loading

Logout succeed

Logout succeed. See you again!

ebook img

Apollo 11 Flight Plan April 15 1969 PDF

pages99 Pages
release year2000
file size1.71 MB
languageEnglish

Preview Apollo 11 Flight Plan April 15 1969

APOLL1O1 FLIGHPTL AN -506/CS/ML-M1-057 ; "''.\ �·�� ' ·. 'V (.� <. APRi1l5 1,9 69 \ ) '<D4 PREPARBEYD FLIGPHLTA NNINBGR ANCH FLIGCHRTE WS UPPORDTI VISION MANNED SPACECRAFCTE NTER HOUSTON,TEXAS ) - - ./ APOLLOl l APOLLAOS -506/CSM-107/LM-5 PRELIMINAFRLYI GHTP LAN APRIL1 5,1 969 -/ f)/ .; I (-<"" Submittebdy :j - ,j" A-c. . J./fHche L. FlightP lanninBgr anch G. M. Colton FlightP lanninBgr anch T. A. Guillory '1 FlightP lanninBgr anch ::-v--:>-�d"l??}? I Approvebdy : :h W.J . Nor n Chief, t CrewS upporDti vision Anyc ommentosr questionosn thisd ocumensth ouldb e forwardteodT . A. GuilloryF,l ightP lanninBgr anch, mailc odeC F34,e xtensio4n2 71. TABLE COOFN TENTS Abbreviations Introduction i i SECTIOIN -GENERAL MissioDne scription 1. 1-1 SummaryF lighPtl an( TLC-TEC) 2. 1-5 ( ) SummaryF lighPtl an LunarO rbit 3. 1-6 RendezvoPurso file 4. 1-7 CSMB urnS chedule 5. 1-8 LMB urnS chedule 6. 1-9 7. LunarL andinSgi teD ata 1-10 CSMF lighPtl anN otes 8. 1-11 LM FlighPtl anN otes 9. 1-20 CommunicatioPnlsa n 10. 1-29 SECITON II- UPDATEF ORMS ManeuveUrp datFeo rms 1. 2-1 CSMM aneuveUrp date Pads 2. 2-2 LMM aneuveUrp datPea ds 3. 2-22 SECTIONI II- DETAILTEIDEM LINE LauncPhh ase 1. 3-i TLIT-&D 2. 3-3 TranslunCaora stA ctivities 3. 3-5 a. CislunaNra vigation 3-7'3 -19 b. LM Familiarization 3-37 c. LunarO rbitI nsertion 3-48 LunarO rbitA ctivities 4. 3-48 a. SeconLdM Ingress 3-53 b. LM Activatiaonnd C /0 3-62 i - -�-�--- SECTION III CONT'D c. Undocking 3-66 d. Touchdown 3-68 e. EVA 3-78 f. LM Liftoff 3-88 g. LM ActivDeo cking 3-92 5. TEl-TEC 3-97 6. Entry 3-134 SECTIOINV DETAILETDE STO BJECTIVES l. DetaileTde stO bjectives 4-l 2. TestO bjective/MisAscitoinv itCyr ossR eference4 -3 3. TestO bjectives 4-6 SECTIOVN -CONSUMABLES RCSP ropellaUnsta ge 2-l l. 2. SM RCSB udget 5-4 3. SPSB udget 5-24 4. LM RCSB udget 5-26 5. DPSB udget 5-30 6. APSB udget 5-31 7. CSME PSB udget 5-33 8. LM EPSB udget 5-38 9. LM ECSB udget 5-42 l PLSSB udget 5-47 0. SECTIOVNI - SUMMARFYL IGHPTL AN SummarFyl ighPtl an 6-l i i INTRDOUCTION ThisF lighPtl anh asb een prepabrye tdh eF lighPtl anninBgr anchF,l ight CrewS upporDti visiowni,t ht echnicsaulp porbty TRWS ystems. Thisd ocumenstc hedultehse A S-506/CMS-107/LM-o5p eratioannsd c rewa ctivities to fulfillw,h enp ossiblteh,e t esto bjectives deifni tnheedM issioRne ­ quirementGs T,y peM issioLnu narL andingt o be published. Thet rajectoprayr ameteursse di n thisF lighPtl ana ref orJ uly1 6,1 969 launchw,i tha launch azimauntdwh e res uppliebdy MissioPnl anninagn d 72° AnalysiDsi visioans definebdy theA pollo MisGs iSopna cecraOfpte rational Trajectotroy b e published, TheA poll1o1 FlighPtl ani s undert hec onfiguration coofn tthreoC lr ew ProcedurCeosn troBlo ard( CPCB).A ll proposed cthoa tnhgiessd ocument thatf alli n thef ollowicnagt egorisehso ulbde submitttedo theC PCBv ia a CrewP rocerdeusC hangRee quest: l. Itemst hati mposaed ditioncarle wt raininogr impacctr ewp rocedures. Itemst hati mpactth ea ccomplishmoefn dte tailetde sto bjectives. 2. 3. Itemsth atr esulitn a significant orR ECPSS b udgecth ange. 4. Itemst hatr esulitn movinmga jora ctivititeos a differeanctt ivity dayi n theF lighPtl an. 5. Itetmhsa tr equirae c hangteo thef lighdta taf ile, TheC hief,F lighPtl anninBgr anch( FCS)D willd etermiwnhea tp roposecdh anges falli n thea bovec ategories, Mr.T . A. Guillorwyi lla cta s co-ordinaftoorra llp roposecdh angetso theA poll1o1 FlighPtl an. Anyr equestfso ra dditioncaolp ieosr changetso thed istributiloins tso f thisd ocument mbues mta dei n writintgo Mr.W . J. NorthC,h iefF,l ight Crew SupporDti visioMnS,C ,H oustonT,e xas. iii --- ---- ABBREVIATIONS ACCEL Acclee ro"·eter EQUIP Equipment L/V Local Vertical '" F!O!!tine AAACCCHTQ AAAcstQuctiseilin�t�i.s�onn t ion EEEVVSATA P EE[xvata'>trp aeoe�rnhrSi acttu�loanrrd AacrTtdiiv meit y 'L �PD LMaanudnatcoVrhey h iclPer eo;surOeis phy S5/AC SSphaacfOAnt'Xgc lXre d ft AEA AbortEl ectrnoics Assembly EVT E�travehicuTlraarn sfer MAO Madrid• Spain SigMlC onditioningf qui�·ment AbortG uid�ncSeu bsystem EXT EKtemal "" Manual "' Stabilization ControSly sten' AGS AmpereH ours Ha�imum m>C T ScanninTge lescope AH Altitude f Stop "'MAX' Q Jll.uill'lllll DynamiPcre ssure SEC Secondary AMAPU or amp Ampere FC FFu elC ell MCC HidcoursCeo rreciton SECO S·IVBE nginCeu t·off AMPL A� ifier FDA! Fl1ghDti rector Attitude Indicator MCC·H MhsfonC ontroCle nte·r Huustun SEP Separate ANG Antilgua FLT Flight or MCC SEQ Sequence Ant Antenna Freq�tency Modulated MDC MainO isplay Con�ole )!VI! SaturTnV B(Thr1d S tage) AOH Apollo Operations Handbook FM Fieldo f View Measurement SLA ServicMoed uleL M Addpter AOS AcquisitioofnS igndl or Acquisitioofn S ite rfposvo r FPSF eetp er second !<MEASR USNSf'le rcury SLOS StarL ne·of·Sight AAPOST AAlsc1egnnmePtnr toO pputlisciaSTloue nlb essycsotpeem FFTT Po rf t fFueleltT hrottlPoes ition MET MMiiddslsei oEiGnm�b ealn tTAn igmlee r SSMP OT SSpeontriMc ieetM oedrul e ARS Atmosphere MGA '" ServicPer opulsiSoyns tem AAUTXT AAutKtiItHuader y Revit.!.lllation GBGIB M GGrraannddB ahBaamhIa(a sH1lS114aF Nn)d sE,a sterTne stR ange "-MHi'I! N HeM11ri\rnn\itl m Imulsmuolm a nnpd ,u Fhleo rida SSRR C SSaumnprlhReeet urnC ontainer Al Azimulh GOC GyroD isplay Coupler "'" Mlneuver SRX S�BanRde ceiveMro deN o.X GDS Goldstone, California MPS Hain PropulsiSoyns tem Sunset BBOAAT BBearnt1.1tdear y GGEETTI GGrroouunnEEddlh a ppsseedd TT iimem eo f Ignition "'M"T VC MilMnanneudaST lhp rauus FVtle icgthoNtCre o tnwtorrokl sSTsX SSo-lSara nWTdir nadCn osmtmop 1�n oendte N o.X Bio Bio·HedilDaalt ao n VoiceDo wnilnk GLY Glycol swc Switch BP Barber Pole CIIT Gree11ri11chH eanT lme H1 Nitrogen s. SeKtant BT BurnT i···e G&N Guidancaned Navigaton NAV Navigation SXT BU Backup CJfCS GuidancNea vigatiCioonnt rol System NCC CorrectiCvoem binatiMoann euver Timeo f EphemerisU pdate BBR&KWT BBrlaacckkeWht i t&e GGYWMM GGuuaamy m,a s ic o NM IIM NNomauintailc aMli les TTEA P HEM TrunnioAnn gle CAPC OM CCaaplsiublrCeaOOil tliuAonnnig claet or HHA2 HAypdorgogeeAen Het illt ude NNSXRX NNo01u11lnnX aXl S low Rate T" A(N >) TTfamnneaaB rais�eeN, o Jota.d a.gascar < CCCCACAMCBCCCCCCCCCCCCCCCCMCCMCCOKDNROO/&SPYRSOPDCDIMML OT NHOA t«JDWYIMN F DURRL N I SO S T CGT J CCCCGCCCCCCCCCCCCCCCCCCCCooooOO'm�ooroaoaooihrrooooiaiTJirunnnendnaiTJiuereynvnfl'IeiTJilrJITI4nrmtctflntttrukiinlplccoaanscewMiianronOog nnd�luulkgnlndtur onCluirodupncree enih eid d .siaaud vt.JPataBSMM rdnr np nt Otn on,tDoi reooi ig iitt aai denP'ocenSdrodlo zci rWtnt nudaaeu�tuAasaA caIy .,sluklqUlstrl tl nn PlCA leeurceiialMifiorea eennt1 lgoot mp n digonn1d� uctt t SmI u ydeu eenlse Snrie titt meg i hatt iMoann euver HJHIHHHHHHIkIIHIIIIIIBESITTAwpMDNVNGPUVCOGNRT KhRYW UITTA CO T T U IHHJHUIHHHHlKPIIIIIlliieSoaineiinnnnengnndegltNnwgatggiehirthsrnteottlitSeathhter tirteiwnllsBGaHiyl yl ei rtoragehrt tlliuaa Dnetos1arivvelvitnPtAezInl n nlu aee iaMeRfasCHl to t Acilvhh laaitootsirakn iioostciaiuuH1 n(tbnltccmuearpu tC1llle(i eeuetre tCeelT al To nUltm.i riornaLnnnaeeilorrnnbDnM afrrnausngae)f t trn trUe riarnUA � ainua,tist tti roanlsi a) PPPPPPPPPPPMPP0oe0"DpPOOOOORIRRROCRCMGGL'"VARPRRGA 2s/ EPEEEL I ASNCAB'HOSID FSS PFM S D EE S NA TL PPPPPPPPPPPPPDVOOO0ClOOPoOrorrrxurhruerrio�rblruKo�meilsieymleaelrsitieyeebtbireipaeqntrstfssscimcsgediitrdrraivn,atyeeeoueecharsetfo\orlaCth RaUaIGir yenlt tr trP yrn� dzeba oplraitGi reiuiyn ruaeltdduGamoelootoengSdrn.,i tnedreelaenbrcioofoloDr g d,h t a n� tutfPa aFdioett eAfnueSelieuschdiSle noy n o naellp uggnAsrAtn alAfNpniRl t aPrzstatapaeeislEeeiylvceotn m aman onirrt1 rS1 gnagtobltyu y H has1 i tnooeuACdnoLmsc nus ctrn eoallre S reocmteitoenr UUuTTTTITTIITTTGTITTTTTTTNMV/RPMVPWLLPIEsEELEEDCD CBAR IKRlMFRGMXCCl&A N M P E S UUUTTTTTTTTTTTTTTTCTTTTomnnrrherieerreeraemeoirwlrabidrannamnnaleennaapnnmargnritoun1ne5ienivnnefenpeioto lecsnss mnsnssrns sulEf fSidVktamleCaalipaa eusa orhI tCc e liatlluttoaPnPP tnr�glca ttr hniuesrhahh tnsotIlItiy ar itaraaCnCeiosnt eo erthsio sssoPsCrtseaOeo,rn ieeeoIaMrnrs a ieso / no A niis tstrtcuRitnpindtTsot ler npatat ildsco riloo n eo&a ungia tr L vcisMeloe Erln j e ction 0OOODDDDODODfElKU/CEP!APTF JBAG�L f fA S ' DDDDDDD[DDDeeii�\cieoegpacgtkttfsgdiilbttr'la ·efcr��aEtoal' �eeelnrii!ndtocrne nO ADrCP ncetsOaoyurr ctnn ITJilt baokolcie1npa Pn edotodliI d nDl rl no A i hs[1ts�sii eeSgpomirllbtntilaa iyA11yo s J En��� 11eyc1srbt1Tlrtiyl ml1e r lLLlLLLlLLLLHA/BBEAC[)FOGGT HRGBSHI C o K r lbslPLLLLlLlLLL ouaaeoowaaoMinuftnuewnc aGqnditBtdru-nrdm� iunhisui c alEdHdiaFg tnqeACahr oad Rud zno krr ia icoep Hi tmm lozeCeuer(ono tGtdiTn �mh wlBtn np.aan Mylue) tn te r QR'PPPP'PPt "WUTRU"IRy OG C PS RQRPPPPPPPorruowrroralor�loeopois/alnprgpneRils to rtBdetl na irally gXTontmul c�tXnhfa ea e UU1e nt t tni1 iM C lloiin tzzroaaltat niidooG nan g inSgy steT': WWWVVVvvVvRT/LIHAo TN0V Nf.x . UWWVIUV'I';'VeiSSeeanoitrl1NNro b�ceitho cSSy eer \.lRuH'hui ttK taeile y itsyag VieapnhFne,elg rgl·ec ut otqt�ocou r ile·t<ndync y DataS torage [f]uipo,pnt LHUJ left-haEnqdui pment RA lldd&ait or XFER Tranfser O(IDllS$Tf!lJ!1 , ''Y O[Di1igdsitapaillla UacyTpnrd ld� K trO yAl!l �>o�jdr.r,,d.c ,thnlcy LliHt0Sl1Sf1C( l\ LLli eet ffhttiHUi -" � hnHalySFnldiod od1 'P0SQ 1fXa(llrlq l\dru aa1ly�rnrm n pll\n�atiy n Pr RRCCSDD R RRReeea1cc:ootrCoidotoeCf�nro! nttrrlo·J1�on yli� te1·, XXMPIOTr-l,D fR lTrr��nn�spminotnr d T.r,arn �r·ittrr Dnwn ;11� lLl �\ LnarL andinMgde1 S•5 lon 'R"C U Rr{irv cr 1 ,,. r. ll{IS lu�nd.,,l,i r,1r�ekf Si�!.! l!StR1e5d tso ne lrE[E�,�or rnr·otl·ovr·tf;(.•i,h.-,a ,,,lrtlL,n·•--lJl ••uoSllolzrbrc {�o"iil pnP Phrr InoP I ItlrnIiSet: trf y):rfis tfJ,r Pl .uI cit·p'n r •� d.Mlf' lllLL� MOON: I�I IIrG Lllllo1uuun"nnng"�a�Oi1rrrMNMrtr ocobu raridlrllteu·ull r1 lliror l": oi•"t' "\r ft •(,, F"�RRRfEfl"lQrG lOS :lT 'Ii\Rl�RT• r<·lig�·u•lufrar,c rtoh rfdmrt LSn -t.ch�>Pban l nP'r �l" "'M.Jtt•rrlr� """ c VVPtE>o�lsloi!octtciylo(CC tnhhhy JaJ nnfl.��'((OD1PrJI'foit ' nff �ffitln··Cr•.o t-1·rtn·ntnfl�f,1 �.l1)1 ) ll(�lanrcrttvtrh,hy·l1 oJ ·:..rtlu.-.t nIn odIr•1" S I yJ�dter •1 LLLPOROS LllLoiuasqnnshado trif rn �Ragiadr t�akrni anOlg lO'rb 'Lt uSo;1st r r>f �"'"'5 1c, 1: 1./ RRfk��col��l,l· Id·Jlh �1i , Jll u·e1d..:l\'bvY1 iIoOcl:uU'1��" t] ,.,,\J, 1",. ',t t,'•," CS�l1C A li�l >•liOtl l IT li9ht1ng l-T ·i r,,; ..r ,,, , · I,., ll .H ,1unrVle1i nl f' OJ( o,. C( lite\ ,,,.,. \ul.•,, V I t SECTIONI -GENRAEL MSISIODNES CRTIINPO l.L anucha ndE .P.(OD.au troin2 4:4)T -2:4G4E T 0 (a) Nomniall uancthmi ei s8 :3E2TS ,J ul1y6, 1 699,w itha luanch windodwu rioanto f4 hsr.2 4m in. (b) Eatrho brit isnetrino itnoa 10n0m c irculoarrbt iatl lm in. 24s eca.ft elri fto-ff (c)C SMs ytsemCs/ 0i ne arh tobrit (d)O potniaIlUM reainlg (5P2t)o t hep adR ESFMMAdTui rntgh fei rst nighpte riod (e) TLoI ccusr at2 4:4:1G8E To vret hPea fciic Ocaend uinrgt he seocndr eovlutoin. (eSeT bal1el- for bunr dat)a. 2.T rnasulnaCro at s(uDraiotn7 3:112)4: 4-75:G5E5T AfteTr L,Iw hihc placetsh es pcaecrafti na frelenu arre tunr trajetco­ ry, thfeo llwoingm ajro evenotcsc purroi rt oL OI: (a) Trnasposiinot,d ociknagn dL Me ejctoin,i cnludnigS IBV photo- graphy ()b Sepraaitno froSmI BV anda CSMe vaisev manuever (c)S IBV prouplsei vvetninogfp orepllan(tsislgn sh)o t ()d Twos eierso fP 23c silunarn avgiaotnis gihtnig,ss t/aerrathh or­i zo,n conistsign offie v setast 0 6:0G0E Ta ndf iev setast2 4:00 GET (e) Foumrid ocurscoere rtcoinswh icht akpel ea actT LI + 9,T LI+ 24, LOI 2-2a ndL OI- 5h osu writh�Vno mniallyz ero (SeTeab l1el- ). (f)P assei tvhermaclo ntlr (oTPC)w illb ec onudcetdd urianllg p eriosd wheont hre acvtiitiedson otr eqiuer differeantttt iueds. ()g LMi snepctoina ndh uoseeeknpig (h)L OI,p erformde at7 5:5:530 GE,Te ndtsh eT LCp hsae. 1 1l- 3.L nuarO rbit (Duiroan5t 5:8 3)7 5:55 1-13:33 GET LOI Day ()a LOI 1 (b)P hotoosf t argeotfos p ptourntyi (c)L OI 2 (d)P ots LOILMe nrty ainsndep citno.T enm inuteosfV HF-BL BR 2 datwail lb et ramnitsetdt oC S/MDSEf or playbatcokM SF.N (e)P osLtO IPseou ldnadmrakt raicnk(gno es eotf s gihtgisn) 2 (eSeT bal1e3 -) (f)R ets peiordo f8 hosu r 4.D esceanntdL nadnigD ay( uDraiton2 3:489)4: 23 1-1:82G0E T (a)D okceLd Ma cvtiatonia ndc hekcout (b)D okcedln adnigs iet lnadmasrikg ihgnt (noes eot fs gihtgis)n (eSeT abl1e3- ) (c)U ndcokniga nds pearaotn( ieSeF giuer 13- RendveozuPsr iofle) (d)D OI thrul nadnig (e)L Mp ostt oudcohwann ds miualteldfi toff ()f Restp eiord( LMo)f 4 hosu r (g)C SMp lanec hange (h)R estp eriod( SCM)o f4 hosu r 5. LUNAERX PORLAITNO D/IY( uDrtaino 10:301)90 3:0-12:0G0E T (a)E AV prep (b)E AV for h2ou rs4 0m inutes (c) Pots EAV (d)R estp eroid( ML)4 hosu r 4m0in utes (e)R est'J eriod( CS4M h)o su r . 6.L itf-Of,f Renzdveuos& TEI Day( uDrtaion1 :700)1 2:282 -1932:8G ET (a)L ML fitO-ff andI nrsteoin 12-

See more

The list of books you might like