Logout succeed
Logout succeed. See you again!

Apollo 11 Flight Plan April 15 1969 PDF
Preview Apollo 11 Flight Plan April 15 1969
APOLL1O1 FLIGHPTL AN -506/CS/ML-M1-057 ; "''.\ �·�� ' ·. 'V (.� <. APRi1l5 1,9 69 \ ) '<D4 PREPARBEYD FLIGPHLTA NNINBGR ANCH FLIGCHRTE WS UPPORDTI VISION MANNED SPACECRAFCTE NTER HOUSTON,TEXAS ) - - ./ APOLLOl l APOLLAOS -506/CSM-107/LM-5 PRELIMINAFRLYI GHTP LAN APRIL1 5,1 969 -/ f)/ .; I (-<"" Submittebdy :j - ,j" A-c. . J./fHche L. FlightP lanninBgr anch G. M. Colton FlightP lanninBgr anch T. A. Guillory '1 FlightP lanninBgr anch ::-v--:>-�d"l??}? I Approvebdy : :h W.J . Nor n Chief, t CrewS upporDti vision Anyc ommentosr questionosn thisd ocumensth ouldb e forwardteodT . A. GuilloryF,l ightP lanninBgr anch, mailc odeC F34,e xtensio4n2 71. TABLE COOFN TENTS Abbreviations Introduction i i SECTIOIN -GENERAL MissioDne scription 1. 1-1 SummaryF lighPtl an( TLC-TEC) 2. 1-5 ( ) SummaryF lighPtl an LunarO rbit 3. 1-6 RendezvoPurso file 4. 1-7 CSMB urnS chedule 5. 1-8 LMB urnS chedule 6. 1-9 7. LunarL andinSgi teD ata 1-10 CSMF lighPtl anN otes 8. 1-11 LM FlighPtl anN otes 9. 1-20 CommunicatioPnlsa n 10. 1-29 SECITON II- UPDATEF ORMS ManeuveUrp datFeo rms 1. 2-1 CSMM aneuveUrp date Pads 2. 2-2 LMM aneuveUrp datPea ds 3. 2-22 SECTIONI II- DETAILTEIDEM LINE LauncPhh ase 1. 3-i TLIT-&D 2. 3-3 TranslunCaora stA ctivities 3. 3-5 a. CislunaNra vigation 3-7'3 -19 b. LM Familiarization 3-37 c. LunarO rbitI nsertion 3-48 LunarO rbitA ctivities 4. 3-48 a. SeconLdM Ingress 3-53 b. LM Activatiaonnd C /0 3-62 i - -�-�--- SECTION III CONT'D c. Undocking 3-66 d. Touchdown 3-68 e. EVA 3-78 f. LM Liftoff 3-88 g. LM ActivDeo cking 3-92 5. TEl-TEC 3-97 6. Entry 3-134 SECTIOINV DETAILETDE STO BJECTIVES l. DetaileTde stO bjectives 4-l 2. TestO bjective/MisAscitoinv itCyr ossR eference4 -3 3. TestO bjectives 4-6 SECTIOVN -CONSUMABLES RCSP ropellaUnsta ge 2-l l. 2. SM RCSB udget 5-4 3. SPSB udget 5-24 4. LM RCSB udget 5-26 5. DPSB udget 5-30 6. APSB udget 5-31 7. CSME PSB udget 5-33 8. LM EPSB udget 5-38 9. LM ECSB udget 5-42 l PLSSB udget 5-47 0. SECTIOVNI - SUMMARFYL IGHPTL AN SummarFyl ighPtl an 6-l i i INTRDOUCTION ThisF lighPtl anh asb een prepabrye tdh eF lighPtl anninBgr anchF,l ight CrewS upporDti visiowni,t ht echnicsaulp porbty TRWS ystems. Thisd ocumenstc hedultehse A S-506/CMS-107/LM-o5p eratioannsd c rewa ctivities to fulfillw,h enp ossiblteh,e t esto bjectives deifni tnheedM issioRne quirementGs T,y peM issioLnu narL andingt o be published. Thet rajectoprayr ameteursse di n thisF lighPtl ana ref orJ uly1 6,1 969 launchw,i tha launch azimauntdwh e res uppliebdy MissioPnl anninagn d 72° AnalysiDsi visioans definebdy theA pollo MisGs iSopna cecraOfpte rational Trajectotroy b e published, TheA poll1o1 FlighPtl ani s undert hec onfiguration coofn tthreoC lr ew ProcedurCeosn troBlo ard( CPCB).A ll proposed cthoa tnhgiessd ocument thatf alli n thef ollowicnagt egorisehso ulbde submitttedo theC PCBv ia a CrewP rocerdeusC hangRee quest: l. Itemst hati mposaed ditioncarle wt raininogr impacctr ewp rocedures. Itemst hati mpactth ea ccomplishmoefn dte tailetde sto bjectives. 2. 3. Itemsth atr esulitn a significant orR ECPSS b udgecth ange. 4. Itemst hatr esulitn movinmga jora ctivititeos a differeanctt ivity dayi n theF lighPtl an. 5. Itetmhsa tr equirae c hangteo thef lighdta taf ile, TheC hief,F lighPtl anninBgr anch( FCS)D willd etermiwnhea tp roposecdh anges falli n thea bovec ategories, Mr.T . A. Guillorwyi lla cta s co-ordinaftoorra llp roposecdh angetso theA poll1o1 FlighPtl an. Anyr equestfso ra dditioncaolp ieosr changetso thed istributiloins tso f thisd ocument mbues mta dei n writintgo Mr.W . J. NorthC,h iefF,l ight Crew SupporDti visioMnS,C ,H oustonT,e xas. iii --- ---- ABBREVIATIONS ACCEL Acclee ro"·eter EQUIP Equipment L/V Local Vertical '" F!O!!tine AAACCCHTQ AAAcstQuctiseilin�t�i.s�onn t ion EEEVVSATA P EE[xvata'>trp aeoe�rnhrSi acttu�loanrrd AacrTtdiiv meit y 'L �PD LMaanudnatcoVrhey h iclPer eo;surOeis phy S5/AC SSphaacfOAnt'Xgc lXre d ft AEA AbortEl ectrnoics Assembly EVT E�travehicuTlraarn sfer MAO Madrid• Spain SigMlC onditioningf qui�·ment AbortG uid�ncSeu bsystem EXT EKtemal "" Manual "' Stabilization ControSly sten' AGS AmpereH ours Ha�imum m>C T ScanninTge lescope AH Altitude f Stop "'MAX' Q Jll.uill'lllll DynamiPcre ssure SEC Secondary AMAPU or amp Ampere FC FFu elC ell MCC HidcoursCeo rreciton SECO S·IVBE nginCeu t·off AMPL A� ifier FDA! Fl1ghDti rector Attitude Indicator MCC·H MhsfonC ontroCle nte·r Huustun SEP Separate ANG Antilgua FLT Flight or MCC SEQ Sequence Ant Antenna Freq�tency Modulated MDC MainO isplay Con�ole )!VI! SaturTnV B(Thr1d S tage) AOH Apollo Operations Handbook FM Fieldo f View Measurement SLA ServicMoed uleL M Addpter AOS AcquisitioofnS igndl or Acquisitioofn S ite rfposvo r FPSF eetp er second !<MEASR USNSf'le rcury SLOS StarL ne·of·Sight AAPOST AAlsc1egnnmePtnr toO pputlisciaSTloue nlb essycsotpeem FFTT Po rf t fFueleltT hrottlPoes ition MET MMiiddslsei oEiGnm�b ealn tTAn igmlee r SSMP OT SSpeontriMc ieetM oedrul e ARS Atmosphere MGA '" ServicPer opulsiSoyns tem AAUTXT AAutKtiItHuader y Revit.!.lllation GBGIB M GGrraannddB ahBaamhIa(a sH1lS114aF Nn)d sE,a sterTne stR ange "-MHi'I! N HeM11ri\rnn\itl m Imulsmuolm a nnpd ,u Fhleo rida SSRR C SSaumnprlhReeet urnC ontainer Al Azimulh GOC GyroD isplay Coupler "'" Mlneuver SRX S�BanRde ceiveMro deN o.X GDS Goldstone, California MPS Hain PropulsiSoyns tem Sunset BBOAAT BBearnt1.1tdear y GGEETTI GGrroouunnEEddlh a ppsseedd TT iimem eo f Ignition "'M"T VC MilMnanneudaST lhp rauus FVtle icgthoNtCre o tnwtorrokl sSTsX SSo-lSara nWTdir nadCn osmtmop 1�n oendte N o.X Bio Bio·HedilDaalt ao n VoiceDo wnilnk GLY Glycol swc Switch BP Barber Pole CIIT Gree11ri11chH eanT lme H1 Nitrogen s. SeKtant BT BurnT i···e G&N Guidancaned Navigaton NAV Navigation SXT BU Backup CJfCS GuidancNea vigatiCioonnt rol System NCC CorrectiCvoem binatiMoann euver Timeo f EphemerisU pdate BBR&KWT BBrlaacckkeWht i t&e GGYWMM GGuuaamy m,a s ic o NM IIM NNomauintailc aMli les TTEA P HEM TrunnioAnn gle CAPC OM CCaaplsiublrCeaOOil tliuAonnnig claet or HHA2 HAypdorgogeeAen Het illt ude NNSXRX NNo01u11lnnX aXl S low Rate T" A(N >) TTfamnneaaB rais�eeN, o Jota.d a.gascar < CCCCACAMCBCCCCCCCCCCCCCCCCMCCMCCOKDNROO/&SPYRSOPDCDIMML OT NHOA t«JDWYIMN F DURRL N I SO S T CGT J CCCCGCCCCCCCCCCCCCCCCCCCCooooOO'm�ooroaoaooihrrooooiaiTJirunnnendnaiTJiuereynvnfl'IeiTJilrJITI4nrmtctflntttrukiinlplccoaanscewMiianronOog nnd�luulkgnlndtur onCluirodupncree enih eid d .siaaud vt.JPataBSMM rdnr np nt Otn on,tDoi reooi ig iitt aai denP'ocenSdrodlo zci rWtnt nudaaeu�tuAasaA caIy .,sluklqUlstrl tl nn PlCA leeurceiialMifiorea eennt1 lgoot mp n digonn1d� uctt t SmI u ydeu eenlse Snrie titt meg i hatt iMoann euver HJHIHHHHHHIkIIHIIIIIIBESITTAwpMDNVNGPUVCOGNRT KhRYW UITTA CO T T U IHHJHUIHHHHlKPIIIIIlliieSoaineiinnnnengnndegltNnwgatggiehirthsrnteottlitSeathhter tirteiwnllsBGaHiyl yl ei rtoragehrt tlliuaa Dnetos1arivvelvitnPtAezInl n nlu aee iaMeRfasCHl to t Acilvhh laaitootsirakn iioostciaiuuH1 n(tbnltccmuearpu tC1llle(i eeuetre tCeelT al To nUltm.i riornaLnnnaeeilorrnnbDnM afrrnausngae)f t trn trUe riarnUA � ainua,tist tti roanlsi a) PPPPPPPPPPPMPP0oe0"DpPOOOOORIRRROCRCMGGL'"VARPRRGA 2s/ EPEEEL I ASNCAB'HOSID FSS PFM S D EE S NA TL PPPPPPPPPPPPPDVOOO0ClOOPoOrorrrxurhruerrio�rblruKo�meilsieymleaelrsitieyeebtbireipaeqntrstfssscimcsgediitrdrraivn,atyeeeoueecharsetfo\orlaCth RaUaIGir yenlt tr trP yrn� dzeba oplraitGi reiuiyn ruaeltdduGamoelootoengSdrn.,i tnedreelaenbrcioofoloDr g d,h t a n� tutfPa aFdioett eAfnueSelieuschdiSle noy n o naellp uggnAsrAtn alAfNpniRl t aPrzstatapaeeislEeeiylvceotn m aman onirrt1 rS1 gnagtobltyu y H has1 i tnooeuACdnoLmsc nus ctrn eoallre S reocmteitoenr UUuTTTTITTIITTTGTITTTTTTTNMV/RPMVPWLLPIEsEELEEDCD CBAR IKRlMFRGMXCCl&A N M P E S UUUTTTTTTTTTTTTTTTCTTTTomnnrrherieerreeraemeoirwlrabidrannamnnaleennaapnnmargnritoun1ne5ienivnnefenpeioto lecsnss mnsnssrns sulEf fSidVktamleCaalipaa eusa orhI tCc e liatlluttoaPnPP tnr�glca ttr hniuesrhahh tnsotIlItiy ar itaraaCnCeiosnt eo erthsio sssoPsCrtseaOeo,rn ieeeoIaMrnrs a ieso / no A niis tstrtcuRitnpindtTsot ler npatat ildsco riloo n eo&a ungia tr L vcisMeloe Erln j e ction 0OOODDDDODODfElKU/CEP!APTF JBAG�L f fA S ' DDDDDDD[DDDeeii�\cieoegpacgtkttfsgdiilbttr'la ·efcr��aEtoal' �eeelnrii!ndtocrne nO ADrCP ncetsOaoyurr ctnn ITJilt baokolcie1npa Pn edotodliI d nDl rl no A i hs[1ts�sii eeSgpomirllbtntilaa iyA11yo s J En��� 11eyc1srbt1Tlrtiyl ml1e r lLLlLLLlLLLLHA/BBEAC[)FOGGT HRGBSHI C o K r lbslPLLLLlLlLLL ouaaeoowaaoMinuftnuewnc aGqnditBtdru-nrdm� iunhisui c alEdHdiaFg tnqeACahr oad Rud zno krr ia icoep Hi tmm lozeCeuer(ono tGtdiTn �mh wlBtn np.aan Mylue) tn te r QR'PPPP'PPt "WUTRU"IRy OG C PS RQRPPPPPPPorruowrroralor�loeopois/alnprgpneRils to rtBdetl na irally gXTontmul c�tXnhfa ea e UU1e nt t tni1 iM C lloiin tzzroaaltat niidooG nan g inSgy steT': WWWVVVvvVvRT/LIHAo TN0V Nf.x . UWWVIUV'I';'VeiSSeeanoitrl1NNro b�ceitho cSSy eer \.lRuH'hui ttK taeile y itsyag VieapnhFne,elg rgl·ec ut otqt�ocou r ile·t<ndync y DataS torage [f]uipo,pnt LHUJ left-haEnqdui pment RA lldd&ait or XFER Tranfser O(IDllS$Tf!lJ!1 , ''Y O[Di1igdsitapaillla UacyTpnrd ld� K trO yAl!l �>o�jdr.r,,d.c ,thnlcy LliHt0Sl1Sf1C( l\ LLli eet ffhttiHUi -" � hnHalySFnldiod od1 'P0SQ 1fXa(llrlq l\dru aa1ly�rnrm n pll\n�atiy n Pr RRCCSDD R RRReeea1cc:ootrCoidotoeCf�nro! nttrrlo·J1�on yli� te1·, XXMPIOTr-l,D fR lTrr��nn�spminotnr d T.r,arn �r·ittrr Dnwn ;11� lLl �\ LnarL andinMgde1 S•5 lon 'R"C U Rr{irv cr 1 ,,. r. ll{IS lu�nd.,,l,i r,1r�ekf Si�!.! l!StR1e5d tso ne lrE[E�,�or rnr·otl·ovr·tf;(.•i,h.-,a ,,,lrtlL,n·•--lJl ••uoSllolzrbrc {�o"iil pnP Phrr InoP I ItlrnIiSet: trf y):rfis tfJ,r Pl .uI cit·p'n r •� d.Mlf' lllLL� MOON: I�I IIrG Lllllo1uuun"nnng"�a�Oi1rrrMNMrtr ocobu raridlrllteu·ull r1 lliror l": oi•"t' "\r ft •(,, F"�RRRfEfl"lQrG lOS :lT 'Ii\Rl�RT• r<·lig�·u•lufrar,c rtoh rfdmrt LSn -t.ch�>Pban l nP'r �l" "'M.Jtt•rrlr� """ c VVPtE>o�lsloi!octtciylo(CC tnhhhy JaJ nnfl.��'((OD1PrJI'foit ' nff �ffitln··Cr•.o t-1·rtn·ntnfl�f,1 �.l1)1 ) ll(�lanrcrttvtrh,hy·l1 oJ ·:..rtlu.-.t nIn odIr•1" S I yJ�dter •1 LLLPOROS LllLoiuasqnnshado trif rn �Ragiadr t�akrni anOlg lO'rb 'Lt uSo;1st r r>f �"'"'5 1c, 1: 1./ RRfk��col��l,l· Id·Jlh �1i , Jll u·e1d..:l\'bvY1 iIoOcl:uU'1��" t] ,.,,\J, 1",. ',t t,'•," CS�l1C A li�l >•liOtl l IT li9ht1ng l-T ·i r,,; ..r ,,, , · I,., ll .H ,1unrVle1i nl f' OJ( o,. C( lite\ ,,,.,. \ul.•,, V I t SECTIONI -GENRAEL MSISIODNES CRTIINPO l.L anucha ndE .P.(OD.au troin2 4:4)T -2:4G4E T 0 (a) Nomniall uancthmi ei s8 :3E2TS ,J ul1y6, 1 699,w itha luanch windodwu rioanto f4 hsr.2 4m in. (b) Eatrho brit isnetrino itnoa 10n0m c irculoarrbt iatl lm in. 24s eca.ft elri fto-ff (c)C SMs ytsemCs/ 0i ne arh tobrit (d)O potniaIlUM reainlg (5P2t)o t hep adR ESFMMAdTui rntgh fei rst nighpte riod (e) TLoI ccusr at2 4:4:1G8E To vret hPea fciic Ocaend uinrgt he seocndr eovlutoin. (eSeT bal1el- for bunr dat)a. 2.T rnasulnaCro at s(uDraiotn7 3:112)4: 4-75:G5E5T AfteTr L,Iw hihc placetsh es pcaecrafti na frelenu arre tunr trajetco ry, thfeo llwoingm ajro evenotcsc purroi rt oL OI: (a) Trnasposiinot,d ociknagn dL Me ejctoin,i cnludnigS IBV photo- graphy ()b Sepraaitno froSmI BV anda CSMe vaisev manuever (c)S IBV prouplsei vvetninogfp orepllan(tsislgn sh)o t ()d Twos eierso fP 23c silunarn avgiaotnis gihtnig,ss t/aerrathh ori zo,n conistsign offie v setast 0 6:0G0E Ta ndf iev setast2 4:00 GET (e) Foumrid ocurscoere rtcoinswh icht akpel ea actT LI + 9,T LI+ 24, LOI 2-2a ndL OI- 5h osu writh�Vno mniallyz ero (SeTeab l1el- ). (f)P assei tvhermaclo ntlr (oTPC)w illb ec onudcetdd urianllg p eriosd wheont hre acvtiitiedson otr eqiuer differeantttt iueds. ()g LMi snepctoina ndh uoseeeknpig (h)L OI,p erformde at7 5:5:530 GE,Te ndtsh eT LCp hsae. 1 1l- 3.L nuarO rbit (Duiroan5t 5:8 3)7 5:55 1-13:33 GET LOI Day ()a LOI 1 (b)P hotoosf t argeotfos p ptourntyi (c)L OI 2 (d)P ots LOILMe nrty ainsndep citno.T enm inuteosfV HF-BL BR 2 datwail lb et ramnitsetdt oC S/MDSEf or playbatcokM SF.N (e)P osLtO IPseou ldnadmrakt raicnk(gno es eotf s gihtgisn) 2 (eSeT bal1e3 -) (f)R ets peiordo f8 hosu r 4.D esceanntdL nadnigD ay( uDraiton2 3:489)4: 23 1-1:82G0E T (a)D okceLd Ma cvtiatonia ndc hekcout (b)D okcedln adnigs iet lnadmasrikg ihgnt (noes eot fs gihtgis)n (eSeT abl1e3- ) (c)U ndcokniga nds pearaotn( ieSeF giuer 13- RendveozuPsr iofle) (d)D OI thrul nadnig (e)L Mp ostt oudcohwann ds miualteldfi toff ()f Restp eiord( LMo)f 4 hosu r (g)C SMp lanec hange (h)R estp eriod( SCM)o f4 hosu r 5. LUNAERX PORLAITNO D/IY( uDrtaino 10:301)90 3:0-12:0G0E T (a)E AV prep (b)E AV for h2ou rs4 0m inutes (c) Pots EAV (d)R estp eroid( ML)4 hosu r 4m0in utes (e)R est'J eriod( CS4M h)o su r . 6.L itf-Of,f Renzdveuos& TEI Day( uDrtaion1 :700)1 2:282 -1932:8G ET (a)L ML fitO-ff andI nrsteoin 12-