loading

Logout succeed

Logout succeed. See you again!

ebook img

Consistency-driven Alternating Optimization for Multi-Graph Matching PDF

pages16 Pages
release year2014
file size1.84 MB
languageEnglish

Preview Consistency-driven Alternating Optimization for Multi-Graph Matching

JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 1 Consistency-driven Alternating Optimization for Multi-Graph Matching: a Unified Approach Junchi Yan, Jun Wang Member, IEEE, Hongyuan Zha, Xiaokang Yang Senior Member, IEEE and Stephen Chu Abstract—The problem of graph matching in general is NP- GRAPH matching (GM) plays a critical role in both complete and many approximate pairwise matching techniques theoryandapplicationforcomputersciencecommunity. have been proposed. For a general setting in real applications, Briefly speaking, graph matching aims to find correspondence it typically requires to find the consistent matchings across a between two feature sets, with a wide spectrum of applica- batch of graphs. Sequentially performing pairwise matching is pronetoerrorpropagationalongthepairwisematchingsequence, tions that require feature matching in image processing and and the sequences generated in different pairwise matching computer vision, as diverse as image registration [2], object orderscanleadtocontradictorysolutions.Motivatedbydevising recognition [3], shape matching [4], object tracking [5], and a robust and consistent multiple-graph matching model, we action recognition [6], among others. Different from the point propose a unified alternating optimization framework for multi- based matching methods such as RANSAC [7] and Iterative graph matching. In addition, we define and use two metrics related to graph-wise and pairwise consistencies. The former Closet Point (ICP) [8], GM methods incorporate both the is used to find an appropriate reference graph which induces unary node-to-node, as well as the second-order edge-to-edge a set of basis variables and launches the iteration procedure. similarity as structural information. As discussed in [9], by The latter defines the order in which the considered graphs encoding the additional second-order edge similarity in the in the iterations are manipulated. We show two embodiments graph representation and matching process, GM methods can under the proposed framework that can cope with the non- factorizedandfactorizedaffinitymatrix,respectively.Ourmulti- usuallyleadtobetternodecorrespondencesolutions.Although graph matching model has two major characters: i) the affinity extensive research has been done for decades [10], deriving informationacrossmultiplegraphsareexploredineachiteration optimal GM is still a challenging problem in both theory by fixing part of the matching variables via a consistency- and practice since the GM problem can be formulated as a driven mechanism; ii) the framework is flexible to incorporate quadratic assignment problem (QAP) [11], being well-known various existing pairwise graph matching solvers in an “out- of-box” fashion, and also can proceed with the output of other NP-complete [12][13]. multi-graphmatchingmethods.Theexperimentalresultsonboth Graph matching is mostly considered under the two-graph syntheticdataandrealimagesempiricallyshowthattheproposed scenario[9],[14],[15],[16],[17],[18]etc.However,inmany framework performs competitively with the state-of-the-art. realapplications,givenabatchofgraphsreferringtoidentical or related structures, it is required to find the global node mappings among all graphs, which is essentially related to I. INTRODUCTION graphclustering[19],[20],[21],[22],classification[23],[24], [25]andindexing[26].Duetotheadvanceofmodernimaging and scanning technologies, there is an increasing need for Apreliminaryversionofthepresentedpaperappearedin[1].Thecurrent multi-graph matching in various applications. In [27], objects papermakesseveralfurtherextensionsandimprovements:i)incorporatethe factorizedgraphmatchinginourformulation,andsolveitviaapath-following arescannedusinginfrared,optical,cartographicandSynthetic algorithm; ii) propose two metrics for graph-wise and pairwise consistency, Aperture Radar (SAR) that are desired to be combined to whichareusedfortheeffectivefindingofbasisvariablesandupdatingorder improve representations. In addition, 3D shape analysis often forthealternatingoptimizationprocedure.Inparticular,thepreliminarywork doesnotaddressthesetwoproblemsasonlyafewgraphsaretestedin[1]. requires to model objects by multi-view assembly [28]. However,theybecomemorecriticalwhenarelativelylargenumberofgraphs Fromthemethodologyperspective,pairwisegraphmatching are considered; iii) perform extensive evaluations that involves more graph methods aim to find the correspondences that preserve the samples,additionaldatasets,andmorestate-of-the-artsforcomparison. J.Yan(correspondenceauthor)iswiththeDepartmentofElectronicEngi- structural invariance between two graphs. Though being suc- neering,ShanghaiJiaoTongUniversity,Shanghai,200240China.Meanwhile, cessfulwhenthestructuralinvariancepropertyisroughlyhold, heisalsosecondarilyaffiliatedwithIBMResearch–China,Shanghai,201203 pairwise matching methods tend to fail when the differences China.e-mail:[email protected] J.WangiswithInstituteofDataScienceandTechnology,AlibabaGroup, between the input graphs are significant or the graph noises Seattle,WA,USA.e-mail:[email protected] are nontrivial. This is because the optimization solver may be H.ZhaiswithSoftwareEngineeringInstitute,EastChinaNormalUniver- trapped in local optima and/or far from the semantic ground sity,Shanghai,200062China,andtheSchoolofComputationalScienceand Engineering,CollegeofComputing,GeorgiaInstituteofTechnology,Atlanta, truth especially when large noises exist. However, a set of Georgia,30332,USA.e-mail:[email protected] graphs open the possibility to explore the global information X. Yang is with Shanghai Key Laboratory of Media Processing and andmatchingconsistencyregularizationthathelpimprovethe Transmission, Department of Electronic Engineering, Shanghai Jiao Tong University,Shanghai,200240China.e-mail:[email protected] matching accuracy. For instance, directly producing node cor- S. Chu is with IBM Research – China, Shanghai, 201203 China. e-mail: respondences between two significantly deformed graphs via [email protected] pairwise matching techniques is extremely error-prone; while The work is supported by NSF IIS-1116886, NSF IIS-1049694, NSFC 61129001,NSFC61025005andthe111Program(B07022). ideally, an indirect matching with a sequence of interpolating JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 2 graphsyieldsmorerobustresults.Forarbitrarygraphs,simply extensive empirical tests. applying the existing pairwise matching algorithms on each pairofgraphisfarfromsatisfaction.Suchapairwisematching II. RELATEDWORK based scheme encodes no global reasoning and regularization As a general problem for matching structural data, graph due to the separated and independent matching process, re- matchinghasbeenextensivelystudiedfordecadesnotonlyin sulting in information-loss and vulnerability to local noises. image processing and computer vision, but also in computer Moreover, different orders of sequential pairwise matching scienceandmathematics[10],[34].Hereweviewtheproblem would usually lead to inconsistent matching results, which from several key aspects that account for the main threads of means XTiaXaj (cid:54)= XTibXbj for matching graph i and j, and the related work, mostly in the area of image processing and the anchor graph is a and b respectively. Here X is the node- pattern recognition. We will discuss pairwise matching and mappingassignmentmatrixwhoseformaldefinitionwouldbe multiple graph matching separately. given later in the paper. This fact has been illustrated and discussed in our conference paper [1]. A. Advances on pairwise graph matching Compared with the vast existing work on the pairwise Machine Learning Methodologies: Conventional graph graph matching problem [9], [14], [15], [16], [17], [18], matching methods first compute an affinity matrix and keep [29], [30] etc., the topic of multi-graph matching is in fact the affinity metrics unchanged during the entire matching a relatively less-investigated one in the image processing process. Recent work leverage various leaning algorithms for and computer vision community [27], [31], [32]. Motivated estimating the optimal affinity matrix [9], [17], [35], [36], by the limitations of the existing approaches, we aim to [37], and the methods can fall into either supervised [17], design a robust method to obtain consistent node-to-node unsupervised [9], or semi-supervised [35] learning paradigm. correspondenceacrossacollectionoflooselyrelatedobjectsor The problem of estimating the optimal setting of the affinity weightedgraphs.Despitethefactthatnotheoreticalguarantee metricisoutofthescopeofthispaper.Weassumetheaffinity isprovidedforobtainingagloballyoptimalsolutions(notethe matrix is prior known which is the same with most of related problem is NP-complete), in this paper, we do take account work [4], [14], [15], [16], [29], [38], [39] etc. the global information of the entire set of graphs to generate Higher-Order Affinity Modeling: Combing the unary and approximated solutions that tend to satisfy the structural second-order edge information has been heavily investigated information and matching consistency across all the graphs. since such a type of matching schemes plays a good tradeoff To evaluate the effectiveness of the proposed multi-graph between computational complexity and representation capa- matching approach, we perform extensive empirical studies bility [4], [14], [15], [38], [39]. Recently, the higher-order on both synthetic datasets that are built using the popular information has been encoded to achieve more robust match- protocols [15], [29], as well as the well-known benchmark ing paradigms. Several representative hyper-graph matching datasets including the CMU motion sequence, the POSE- methodshavebeenproposedforpatternrecognitionandimage sequence, and the WILLOW-ObjectClass data. processing applications [35], [40], [41], [42], [43] that encode The major contributions of our work are: higher-order information to enhance the matching distinctive- First, we propose a unified framework, which has two ness. However, a slight increase in the order would lead to a alternating optimization algorithm variants to cope with non- combinatorialexplosionofthestatespace.Asaresult,mostof factorized and factorized affinity matrix in the objective func- higher-order methods, such as the related work we mentioned tion, respectively. Our method bears several merits: i) the here,aretypicallyappliedonverysparsegraphswithnomore pairwiseaffinitiesovermultiplegraphsarejointlyexplored,in than third-order features. In addition, it is worth noting that the hope of being more robust against local noises, which is the term pairwise used in this paper refers to matching two empirically observed in our extensive tests; ii) the framework graphs,whileinthecontextofhyper-graphmatching,pairwise is flexible to incorporate various existing pairwise matching sometimes refers to the second-order edge affinity. techniques in an “out-of-box” fashion, in two stages for both Optimization Methods: Most approaches first formulate before and during the iteration; iii) our method does not an objective function, and then employ certain optimization impose any consistency requirement on the initial matching methods to derive optimal matching results [4], [14], [38], inputs.Bycontrast,othermethods[32],[33]requiretheinitial which can vary among a wide spectrum of optimization solutions must be inconsistent, which allows them to improve techniques and strategies. Several recent work first relax the the overall accuracy by enforcing consistency. Therefore, our objectivefunctiontoaconvex-concaveformulation[29],[44]. methodcanstart with,andfurtherimprove theresultsof[32], Then the optimal solutions are obtained using the so-called [33] also in an “out-of-box” fashion. path following strategy and a modified version of the Frank- Second, we define and use the metrics related to graph- Wolfe algorithm [45]. Probabilistic matching paradigms are wise/pairwise consistency to address two key challenges in also developed, which have shown power in interpreting and our framework: i) appropriate selection of the reference graph addressing hyper-graph matching problems [15], [42], [43]. which induces a set of basis variables to proceed the iterative optimization procedure effectively; ii) adaptive setting of the B. Advances on multiple graph matching iterative updating order, which improves the convergence speed by a notable margin. Compared with the preliminary Themulti-graphmatchingproblemisalsoreferredasCom- version [1], the consistency-driven framework outperforms in mon Labeling [31] or Multiple Isomorphism [46]. In [31], a JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 3 common labeling is defined as a bijective mapping between all graph nodes in the considered graphs to a virtual node set. The common labeling is constructed by a consistent multiple isomorphism [46], where an isomorphism involves assigning each node from one graph to one of the other graphs. Comparedwiththepairwisematchingproblem,themultiple graph matching has not been extensively studied, and only a few address this problem using principled formulations (a) twographsandtheassociatedaffinitymatrix (b) thestartreestructure or techniques. A loosely related early work [47] aims at finding a maximum spanning tree on a super graph whose Fig.1:Illustrationsfor:a)thepairwisematchingaffinitymatrixinducedbytwosample vertices represent graphs, and its edges represent matching graphs. Darker cells in the matrix denote smaller value within the normalized value range[0,1];b)thestartreestructureforthereferencegraphtogetherwiththespecified correspondencesbetweentwographs.Theedgesonthesuper- “updated” graph and the resting “fixed” graphs in one iteration of the proposed two graphareweightedbytheir“quality”suchasmatchingaffinity methods.Fivepairwisetermsareconsidered:Kru,Kf1u,Kf2u,Kf3u,Kf4u. score as we will describe later in this paper. Very recently, Sole-Ribalta and Serratosa [48] (and its journal version [31]) Specifically, his paper intensively uses X to denote the ij generalize the classical Graduated Assignment Graph Match- pairwise matching matrix between graph i, j, and X = ing (GAGM) algorithm [14], [16] from two-graph to multi- {X ,i,j =1,...,N}forthesetofpairwisematchingmatrix ij graphcase,whichgeneratesthecommonlabelingbymatching over a graph set denoted by G = {G ,...,G }. We call X 1 N all graph nodes to a virtual node set. This method is assumed thematchingconfigurationw.r.t.G.Ifnotexplicitlystated,we toinheritthesoundperformanceoftheoriginalmethod,while follow the convention that using N for the cardinality of G, being more time-consuming as it repeatedly applies GAGM n for the number of nodes in a graph, and m for edges. across graph pairs iteratively. Other two recent work [33], Now we introduce two definitions regarding with matching [32]starttheirprocedureonaninconsistentpairwisematching consistency induced by the initial pairwise matching results configuration that covers all graph pairs. Given N graphs fromanypairwisematchingsolver.Aswouldbeshownlaterin with n nodes per each, the former method first builds an thispaper,thesetwodefinitionsplayakeyroleintheproposed N-dimensional probabilistic hyper-cube with size n in each alternating optimization framework. In general, they are used dimension, whereby each cell indicates the probability for the to solve two common problems associated with an alternating N-nodecorrespondencefromN graphsrespectively.Thenthe optimization method, respectively: i) how to choose a set of consistency and binarization are fulfilled in a post-processing base pairwise matching variables to proceed the iteration; ii) step.Thelatteremploysspectralapproximationtoeigenvector how to set an optimal rotating order for alternating updating. decomposition on the matching configuration matrix stacked by all raw pairwise matching solutions (assignment matrix), Definition 1. Given N graphs G={Gk,k = 1,...,N} and recover the consistent matching solutions. There are also and the pairwise matching configuration X = {Xij,i,j = severalothermorerecentworkonmatchingabatchofgraphs 1,...,N}, the graph-wise consistency of graph Gk is defined by self-boosting [49] and multi-view point registration [50]. asC (G ,X)=1−(cid:80)Ni=−11(cid:80)Nj=i+1(cid:107)Xij−XikXkj(cid:107)F/2 ∈[0,1]where g k nN(N−1)/2 X is the pairwise permutation matrix over the graph set G. ij III. PRELIMINARIESFORGRAPHMATCHING Definition 2. Given a set of graphs G={G ,k = 1,...,N}, k In this section, several notations used in this paper and two matching configuration X, and a reference graph G , for any r definitions related to the proposed framework will be intro- othergraphG ,thepairwiseconsistencybetweenG andG is u u r dpuaicrewdi,sfeogllroawphedmbaytcahrientgrousnpdeecrtiotwnoonpaerxaidsitginmgsf:onrmonu-lfaatciotonrsizfeodr defined as Cp(Gu,Gr,X)=1− (cid:80)Ni=1(cid:107)Xri−nNXruXui(cid:107)F/2 ∈[0,1] and factorized representations of the affinity matrix. We leave the details of using the two definitions to Section IV in the context of the proposed multi-graph matching framework. In the rest of this section, we depict the two A. Notations and definitions existing pairwise graph matching formulations, which are the Throughout the paper, R denotes the real number domain. origins of the proposed multi-graph matching algorithms. Bold capital letters denote for a matrix X, bold lower-case letters for a column vector x, and hollow bold letters for a set B. Non-factorized pairwise graph matching X. All non-bold letters represent scalars. XT is the transpose GiventwographsG (V ,E ,A )andG (V ,E ,A ),where of X; diag(x) is a diagonal matrix whose diagonal elements 1 1 1 1 2 2 2 2 V denotes nodes, E, edges and A, attributes. There is are x; vec(X) is the column-wise vectorized matrix X. tr(X) an affinity matrix K ∈ Rn1n2×n1n2 defined such that is the trace of matrix X. In ∈Rn×n is an identity matrix and Kia;jb,(i,j = 1,...,n1),(a,b = 1,...,n2) measures the the subscript n will be omitted when it can be inferred from edge pair affinity (vi,vj) vs. (va,vb) from two graphs. The context. 1m×n,0m×n ∈ Rm×n are matrices of all elements diagonal term Kia;ia describes the unary affinity of a node match (v ,v ). Rigorously, the affinity value K for the being ones and zeros. 1 is the abbreviation for 1 . X◦Y i a ia;jb n n×1 edge pair (v ,v ) vs. (v ,v ) is located at the ((a-1)n +i)-th and X⊗Y denote the Hadamard and Kronecker products of i j a b 1 row and ((b-1)n +j)-th column of K. One example of K is matrices. |X| is the cardinality of the set X, (cid:107)X(cid:107)F =tr(XTX) illustrated in Fig2.1(a). By introducing an assignment matrix for the Frobenious norm and (cid:107)·(cid:107)p is the p-norm. X∈{0,1}n1×n2 for n1 =|V1|,n2 =|V2|, we set Xia =1 if JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 4 node vi matches node va (0 otherwise). The problem of GM matrix,andKq12 ∈Rm1×m2 fortheedgeaffinitymatrix,which involves finding the optimal correspondence X, such that the is used to measure the similarity of each pair of nodes and sumofthenodeandedgecompatibilitybetweentwographsis edges, respectively. As shown in [29], then the affinity matrix maximized.Withoutlossofgenerality,weassumen ≥n for for pairwise matching can be factorized to: 1 2 different sizes of graphs. This leads to the following two-way constrained quadratic assignment problem (QAP): K12 =(H2⊗H1)diag(vec(L12))(H2⊗H1)T X∗ =argmaxvec(X)TKvec(X) where Hi =[Gi,Ini]∈{0,1}ni×(mi+ni), i=1,2 X (cid:20) Kq −Kq GT (cid:21) s.t. X1n2 ≤1n1 1Tn1X=1Tn2 X∈{0,1}n1×n2 L12 = −1G21Kq12 G1K12q12G2T2 +Kp12 The constraints refer to the two-way one-to-one node map- BasedontheabovefactorizationofK ,theoriginalpairwise 12 ping:anodefromgraphG canmatchatmostonenodeinG graph matching objective function can be written as [29]: 1 2 andeverynodeinG2iscorrespondingtoonenodeinG1.There J12=vec(X12)T(H2⊗H1)diag(vec(L12))(H2⊗H1)Tvec(X12) is no (one/many)-to-many matchings between two graphs. (cid:16) (cid:17) The above formulation is general as it allows two graphs =tr L12(HT1X12H2)◦(HT1X12H2 having unequal number of nodes (n1 (cid:54)= n2). Similar to By factorizing L to L = U VT = (cid:80)c ui viT, the previous work [12], [29], we follow the protocol that 12 12 12 12 i=1 12 12 cpoenrmveurttastiXonfmroamtrixan(Xa1snsi2g=nm1enn1t)mbyataridxdi(nXg1dnu2m≤my1nn1o)detsotoa [wvh112e,rev212U,1·2·· ,=vc12[]u∈112R,u(n2122+,·m·2·),×ucc1,2J]12∈canRb(en1d+emriv1)e×dca,sV[29]=: oanndegaruagpmhe(ni.te.thaeddaifnfignsitlyacmkvatarriixabblyeszteorothse)ainssicgansmeenn1tm(cid:54)=atnri2x. J12 =(cid:88)tr(cid:16)Ai12X12Bi12XT12(cid:17) (2) This is a standard technique from linear programming [51] i and is adopted by [12], [29], [52] etc., being able to handle where Ai =H diag(ui )HT, Bi =H diag(vi )HT 12 1 12 1 12 2 12 2 superfluous nodes in a statistically robust manner. By taking this step, the graphs are of equal sizes. This preprocessing Notetheabovefactorizationformulationdoesnotrequiretwo opens up the applicability of existing multi-graph methods graphs being of equal sizes. In the rest of paper, similar to [31],[32],[46]astheyareallbasedontheassumptionthatall the non-factorization case, we will add dummy nodes in case graphsareofequalsizes.Therefore,thefollowingformulation of unequal sizes of graph, to make the two-way constraint is used throughout the paper which assumes n =n =n. 1 2 become a bijection. This step will transform X to a strict 12 X∗12 =argmaxvec(X12)TK12vec(X12) (1) permutation matrix, which leads to the following convex- X12 s.t. X 1 =1 1T X =1T X ∈{0,1}n1×n2 concave relaxation formulation as discussed in [29]. 12 n2 n1 n1 12 n2 12 Here X is a permutation matrix which is constructed by 12 D. Convex-concaverelaxationsforfactorizedgraphmatching augmenting the assignment matrix with slack columns in case By ensuring X a permutation matrix such that XT X = n >n ,suchthatthereisalwaysabijectionbetweengraphs. 12 12 12 1 2 I , the objective can be relaxed to the convex formulation, The above QAP formulation is used by most existing bnynaddingaconstanttermC asusedin[29].Thuswehave: 12 GM methods [4], [14], [15], [16], [38], which directly deals 1 with the large pairwise affinity matrix K. The affinity matrix J1v2ex(X12)=J12(X12)− 2C12(X12) (3) polradyesr aancdenstercaolnrdo-loerdinerGrMelatbieocnasusbeetiwteeenncogdreasphasl.l Tthheefitrwsto- where C12=(cid:88)(cid:16)tr(Ai12Ai12X12XT12)+tr(Bi12Bi12XT12X12)(cid:17) i common properties of K, full-rankness and indefiniteness, On the other hand, as shown in [29], the concave relaxation pose key challenges to conventional GM methods such as Jcav can be written as: 12 spectralmethods[4],[38]andgradient-basedapproaches[14], (cid:16) (cid:17) [15], [16]. In addition, its relatively large size also impedes J1c2av =tr Kq1T2(GT1X12G2◦GT1X12G2) (4) the applicability when large-size graphs are considered. Thus (cid:16) (cid:17) (cid:16) (cid:17) −tr (G Kq GT)TX +tr KpTX the factorized graph matching formulation is studied and 1 12 2 12 12 12 introduced by [29] in parallel which avoids involving the whole K for optimization. IV. MULTIPLEGRAPHMATCHINGBY C. Factorized pairwise graph matching CONSISTENCY-DRIVENALTERNATINGOPTIMIZATION The authors in [29] show that the affinity matrix can First of all, as the same with the preprocessing used in be factorized as a Kronecker product of smaller matrices, pairwise graph matching that makes graphs of equal size, we which decouples the graph structure from the affinity. Specif- add dummy nodes to make all input graphs of the same size. ically a graph G can be denoted by {P,Q,G}, where P = [p ,...,p ] ∈ Rdp×n, Q = [q ,...,q ] ∈ Rdq×m are the Note this protocol is also used by [31], [32], [46] for multi- 1 n 1 m feature matrices computed for n nodes and m edges. Here d graph matching. Based on this consensus, in what follows we p and d are the number of dimensions for unary features and will present our algorithm with two variants, by factorizing q edge features. The topology of the graph is specified by the the affinity matrix and not, respectively. The non-factorized node-edge incidence matrix G ∈ Rn×m such that the non- formulation is a more dominant representation used in most zero elements in each column of G indicate the starting and existingwork[4],[39],[15],[16],whiletheotheravoidsusing ending nodes in the corresponding edge. Refer to [29] for moredetails.Morespecifically,giventwographs{P ,Q ,G } the whole affinity matrix in optimization [29], [30]. We will 1 1 1 and {P2,Q2,G2}, let Kp12 ∈Rn1×n2 denote the node affinity provide a unified approach to cope with these two cases. JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 5 A. Non-factorized multiple graph matching Algorithm 1 Consistency-driven Non-factorized Alternating Given N graphs and the pairwise affinity matrix K for Optimization for Multi-Graph Matching ij eachpairofgraphsGi,Gj,withoutlossofgenerality,themulti- Input: graph matching objective function can be written as follows: 1: N graphswithnnodesofeachgraph; N 2: PairwiseaffinitymatrixKij(i,j=1,...,N); X∗ =argmax (cid:88) vec(X )TK vec(X ) (5) 3: Maximumiterationcount:Tmax; ij ij ij Output: X i,j=1,i(cid:54)=j 4: ConsistentassignmentmatrixXij (i,j=1,...,N); s.t. X 1 =1 1TX =1T X =XT ∈{0,1}n×n Procedure: ij n∀i,j =n1,.n..,iNj ; |nX|=iNj (N −ji1) 5: pOebrtfaoirnmitnhgepraaiwrwmiseatcghrainpghmcoantcfihgiunrgatoiovnerXN=grap{hXs;ij} by exhaustively (awughmereentXed a=ssig{nXmije,nit,)jma=trix1,s.e.t.s,uNch}thiast Xthiej =peXrmTjiu.taNtiootne 768::: SSIneeitttiuraelpifdzeearetitnnhcgeeblgiesrstatpOshouGldutrtioi=nnsamsXcae∗kxnrGdk=inCgXgok(rrGd,ekkr,wX=.)r,.1t{.,k.C.=p.(,GN1u,,.,k.G.(cid:54)=r,,NXr;}); that by the definition of affinity matrix as introduced earlier 9: fort=1:Tmax do in the paper, in general Kij (cid:54)= Kji, Kij (cid:54)= KTji. Though 1101:: forFuixinNO-2uXdttufd,oforf =1,...,N,f (cid:54)=r,u,updateXturbysolving they encode redundant information, we include all Kij in the thetwo-graphmatchingproblem(7); objective function, which would be used in the optimization 12: Compute the updated objective score J(Xur) using the updated Xt fortheobjective(7); procedure as we will show in the following. ur One obvious observation on the above function is that 13: Computetheso-farbestobjectivescoreJ∗(Xur)usingtheso-far- bestX∗ fortheobjective(7); the pairwise matching variables X are redundant and can ur be determined by a compact basisijvariable set {X ,k = 14: ifJur >Ju∗r,X∗ur =Xtur; rk 15: endfor 1,...,N,k (cid:54)= r} (a star tree rooted at the reference graph) 16: endfor such that any X can be computed by XT X . Consequently, ij ki kj we design our non-factorized multi-graph matching algorithm as follows. First, in order to induce a basis matching set to Algorithm 2 Consistency-driven Factorized Alternating Opti- proceedtheoptimizationprocedure,areferencegraphGr isset mization for Multi-Graph Matching by a certain means. Then in each iteration, one can choose a certaingraphG inrotationbyacertainorderO ,andupdate Input: u udt its mapping with G i.e. X , by fixing the other N −2 X 1: N graphswithnnodesofeachgraph; r ur rf regardinggraphsG (f =1,...,N,f (cid:54)=r,u)againstG .This 2: Graph-wisenode-edgeincidencematrixGi,nodeandedgeaffinitymatrix f r Kp,Kq (i,j=1,...,N); idea is illustrated in Fig.1(b). Now, we reach the following ij ij objective function by dropping the constant terms1 for X : 3: Maximumiterationcount:Tmax,path-followingstepsizeδ rf Output: N 4: ConsistentassignmentmatrixXij(i,j=1,...,N); vec(Xur)TKurvec(Xur)+f=1(cid:88),f(cid:54)=r,uvec(Xuf)TKufvec(Xuf) P5r:ocOebdtuarine:the raw matching configuration X = {Xij} by exhaustively performingtwo-graphmatchingoverN graphs; tNhiosteleiandsthteoptehremfuotlaltoiwoninmgaetrqiuxaftoiornmiwnethheavveecXtourfiz=edXfuorrmXr:f, 67:: SSeettruepfdearetinncgelgisrtapOhuGdtri=namscaexnGdkinCggo(rGdekr,wX.)r,.t{.kC=p(G1u,.,.G.r,,NX}); vec(X )=(X ⊗I)vec(X ) (6) 8: InitializethebestsolutionsX∗rk=Xrk,k=1,...,N,k(cid:54)=r; uf fr ur 9: fort=1:Tmax do FromnowonwewilluseF ∈Rn2×1 todenoteX ⊗I,by 10: foruinOudt do fr fr 11: FixN-2Xt ,forf =1,...,N,f (cid:54)=r,u,updateXt byusing replacing vec(X ) via vec(X ) = F vec(X ) we rewrite fu ru uf uf fr ur thefollowingpath-followingprocedure: the objective function more compactly as follows: 12: forα=0:δ:1do 13: update Xt via applying MFW on the convex-concave relax- N ru J(X )=vec(X )T(K + (cid:88) FT K F )vec(X ) (7) ation:J =(1−α)Jvex+αJcav byformula(10). ur ur ur fr uf fr ur 14: endfor f=1,f(cid:54)=r,u 15: Compute the updated objective score J(Xru) using the updated It becomes clear that in each iteration the sub-problem (7) Xtru fortheobjective(9); is a standard pairwise graph matching problem, which can be 16: Computetheso-farbestobjectivescoreJ∗(Xru)usingtheso-far- bestX∗ fortheobjective(9); ru solved by various pairwise graph matching techniques based 17: ifJru>Jr∗u,X∗ru=Xtru; on the QAP formulation in an “out-of-the-box” manner2 18: endfor 19: endfor So far, we have proposed our alternating optimization framework that directly deals with the affinity matrix. Note thatintheabovediscussion,weassumethereferencegraphG r andtheupdatingordero arebothpre-given.Wewouldstill B. Factorized multiple graph matching udt holdthisassumptionforpresentingthefactorizedvariantinthe Recent work [29] exploits the underlying structure of affin- next paragraph. In the end of this section, we would address ity matrix K, which is not necessarily negative definite, in the these two common problems using a principled paradigm. hope of designing better optimization scheme for addressing As we will show later, it is closely related to the graph- thenon-convexissue.Thepresentedalgorithmintheprevious wise/pairwise consistency metrics as defined in Section III. section cannot be directly applied to the original factorized graphmatchingformulationin[29]asthere-weightedaffinity 1Forefficiency,weomitthetermsregardingKfuastheyhavebeenencoded matrix in (7) lacks a convenient interpretation as the original byKuf.Thispolicyisusedthoughtthepaperfortheproposedalgorithms. affinitymatrixthatcanbefactorized(decoupled)intopairwise 2Several matching methods are not or not explicitely based on QAP: e.g. similarity and self-structure. In this section, we present an thegrapheditdistancebasedmethods[53]andtherecentadvances[54],[55] canenjoybettererror-toleranceagainstmissingnodesandedges. alternating optimization approach to solve the multiple graph JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 6 matching problem based on the factorized formulation. As where the gradient can be obtained as follows: pointed out by [29], the main advantage of factorized model N is avoiding computing and storing the large-sized affinity ∇ Jα =(1−α)∇ (Jvex+ (cid:88) Jvex) (12) Xru Xru ru fu matrix by decoupling it into smaller edge-wise and node-wise f=1,f(cid:54)=r,u matricesaswehaveshowninthepairwisegraphmatchingfor- N mulation. Another notable difference from our non-factorized +α∇Xru(Jrcuav+ (cid:88) Jfcauv) multi-graph matching algorithm, is that it derives a specific f=1,f(cid:54)=r,u convex-concave path-following algorithm as we will present Having obtained the optimal Y, the optimal step size λ can inthissection,whiletheformercanre-useanynon-factorized be found at the optimal point of the following parabola: graph matching solvers [15], [16], [38], [39]. Jα =(1−α)Jvex(X +λY)+αJcav(X +λY) (13) In general, the factorized multiple graph matching problem ru ru can be expressed by maximizing the following objective =aλ2+bλ+const function, where J is in the form of formula (2): ij Next, we would focus on solving the two common issues N X∗ =argmax (cid:88) J (X ) (8) for both non-factorized and factorized variants: i) finding the X ij ij optimal reference graph G that induces the basis variable i,j=1,i(cid:54)=j r set {X ,k = 1,...,N,k (cid:54)= r} to initialize the iterative s.t. X 1 =1 1TX =1T X =XT ∈{0,1}n×n rk ij n n n ij n ij ji optimization procedure; ii) setting the optimal updating order ∀i,j =1,...,N; |X|=N(N −1) O to speed up convergence and to suppress possible error udt For the factorized graph matching formulation, we will propagation over alternating optimization. This is because directly use the matrix form X instead of the vectorized although in each iteration the objective (7) or (9) contains form x = vec(X) as used in the non-factorized case. As the affinities over multiple graphs to explore jointly, nevertheless, samewiththenon-factorizedmulti-graphmatchingproblem,a reference graph Gr is first selected, followed by an alternating this new objective is coupled with the estimated Xrf from the optimization procedure with a certain sequential updating or- previous iteration thus cannot fully avoid error propagation. der.Similartothenon-factorizedcase,wereachthefollowing objective function without using the affinity matrix: C. Consistency-driven alternating optimization N (cid:88) J(X )=J (X )+ J (X ) (9) Firstweaddresstheproblemrelatedtofindingthereference ru ru ru fu fu f=1,f(cid:54)=r,u graph. Our iterative alternating optimization involves a set of Note J is a function of X as X = X X for fixed basis mappings between a reference graph and others in an ru fu fr ru X . Its convex-concave relaxation form, which is weighted expectation maximization manner. It is critical to generate fr by α∈[0,1], can be written as follows: reasonably accurate initial solutions to avoid trapping into an unsatisfactory local optimum. Specifically, one is given a Jα(X )=(1−α)(cid:16)Jvex(X )+ (cid:88)N Jvex(X )(cid:17) (10) raw matching configuration Xraw obtained from independent ru ru ru fu fu f=1,f(cid:54)=r,u pairwise matching without knowing the ground truth. Under +α(cid:16)Jrcuav(Xru)+ (cid:88)N Jfcauv(Xfu)(cid:17) tGhrisancodnidtsitaiossno,coinaeteidsbsaeseiksisnegtathna“tasppparnoaprnieawte”mraetfcehreinngcecognrafipgh- f=1,f(cid:54)=r,u uration Xspan by Xspan = XrawTXraw. One intuitive metric ij ri rj where Jvex is written by formula (3), and Jcav by formula to approximate the accuracy is the graph-wise affinity score (4). As α increases from 0 to 1, this path-following strategy by(cid:80)N vec(X )TK vec(X )givenG .However,due k=1,k(cid:54)=r kr kr kr r enjoys the global optimal solution when α = 0 due to the to outliers and local deformation, as well as the difficulty in convex form, and finally leads to an integer solution when setting up the perfect affinity matrix in a parametric manner3, α = 1, for the concave form. Thus it is insensitive to the the ground truth may not correspond to the highest score initial point, and usually no post-binarization is needed [56], modeled by the parametric objective function. Thus graph- [57] which otherwise may cause additional performance loss. wise score is not a robust indicator to accuracy as shown in For each α ∈ [0,1], the sub-problem can be solved using Fig.2, which will be discussed in details in our experiments. the Frank Wolfe’s algorithm (FW) [45], which is widely Our embodiment is setting G = max C (G ,X) by used constrained nonlinear programming. In implementation, r Gk g k we use the modified Frank Wolfe’s algorithm (MFW) [58] Definition (1). The rationale is that the erroneous correspon- to speed up its convergence which probably finds a better dences are at random yet correct correspondences concur searching direction Y by a convex combination of previously thus consistent across pairwise matchings. This observation obtained solutions. In the experiments, we used the directions motivates us choosing G as the one maximizing the graph- computed in 2 previous steps. The FW (MFW) algorithm first r wise consistency – Definition (1), in the hope that it would computes the optimal direction Y and then determines the optimal step size λ ∈ [0,1], with respect to the objective inducethemostaccuratebasissetforinitialization,orequally: function(10).TheoptimalYwithrespecttoX initerationk min (cid:80)N (cid:107)Xspan − XrawTXraw(cid:107) , where (cid:107)(cid:107) is the p- ru r i,j=1 ij ri rj p p canbecalculatedbysolvingthefollowinglinearprogramming norm for a matrix. Since the resultant matching matrices are problem by the Hungarian method [59]: (cid:16) (cid:17) 3Currentlytheaffinityfunctionismostlymodeledbyparametricfunctions, max tr ∇ Jα(Xk )T(Y−Xk ) (11) Y Xru ru ru thefixedparametersbywhatevermanualsetting[16],orlearnedfromtraining samples[17],[36]etc.arestillunabletoperfectfitthescorewithaccuracy, s.t. Y1 =1 ,YT1 =1 ,Y≥0 n n n n n×n leadingtotheexistenceofdiscrepancybetweenscoreandaccuracy. JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 7 TABLEII:ParametersettingsforsolutionpathillustrationasshowninFig.2. noisetype parametersettings results deform N=20,nin=12,nout=0,ε=.15,ρ=1,σ2=.05 Fig.2(a) outlier N=20,nin=8,nout=4,ε=.05,ρ=1,σ2=.05 Fig.2(b) density N=20,nin=12,nout=0,ε=.05,ρ=.5,σ2=.05 Fig.2(c) D. Implementation details and convergence discussion (a) Deform (b) Outlier (c) Density Another consideration is due to the sub-optimality nature of existing pairwise matching techniques for solving the NP- hard sub-problem of Eq.(7) or (9) per iteration. Therefore the newly obtained solution cannot guarantee to achieve higher Fig. 2: Comparison of four strategies for setting reference graph, updating order and affinityscorethanthepreviousone,althoughoftenempirically enforcingscore-non-descendingpathselectionconstraint,refertoTableIandTableII for structured descriptions. Accuracy over iteration path by four solvers in different observed. To avoid the score degenerating case, we suggest colors:RRWM(blue),GAGM(green),FGM(black),IPFP(red).Thecorrespondingfour enforce a score-non-descending path selection strategy by horizontalsolidlinesineachplotindicatetheperformanceofabaselinebyrandomly choosingagraphasthereferenceonetoderiveconsistentmatchingconfiguration.The comparing the objective score calculated by the new solution curvesaregeneratedbyaveraging50randomtestsoverTmax =2iterations,i.e.the Xt and the one from the currently maintained solution X∗ . numberofinneriterationroundsis(N−1)∗Tmax=38.Zoominforbetterdisplay. ur ur The new solution would be dropped if it decreases the score. As such, we obtain a score-non-descending solution path. TABLE I: Settings of reference graph, alternating updating order, and path selection strategyforthesolutionpathsasillustratedinFig.2. When this strategy is not imposed, X would always be ur referencegraph updatingorder pathselection curve overwritten. We would compare both the “path selection” and graphwiseconsistency pairwiseconsistency enforced dashed “non-path selection” strategies in our experiments. graphwiseconsistency randomorder enforced solid graphwiseconsistency pairwiseconsistency non-enforced dash-dot Now, we summarize the above discussion and analysis into graphwisescore pairwisescore enforced dotted twovariantsofouralternatingoptimizationalgorithms,which are depicted in Alg.1 and Alg.2 for the non-factorized and factorized model respectively. The score-non-descending path all binary ones, thus the setting of the reference graph is selection step is plugged in the two algorithm charts. insensitive to p. Without loss of generality, we set p=2. Fig.2depictsacomparisonunderdifferentsettingsbyusing Given the basis variable set for rotating updating, the next the proposed framework, regarding with the way of setting i) problem is finding an “optimal” updating order. The pairwise the reference graph, ii) the updating order and iii) the path consistency C (G ,G ,X) – Definition (2) is used to define selection strategy. Four pairwise matching solvers are used to p u r the order in which the sample graphs in the iterations are study if the solution path is impacted by the specific pairwise considered, so that the least accurate ones are updated first, matching technique or if a more general pattern exists. We thus avoiding error propagation and speeding up the conver- will give a detailed analysis to Fig.2 later in our experiments. gence. Motivated by the similar observation in the case of In the last, we provide a general discussion about the finding the reference graph, the pairwise consistency measure convergencebehavioroftheproposedmethods.Bothproposed is considered to approximate the pairwise matching accuracy. algorithmsinvolveupdatingasetofbasisassignmentsolutions As a result, the updating variables are ranked in ascending of length N: {Xt ,k = 1,...,N,k (cid:54)= r} w.r.t. the reference rk order with respect to C (G ,G ,X). Similarly, C (G ,G ,X) graphG initerationt.NowweconcatenateallindividualXt p u r p u r r rk is also insensitive to which matrix norm (cid:107)(cid:107) (we set p = 2 into a single matrix Xt = [Xt ,Xt ,...,Xt ]. Since each p r r1 r2 rN here) is used as only binary matching matrices are involved. Xt is a discrete binary permutation matrix thus Xt is also rk r Note the authors in [31], [33] also define an inconsistency exhaustively enumerable. As a result, as iteration continues, index for the overall pairwise matching configuration X, or, there exist t and s (t<s), such that the t-th iteration solution multipleisomorphismastermedintheirpapers.However,that Xrt wouldequaltoapreviousvalueXrs (Otherwiseitimplies index is not related to the fine-grained graph-wise/pairwise the solution space is innumerable thus contradicts with the consistency, and unable to define the reference graph and fact). Furthermore, because both algorithms are deterministic, updating order. Perhaps more importantly, the two proposed thustheiterativesolutionpathwouldrestartthesolutionpath: definitions in general provide the sketch for deriving other Xtrk →Xsrk =Xtrk →Xsrk →··· inaloopingmanner.There- consistency metrics, which can be tailored in particular appli- fore, both algorithms would converge to a looping sequences cations. For instance, the graph-wise consistency can be cal- when t<s or to a fixed point when t=s. culated by weighting each term (cid:107)X −X X (cid:107) in Definition ij ir rj (1)byaparameterw ifthepriorestimationonthequalityof ij V. EXPERIMENTSANDDISCUSSION theinitialpairwisematchingsolutionisgiven.Insummary,the presented two measures themselves already bear some gener- The experiments are performed on both synthetic and real- alities since the binary matrices are insensitive to the choice image datasets. The synthetic test is controlled by quanti- of p-norm and they can allow weighted variants as discussed tatively varying the disturbance of deformation, outlier and above. Moreover, our general consistency-driven mechanism edge density. The real-image datasets are tested with varying can also benefit from other newly designed metrics. viewing angles, scales, shapes, and spurious outliers. JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 8 The matching accuracy over all graphs, is calculated by the protocol of [29], [36] that set the final affinity matrix averaging all pairwise matching accuracy (cid:80)iN=−11(cid:80)Nj=i+1Accij. re-weighted by the edge length affinity and angle affinity: Each Accij computes the matches between thNe(Nc−o1r)r/e2spon- Kij,ab = βKilje,nab +(1−β)Kiajn,agb, where β ∈ [0,1] is the dence matrix Xalg given by the ground truth Xtru: Acc = weighting parameter. This is because this dataset is more ij ij ij tr(XalgXtru) geometrically ambiguous than the sequence data if only edge ij ij . Note we only calculate the accuracy for com- tr(1nj×niXtijru) length is used. The angle for each edge is computed by the mon inliers and ignore the matching results over outliers. absoluteanglebetweentheedgeandthehorizontallineasused Theabovetestingmethodologiesfollowastandardprotocol in [29]. The edge affinity and angle affinity are calculated in widelyadoptedbymanyrelatedworkssuchas[15],[16],[29]. the same way in the CMU-POSE test. For node-wise affinity, we use the 128-dim SIFT feature [61] s ∈ R128 associated with each single landmark by K =exp(−(cid:107)s −s (cid:107) ). A. Dataset description and affinity setting ia;ia i a 2 Synthetic data The synthetic test follows the widely used protocol of [1], [14], [15], [16], [29], [38]. For each trial, B. Comparing methods a reference graph with nin nodes is created by assigning First we give a short description for the used pairwise a random attribute to its edge, which is uniformly sampled matching solvers, which serve as building-blocks for our and from the interval [0,1]. Then the “perturbed” graphs are other multi-graph matching algorithms [32], [33]. Other state- created by adding a Gaussian deformation disturbance to the of-the-art multi-graph methods [31], [32], [33] are briefly edge attribute qirj, which is sampled from N(0,ε) i.e. qipj described in the sequel. The tests run on a laptop with 2.9G = qirj+N(0,ε) where the superscript ‘p’ and ‘r’ denotes for Intel Core I7 and 8G memory with a single thread. The code “perturb”and“reference”respectively.Each“perturbed”graph of the comparing methods are all from original authors, apart is further added by nout outliers, which can also be helpful from [14], which is implemented by the author of [29]. to make the graphs of equal sizes when the input graphs are We select the following widely used pairwise graph match- different sizes. Its edge density is controlled by the density ing methods as the pairwise solvers in our methods. In parameter ρ ∈ [0,1] via random sampling. The edge affinity particular, the parameter settings of these methods as reported is computed by Kij,ab = exp(−(qij−σ2qab)2) where σ2 is the belowmostlyfollowtheoriginalsettingsfromtheauthors.We edge similarity sensitivity parameter. No single-node feature further slightly tune the parameters to balance efficiency and is used and the unary affinity Kii,aa is set to zero. efficacyasmatchingmultiplegraphsismoretime-consuming. CMU-POSE Sequence This data contains three se- Graduated assignment (GAGM) GAGM [14] performs quences. The first two are from the CMU house (30 gradient ascent on a relaxed QAP objective driven by the marks, 101 frames), hotel (30 marks, 111 frames) sequence deterministic annealing procedure. The relaxation level is (http://vasc.ri.cmu.edu//idb/html/motion/) which are widely controlledbyacontinuationparameterβ,whichisupdatedby used in [1], [15], [16], [17], [29], [36]. The third sequence αβ →β ≤β . We set α=1.1, β = 0.5 and β =50. t t+1 max 0 max is sampled from the sedan (VolvoC70) sequence (19 marks, In the CMU-POSE data test, we also replace GAGM with 225 frames) which is viewed from various angles covering a its variant, i.e. Soft Constrained Graduated Assignment [16] range of 70 degrees from the POSE dataset [60]. For each which is a recent improvement based on GAGM. test, an image sequence is sampled which is spaced evenly Integer projected fixed point method (IPFP) IPFP [39] by three frames. We utilize this dataset for the outlier test. approximates the original objective function via transforming We select nin=10 landmarks out of all nant annotated points it into a series of linear assignments over iterations, and in (nant=30 for the two CMU sequences, nant=19 for Pose eachiterationfindstheoptimalsolutioninthediscretedomain sedan sequence), and randomly chose nout=4 nodes from viaHungarianmethod.Thenthemethodfindsthere-weighted the rest nant−nin nodes as outliers. The graphs are fully solutioninthecontinuousdomainalongthedirectionfromthe connected to encode all information to suppress outliers. current solution to the optimal discrete solution. We set the The affinity matrix is constructed by the edge length maximum round of iterations as 10 in all experiments, which similarity Klen = exp(−(dij−dab)2) where d , d are is in accordance with the empirical observation by [39]. ij,ab σ2 ij ab the Euclidean distance between two points that are further Re-weighted random walk matching (RRWM) RRWM normalized to [0,1] by dividing the largest edge length. The [15] introduces a random walk view on the problem and to unary affinity is also set to zero in line with [15], [16], [29]. some extent can be regarded as a re-weighted version for WILLOW-ObjectClassTheobjectclassdatasetreleasedin GAGM [14] and Spectral Matching [4] methods. We fix its [36]isconstructedbyimagesfromCaltech-256andPASCAL parameters α=0.2 and β=30 in all experiments. VOC2007. Each object category contains different number of Fast Bipartite graph matching (FBP) FBP [54] is a re- images:109Face,50Duck,66Winebottle,40Motorbike,and cently proposed graph edit distance based method. It approxi- 40 Car images. For each image, 10 feature points were man- matesthesecond-ordergraphmatchingproblemtoafirst-order ually labeled on the target object. The edge sampling for the assignment problem by considering the local edge structure affinity matrix follows the same way as [29] by constructing via fast bipartite matching. It requires to build the node-to- the sparse delaunay triangulation among the marks, since the node cost matrix C ∈ Rn×n which encodes both node-wise triangulation can efficiently encode the object structure when and local structure information around each node. However, no outlier exists. For defining the edge affinity, we follow in each iteration of our framework, only the (re-weighted) JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 9 affinitymatrixKisgivenwhiletheattributematrix(thispaper configuration4 (when N≤n) to obtain consistent matchings. is dealing with attributed graphs) for each graph is unknown Permutation synchronization (SYNC) SYNC [32] em- and cannot be recovered from K. Thus the attribute/adjacency ploys spectral analysis and approximation to eigenvector de- matrix based steps for computing C as used in [54], [55] are composition on the matching configuration matrix comprised inapplicable in our framework. To compute the element C ofallinitialpairwisematchingsolutions,andrecoverthecon- ia when only K is given, we employ the Hungarian method to sistent matching solutions. Note that the SYNC method only compute the assignment cost for the rest of nodes, by fixing can work when the number of nodes is less than the number the mapping i → a. Specifically, the input to the Hungarian of graphs, thus similar to the sub-step in the MHCL method, methodistherow/columnofK(byinvertingthevaluesoasto Maximum Spanning Tree (MST) is used when n≤N. change it from affinity to cost) that can be re-shapen into the cost matrix w.r.t. i → a i.e. vec2mat(max(K)−K ) – see C. Incorporating both pairwise and multi-matching solvers ia,: Fig.1(a) for illustration. Note this adaption may weaken the Havingdescribedtheabovemulti-graphmatchingmethods, performanceofFBPwhichisoriginallydesignedforeffective we provide a further comparison for the advantage of our exploring the individual graph attribute/adjancey information. framework,whichcoverstwoaspects:i)betterreusingvarious Factorized graph matching (FGM) FGM [29] factorizes pairwise matching techniques in an “out-of-the-box” fashion; the affinity matrix which allows for relaxing the objective to ii) proceeding with the output of other multi-graph matching a convex function and a concave one respectively. We set the methods to improve the solution. increment step δ = 0.2 for the path-following algorithm, and For the first aspect, our framework not only leverages the the iteration count in the Modified Frank-Wolfe method as 5. pairwise matching solver to compute the putative matchings Ontheotherhand,thefollowingpeermulti-graphmatching in the first stage for initialization and consistency estimation, methods are evaluated and compared with our methods: but also reuses the solver during the iterative alternating Graduated assignment based common labeling (GACL) optimization. In this second stage, the affinity matrix is re- GACL [48], [31] is a more recent work that extends the newed, containing the global information beyond two graphs. graduated assignment method to solve the multi-graph match- In contrast, the peer methods MHCL/SYNC use the pairwise ing problem, by matching all graph nodes to a virtual node matching technique in one-shot: only for the purpose of set. It continuously updates the set of probabilities for the obtainingtheinitialpairwisematchingconfiguration,whilethe mapping between the nodes in each graph to the virtual node post-procedure is immune from any pairwise matching solver. set by optimizing the objective function until converge. The Fortheabovereason,inthefollowingplotswhenourmethods final solution is consistent and discrete. Here we use the are tested, we use the naming convention “X-Y” to term the exponentialobjectivefunctionasthesameformwithours,but different pairwise matching solvers used in two stages. While inverseaffinitytocostKgacl =max(Kours)−Kours element- the compared other multi-graph matching methods are set to wise, as GACL concerns with minimizing the cost function. always use the first stage solver as termed by “X”. We set the parameter in GACL (refer to the original paper) For the second aspect, the proposed framework can either β = .5, β = 20, α = 1.1 for the annealing outer loop use the proposed reference graph driven mechanism, or reuse 0 max αβ → β ≤ β , and set the maximum iteration round any other multi-graph matching methods to generate an initial t t+1 max of the inner loop T =5 for cost efficiency. matching configuration X. As we will show later, these two in Modified hype-cube based common labeling (MHCL) approaches perform similarly in accuracy, while using the the original hypercube framework is used in [33], [46] while reference graph based initialization only involves one-shot specifically tested in the three-graph matching case, due to O(N3) times of multiplication of permutation matrix which exponential memory overhead. The algorithm has two main can be very fast, compared with the spectral analysis based steps: first, it performs a pairwise matching via existing method SYNC related to SVD computing with the complexity pair solvers and averages either discrete assignment solu- ofO(N2n3)andthetediousthree-layerloopingprocedurefor tions or probabilistic ones into an N-dimensional assign- GACLwhosetimecomplexitywouldbefurtherdiscussedlater ment hypercube, as an extension to the permutation matrix in this section. Moreover, SYNC/MHCL are both unable to for two graphs. Each element of the hypercube represents proceed their processing given the output of our algorithms, the matching probability for the tuple of N nodes from because they require the input solutions are inconsistent and N graphs respectively. Second, a post-binarization step is then transform the inconsistent solution to a consistent one. applied to to obtain the consistent common labeling. While To make the plots in the rest of the paper more digestible, the original hypercube data structure can only work with a themethodswiththeiracronymsarelistedforcross-reference. very small number of graphs, not scalable to large N due • PAIRThebaselinewhichperformsexhaustivePAIRwise to its memory space overhead is nN. Thus we modify the graph matching over the whole graph set. Note the original method to a more light-weighted one including the consistency over pairwise matchings is not guaranteed; following four steps: i) adopt a pairwise graph matching • AREF Abbreviated for Adaptive REFerence Graph Se- solver to obtain all possible pair assignment solutions X0 ; lection, which consists of three steps: i) perform exhaus- ij ii) re-calculate the assignment matrix X by averaging the tive pairwise matching; ii) select the most “consistent” ij indirect mapping X =(cid:80)N X X /N; iii) use Hungarian ij k=1 ik kj 4Therawconfigurationinducesafullyconnectedsupergraphforeachnode method to binarize X ; iv) use the SYNC method (when ij isagraph,andtheedgeisthepairwisematchingscore.AMaximumSpanning N >n)orMaximumSpanningTree(MST)[62]overtheraw Tree(MST)canbefoundwhichspansanewconsistentconfiguration[47]. JUNCHIYANETAL.CONSISTENCY-DRIVENALTERNATINGOPTIMIZATIONFORMULTI-GRAPHMATCHING:AUNIFIEDAPPROACH 10 graph as the reference G according to the metric of then the cost of setting the reference graph and updating r graph-wise consistency; iii) use its pairwise matching order is O(N3n3) where O(n3) refers to the permutation solutionsX withothergraphstospanthenewpairwise matrix multiplication that in fact can be signification speeded rk matching solutions by X =XTX ; up at the code level typically in a linear time w.r.t. n. In ij ri rj • FREF Abbreviated for Fixed (random) REFerence each iteration, as shown in formula (7), it adds up N − 2 Graph Selection, which replaces the first two steps of indirect pairwise affinities in addition with the direct affinity AREF by randomly selecting a reference graph while objective. Building this whole objective function as the input keeping the third step the same. It is very efficient since to RRWM costs O(Nn4) per iteration. The whole overhead onlyalinearnumberofpairwisematchingsareperformed is N(τ +O(Nn4))+O(N3n3)+N2τ as our method rrwm rrwm w.r.t. the number of graphs N; stopswhenallassignmentmatrixareupdatedforonetime,i.e. • GACL Abbreviated for Graduated Assignment based afterN−1roundofiterations.Thetimecomplexityestimation Common Labeling as proposed in [31], [48]; for applying other pairwise graph matching solvers including • SYNC Abbreviated for SYNChronization in [32]; IPFP/GAGM can also be derived in a similar manner. • MHCL Abbreviated for Modified Hype-Cube based We further study the time complexity of other peer multi- Common Labeling, which is introduced earlier in this graph matching methods. i) SYNC: it involves a one-shot paper as an modified version of [33], [46] to handle the SVD to find the n leading eigenvectors on the grouped memory bottleneck when more graphs are involved; assignment matrix of size nN × nN, whose complexity is • FREF+/GACL+/SYNC+/MHCL+ Perform Alg.1/2 us- O(N2n3), and N iterations of Hungarian method with cost ing FREF/GACL/SYNC/MHCL’s output as initial input. O(Nτ ) = O(Nn3). Thus the total cost is τ = Hun sync ThedifferencetoAlg.1/2issettingX∗ instep(8)asthe O(N2n3)+N2τ ; ii) MHCL: it performs the Hungarian kr rrwm solutions from other methods instead of pairwise match- method to binarize each matrix which is averaged by the pu- ings.All“plus-sign”casesalsousetheconsistency-driven tative assignment matrices from N(N−1) pairwise matchings. 2 method to set the reference graph and updating order, ThecostisO(N2n3)+O(N3n3),wherethefirsttermiscon- and this can be done in a free-rider fashion since other cernedwiththeHungarianmethod,andthesecondisrelatedto methods also require computing pairwise matchings. It the averaging step involving N3 times of permutation matrix is worth noting that FREF+ in fact corresponds to the multiplication, which can usually be optimized to O(N3n) at method in our conference version [1] since either the thecodelevel.ThenSYNCisperformedtoobtainconsistency. reference graph or the updating order is randomly set; Thus its time complexity is O(N3n3)+N2τ ; iii) GACL: rrwm • ALG12 One of our two methods, being Alg.1 when non- accordingtotheanalysisbytheauthorsin[31],itscomplexity factorized graph matching solvers are adopted including is O(N2m2)+τ per iteration which is further surrounded Sh RRWM/IPFP/GAGM, or Alg.2 when factorized solvers by two layers of loops. Specifically, the outer loop concerns are used like FGM. Note our method in fact can also be a continuation method which gradually increases the control termedasAREF+basedontheabovenamingconvention. parameter β. The inner loop concerns iteratively updating the This is because the result of AREF in fact initialize both assignmentmatrixtowardsthevirtualnodesetbygivenafixed Alg.1andAlg.2instep(8).Forthisreason,intherelated β.ThusthetotalcomplexityisT O(N2m2)whereT isthe ga ga plots, AREF and ALG1 are in the same red color; total number of iterations over two layers of loops, which in 2 • ALG12* same as ALG12, but does not enforce the score- fact is significantly larger than N or n. non-descending path selection strategy. Factorized multi-graph matchingDuetocurrentlyweare unable to identify any other factorized multi-graph matching method to our best knowledge, thus we only present the D. Time complexity analysis result for our method. Specifically, Besides the step for initial Since the existing multi-graph matching methods SYNC pairwisematching,referencegraphandupdatingordersetting, [32], MHCL [33], [46] start with the pairwise matching Alg.2 further involves i) factorizing the N(N − 1) pairs solutions,andourmethodsalsousepairwisematchingsolvers of graphs that involves SVD decomposition at the cost of for initialization and optimization. Thus we will consider O((n+m)3) per each; and ii) using the MFW method used a specific pairwise matching solver and estimate the time in each iteration that includes calculating the gradient of the complexity when applying it for the different methods. objective function ∇2 J at the cost of O((n+m)2) for Xur ij Non-factorized multi-graph matching Without loss of each pair (i,j), which is repeatedly performed over N −1 generality, we choose RRWM [15] as the pairwise matching terms (cid:80)N J + J in the objective function; iii) f=1,(cid:54)=r,u fu ru solver, and study the overall time complexity when applying performing the Hungarian method at the cost of O(n3) to it in our non-factorized method for Alg.1. RRWM involves obtaintheoptimallinesearchdirectionYgiventhecalculated an iterative procedure, in each iteration, the power iteration gradient ∇2 J; iv) the step-size search given the optimal Xur method [63] and Sinkhorn method [64] are employed. The searchdirectionthatisatthesamecostofcomputinggradient. costoftheformerisO(m2)andthelatter,whichisdenotedas Thus the total complexity is O(N2(n+m)3)+T O(N(n+ fw τ = O(n2) largely depends on the convergence speed, thus m)2 +n3)+N3n3 +N2τ where T is the number of Sh rrwm fw wehaveτ =T (O(m2)+τ )whereT referstothe iterations for the MFW method. rrwm rrwm Sh rrwm number of iteration rounds. For our method, first RRWM is Table III summarizes the time complexity by the general performed on each pair of graphs whose cost is O(N2τ ), theoreticalanalysis.Ingeneral,Alg.1wouldberelativelymore rrwm

See more

The list of books you might like