb) N50contiglength(kb) GC(%) Cov(X) tRNA(#) ConservedGenes*(#) Abun(%) 16SrRNAtaxonomic classification** A 703 2.6 7.3 49.6 21.2 32 128/139 21.2 Bacteroidetes B 334 1.9 23.1 42.4 9.0 11 103/139 11.1 Clostridiales C 1900 2.2 1.8 36.9 5.0 24 164/139 7.4 Halobacteroidaceae D 2851 1.6 0.6 35.2 2.2 4 38/139 2.3 Halanaerobiaceae E 2693 2.9 1.6 51.2 3.2 9 111/139 6.0 Bacteroidetes F 2217 2.4 1.9 51.0 2.8 30 97/139 4.5 Methanocalculus G 6796 3.7 0.6 38.6 2.1 43 232/139 5.1 Haloanaerobiales H 1750 1.2 0.7 46.5 2.9 7 20/139 2.2 Clostridiales I 1671 0.8 0.5 61.8 2.3 3 55/139 1.3 Rhodobacteraceae Characteristicsand16SrRNAtaxonomicalclassificationofthenineselectedbinsobtainedfromthealkalinemetagenome. Cov,Coverage. Abun,Abundance. *NumberofConservedSingleCopyGenesdetected(outofasetof139).Numbershigherthan139indicatethepresenceofDNAoriginatingfrommorethanasinglepopulationinthe bin.Numberslowerthan139indicatetheprovisionalgenomesequenceassociatedwiththebinmaybeincomplete. **TaxonomicalassignmentbasedontheSILVAandRDPmaximumcoincidencelevel.SeeSupplementaryTable2forassignmentdetails. Table 2). Phylogenetically, the three 16S sequences were bin D contig03844) were closely related to other uncultured closely related to several uncultured Bacteroidetes identified Firmicutes and Halanaerobiales identified in hypersaline or in soda lakes (Figure5). A similar result was obtained in bin alkaline environments (Figure6). Clostridiales (bin B and bin E (6% abundance) which was also classified as “ML635J-40 H) accounted for 13% of the binned community (Table4). 16S aquatic group” by the SILVA and to Flavobacteria by RDP. rRNAsequencespresentinthesetwobinswereassignedtothe Phylogenetically, the 16S sequences were also closely related to Clostridiales order by both classifiers (Supplementary Table 2). unculturedhaloalkalineBacteroidetes. Phylogenetically,thedetected16Ssequenceswerecloselyrelated The second most abundant group of bacteria were the to other Clostridiales isolated from several soda lakes and algal Halanaerobiales (bins, C, D and G), which represented 15% blooms(Figure6).Alphaproteobacteriawerealsodetectedinthe of the binned microbial community (Table4). The 16S rRNA alkaline anaerobic reactor but their abundance was low, 1.3% sequences detected in the three bins were classified mainly (Table4). Bin I was assigned by both classifiers to the purple as Halanaerobiales by both classifiers (Supplementary Table non-sulfur bacteria Rhodobaca of the family Rhodobacteraceae 2). The two 16S sequences long enough (>1,000 bp) to be (SupplementaryTable2).Phylogenetically,the16Ssequencewas included in the phylogenetic tree (bin C contig01919 and closely related to Roseinatronobacter sp. MOL1.10 identified in Mono lake and an uncultured bacterium, clone TX4CB_152, identifiedinahighlyalkalineandsalinesoil(Valenzuela-Encinas etal.,2009)(SupplementaryFigure2). In the alkaline anaerobic reactor, a single population of methanogens, Methanocalculus, a Methanomicrobiales, dominated among the archaeal community (Table4 and Figure7). Bin F contained one 16S rRNA sequence which was classifiedbybothclassifiersasMethanocalculus(Supplementary Table 2). Phylogenetically, this sequence was closely related to Methanocalculus sp. AMF-Bu2, identified in sediments from soda lakes of the Kulunda Steppe (Altai, Russia), the same lake system from which the inoculum for the alkaline reactor was obtained, and to Methanocalculus natronophilus, isolated from sediments of soda lakes of the Tanatar II system, also in the Kulundaregion(Zhilinaetal.,2013)(Figure7). FunctionalAnalysisoftheSelectedBins FIGURE4|Mainsludgecomponentsfromtheanaerobicdigestionof RNA was extracted from the alkaline reactor Alk-Sed-2 on SpirulinaatalkalineconditionsintheAlk-Optreactor.Dailybiogas day 113. Metatranscriptome sequencing statistics are presented production(grayline—leftaxis).FreeAmmonia(NH3)((cid:3));Total(•)andSoluble in Supplementary Table 3. mRNA transcripts were mapped to ((cid:4))ChemicalOxygenDemand,andaceticacid(N)profiles(rightaxis). all nine bins. From these, bins A, B, E, H, and I contained FrontiersinMicrobiology|www.frontiersin.org 9 June2015|Volume6|Article597 Nolla-Ardèvoletal. AlkalineanaerobicdigestionofSpirulina FIGURE5|16SrRNACytophaga-Flavobacterium-Bacteroides NCBIreferenceRNAsequencesdatabase;bold+underlined:tophitsin phylogenetictree.16SrRNAphylogenetictreeofthecontigsassignedto blastsearchagainstNCBInon-redundantnucleotidecollection.Additional membersoftheCytophaga-Flavobacteria-Bacteroidesgroup(CFB)bythe referencesequencestreerepresentgeneradetectedinotheralkaline RDPandSILVAclassifiers.Although,thebinningwasperformedwithcontigs environmentsoranaerobicdigesters.16SrRNAsequenceofE.coliRREC_I ofassemblyA,thetreealsoincludesthosecontigsthatwereobtainedfrom waschosenasoutgroup.Bootstrapvaluesatnodesareobtainedfrom500 assemblyBandwerenotassembledinassemblyA.Minimumcontiglength replicatesandareonlyshownforbrancheswithatleast50%support(values of500bp.Colored:sequencesobtainedfrommetagenomicreads. >49.9).Thescalebarrepresents0.01nucleotidesubstitutionspersite. AssignmenttoMetawattbinsandpercentageofbinabundanceisindicated AccessionnumbersofreferencesequencesareavailableinSupplementary ifapplicable.Referencesequencesinbold:tophitsinblastsearchagainst Table4. active coding DNA sequences (CDS) which were automatically enzymes related to general metabolic functions such as glucose annotated by GenDB and assigned to different functions. The metabolism, pyruvate related enzymes and ATPase, synthases remaining bins, C, D, F, and G, also contained active CDS and similar, were also detected among the four bins (Table5). however,theautomaticannotationbyGenDBfailedtoassigna Among the active CDS of bins A, B, and E multiple enzymes specificfunctiontotheidentifiedCDS(SupplementaryTable3). related to the DNA/RNA metabolism such as DNA and RNA Table5 contains a selection of the most relevant proteins polymerasesweredetected(Table5). detected in bins A (Bacteroidetes), B (Clostridiales), E Using GenDB, it was not possible to automatically assign a (Bacteroidetes), and H (Clostridiales) clustered into three specificfunctiontotheCDSdetectedinbinF,Methanocalculus. maingroups,CDSrelatedtotransportfunctions,CDSinvolved However, when the identified CDS were blasted against a ingeneralmetabolismfunctionsandCDSassignedtofunctions database containing the enzymes from the three different related to DNA and RNA metabolism. All four bins contained methanogenesis pathways, key enzymes of these pathways multiple transport enzymes such as ABC transporters, amino were detected and their activity could be assessed using the acidtransportersandTonB-systemtransporters,allinvolvedin RPKM value calculated with ReadXplorer (Figure8). Coding the uptake of substrates, solutes and other metabolites. Several sequencesfromenzymesfromallthreepathwaysweredetected enzymes responsible for the uptake of betaine and choline, in bin F. However, only a few enzymes appeared to be active. both osmoprotectant molecules were also identified among None of the specific enzymes of the methylotrophic and the bins A and E (Table5). It is also worth noting that these same acetoclastic pathways recruited mRNA transcripts, whereas the + + + + bins also contain multiple Na , Ca , K , and H cations enzyme formylmethanofuran dehydrogenase (fwd) specific of importers. Among the detected active CDS assigned to general thehydrogenotrophicpathway,recruited168mRNAtranscripts metabolic functions, multiple peptidases and oligopeptidases withanRPKMvalueof4,634(Figure8).Thecommonenzymes were identified in bins A, E, and H. Multiple NAD/NADH of the three pathways were all actively transcribed. Among related proteins were also active among bins A and E. Other these,themostactiveenzymewasmethyl-coenzymeMreductase FrontiersinMicrobiology|www.frontiersin.org 10 June2015|Volume6|Article597

See more

The list of books you might like