loading

Logout succeed

Logout succeed. See you again!

ebook img

Constitutive Notch Signaling Causes Abnormal Development of the Oviducts, Abnormal PDF

pages12 Pages
release year2016
file size2.92 MB
languageEnglish

Preview Constitutive Notch Signaling Causes Abnormal Development of the Oviducts, Abnormal

BIOLOGY OF REPRODUCTION (2016)94(3):67,1–12 Published online beforeprint 3February 2016. DOI 10.1095/biolreprod.115.134569 Constitutive Notch Signaling Causes Abnormal Development of the Oviducts, Abnormal Angiogenesis, and Cyst Formation in Mouse Female Reproductive Tract1 Lydia Ferguson,3 Elena M. Kaftanovskaya,3 Carmen Manresa,3 Agustin M. Barbara,3 Robert J. Poppiti,4,5 Yingchun Tan,3,6 and Alexander I. Agoulnik2,3,7 3Department of Human and Molecular Genetics, Herbert Wertheim College of Medicine, Florida International University, Miami, Florida 4Department of Pathology, Mount Sinai Medical Center, Miami Beach, Florida Do w 5Department of Pathology, Herbert Wertheim College of Medicine, Florida International University, Miami, Florida n lo 6Department of Gynecology, Shandong Qianfoshan Hospital, Shandong University, Jinan, China ad e 7Department of Obstetrics and Gynecology, Baylor College of Medicine, Houston, Texas d fro m ABSTRACT transmembrane receptor essential for local juxtacrine cell-to- h cellsignaling,andisfoundinamultitudeofcelllineages.The ttp ofTmheanNyottcihssusiegsnaalinndgpoartghawnasyiinsctrhiteicaelmfobrrytoh.edTioffesrteundtyiattiohne NceOlluTlCarHdifsfiegrneanltiinagtiopnaathnwdapyrolhifaesratbioeenn,apshoopwtonsist,oanddecteerllmfiantee s://ac consequences of Notch1 gain-of-function signaling on female in both adult and embryonic life. In particular, the heart, ad e reproductivetractdevelopment,weusedacre-loxPstrategyand prostate, kidney, mammary gland, and stem cell systems mD Amhr2-cre transgene to generate mice with conditionally ico activated Notch1 (RosaNotch1). The Amhr2-cre transgene is depend on NOTCH signaling, and defects in this pathway can .ouw leadtotumorgrowth[1].ThecrucialroleofNOTCHsignaling pn expressedinthemesenchymeofdevelopingfemalereproductive in the regulation of angiogenesis and vascularization was .colo tract and in granulosa cells in the ovary. Double transgenic ma Amhr2-cre, RosaNotch1 females were infertile, whereas control revealedinmousemodelsoftargeteddisruptionorconstitutive /bd opRrroogsaganrNesostsciihnn1gmmwiucitetahnhtaasgdes.nhooTrwhmeeadlmfhueetramtinloittryro.hvaAidglluincfgtesmodafildeblrnoeooptdroddveuevcsetslieovlpes sRibgpnTjahlgeineNgneOosTf[C2N–Ho7t]cr.ehc1e,pNtoortcbhin1d/Nsoatcmhe4m, Jbaragn1e,-Dbollu4n,dHliegya1n/2d,oannda iolreproded fro cmouillitnipgl,eanbdlowckeargeeisnsitneadthleoolpuemdeanroaulnodngthteheovaorvyi.duTchterelenwgetrhe, nuenidgehrbgooreisngtwoceslel.quAenftteiarltchleisavcaognetsabcty,AthDeANMOpTroCtHeasereacnepdtocr- /articlem w creating a barrier for sperm or oocyte passage. Mutant females secretase, thus releasing the active intracellular domain -aw bw demonstratedinflameduteriwithincreasedvascularizationand (NICD). The NICD then travels to the nucleus, where it s adneveinloflpuexdoofvairniaflna,momviadtuocrytalc,ealnlsd. uAtderdiintieoncyaslltys,. Tohldeesrignfeimficaalnest MintAerMacAtsLw1it(hMtahsetetrrmaninscdr-ilpiktieon1f)a,ctroerspRoBnsPiJbjleanfodrcoacatcitvivataitnogr tract/94.biolr change in gene expression was detected in the mutant oviduct downstreamtargets[8].Inmammals,thetwomaintargetgenes /3e expression of Wnt4, essential for female reproductive tract most commonly activated are Hes and Hey, which are key /67pr dperevveilooupsmlyenitn. SmimicielarwoitvhiduaccttaivlaptehdenoSmtyopesanhdavienbbeeenta-dceatteecntiend, tranInscaridpdtiiotinonfatoctoitrss.ownregulatorynetwork,NOTCHinteracts , 1-12od.o Wnt4, Wnt7a, and Dicer conditional knockouts, indicating a withthetransforminggrowthfactorbeta(TGFb)andtheWnt/ /24rg common regulatory pathway disrupted by these genetic abnor- b-catenin pathways [9]. The intersection of NOTCH and b- 34. malities. 4 catenin pathways has been well documented, particularly in 5 8 angiogenesis, female reproductive tract, infertility, Notch1, stemcelldifferentiation[10],embryonicvasculardevelopment b y oviduct [11], and cardiac progenitor cell differentiation [12]. The two g u signaling pathways undergo crosstalk at many different stages es INTRODUCTION of signaling, and direct interaction has been demonstrated by t o n the binding of unphosphorylated b-catenin directly to the 0 TheNOTCHsignalingpathwayishighlyconservedinmost 1 NICD [13]. Collision of the NOTCH signaling pathway and A multicellularorganismsand,inmammals,fourNOTCHgenes, p NOTCH1–4, have been identified. NOTCH is a type-1 tphaattteronfsiTnGaFnbumisbeerxopfedcteevde,logpimveenntathlepiarthmwiarryosreadndecxepllretysspieosn. ril 2 0 Coregulation of NOTCH and TGFb target genes has been 19 1Supported by the Herbert Wertheim College of Medicine, Florida frequently described: the NOTCH target gene Hes1 was InternationalUniversity. 2Correspondence: Alexander I. Agoulnik, Department of Human and upregulated by TGFb in keratinocytes [14]; such interactions MolecularGenetics,HerbertWertheimCollegeofMedicine,Miami,FL havealsobeendescribedinsmoothmusclecells[15,16]andT 33199.E-mail:[email protected] cells [17, 18]. ThedifferentiationoftheMu¨llerianductisinitiatedinmice atEmbryonicDay(E)11.5byinvaginationoftheepitheliumof Received:14August2015. Firstdecision:31August2015. the anterior mesonephros [19]. In females, an absence of Accepted:25January2016. testosterone leads to the regression and disintegration of the (cid:2)2016bytheSocietyfortheStudyofReproduction,Inc.Thisarticleis Wolffian duct beginning at E13.5 [20]. In the absence of available under a Creative Commons License 4.0 (Attribution-Non- Mu¨llerianinhibitingsubstance,theMu¨llerianductcontinuesto Commercial),asdescribedat http://creativecommons.org/licenses/by-nc/ differentiate, eventually forming the oviducts, uterus, cervix, 4.0 and upper region of the vagina by birth; however, further eISSN:1529-7268http://www.biolreprod.org ISSN:0006-3363 maturation of these tissues continues for several weeks. The 1 Article 67 FERGUSON ETAL. TABLE1. PCRprimersusedforgenotypingandqRT-PCR. Gene Forward Reverse Ccnd2 CTGTGCATTTACACCGACAAC CACTACCAGTTCCCACTCCAG Cdkn1a(P21) CAGATCCACAGCGATATCCA GGCACACTTTGCTCCTGTG Cdk6 GCCCTTACCTCGGTGGTC ACAGGGGTGGCATAGCTG Fn1 CGGAGAGAGTGCCCCTACTA CGATATTGGTGAATCGCAGA Gli1 CTGACTGTGCCCGAGAGTG CGCTGCTGCAAGAGGACT Hes1 ACACCGGACAAACCAAAGAC CGCCTCTTCTCCATGATAGG Myc CCTAGTGCTGCATGAGGAGA TCTTCCTCATCTTCTTGCTCTTC Ptch1 GGAAGGGGCAAAGCTACAGT TCCACCGTAAAGGAGGCTTA Smo GCAAGCTCGTGCTCTGGT GGGCATGTAGACAGCACACA Wnt4 CTGGACTCCCTCCCTGTCTT ATGCCCTTGTCACTGCAAA Wnt5a ACGCTTCGCTTGAATTCCT CCCGGGCTTAATATTCCAA Wnt7a CGCTGGGAGAGCGTACTG CGATAATCGCATAGGTGAAGG D o b-Actin CCCAACTTGATGTATGAAGG TTGTGTAAGGTAAGGTGTGC w n cre ATCAACGTTTTCTTTTCGG ATTTGCCTGCATTACCGGTC lo DNotch1 AAAGTCGCTCTGAGTTGTTAT CGGAACTTCTTGGTCTCCAG ad Notch1(NICD) GGACATGCAGAACAACAAGG CAGTCTCATAGCTGCCCTCA ed Gapdh AACGACCCCTTCATTGAC TCCACGACATACTCAGCAC fro m h ttp s oviductsdevelopfromthecranialregionoftheMu¨llerianduct, Carolina,ChapelHill,supportedbyNIH.ThemicehaveIRES-Cre-pAFRT- ://a with coiling completed by E15 [21]; however, at birth, no flankedPgk-neo-bpAcassetteintroducedintoexon5oftheAmhr2locus,and c a morphological differences in the oviductal epithelial cells are t[h3u2s].trAamnshgre2n-iccreCrmeaelexpmreiscseionwefraeithcfruolslysedrepwroitdhucReossAaNmohtcrh21 gfeemnealeexpmreicsesioton demD apparent. The first ciliary cells are visible from 5 days after generate Amhr2-cre, RosaNotch1 females and RosaNotch1 female littermates, ico birth, and secretory cells are mature by Day 23 [22]. The whichwereusedascontrols. .ouw doiffftehreenteixatpiroenssoifontheoMf u¨mllaenryiangdeuncets.reTquhieresWanptrefacmiseilyintgerepnleasy, PCR Genotyping p.comnloa specifically, Wnt4 and Wnt7a, expressed in the mesenchyme /bd asenxd-seppeitchifeilciudmev[e2l3o]pmareenitmopfotrhtaenMt fuo¨lrletrhieanindituiaclt.foLrimm1atieoxnpraensd- bplroootGodceoanlno.dmMitciiscDseuNewAkeriwtea(gQseienaxogtteryanpc,eteVddauflersoninmcgiam,porCiumAsee)rtsaicssscpuoeercdsiiufnisgcintfgoortthhceerQemiaaangndeunfaaDccttNiuvreaeatres’yds iolreproed fr sioninitiatesintheMu¨llerian ductepithelium,butlaterrefines do Notch1transgene(DNotch1)(Table1). /am dtcooefnittnrhiinbegutpitorhneecsuarnfsrtooemrrioart-nhpdeostdHeirofiofmerreeoanxbtioisaxtAoinfgt(hHeoovxdiaed)vuecfltaomp[iin2lyg4],rgeepanrneods- Histology and Immunohistochemistry rticle-a ww bw dDcreruiicccteietcpirvatole[r2[-1t8dr9,ar]ic2v.t9e,Cn]oownrCdirrtieehtitoirAnneomacilochmdr2eablc-eicintdriaeos,sneisagn[no2daf5lWic]n,ongnbtd7-aciantaidowteninEathilmnpaxc[r22ot,i6gv,eaasrt2eitoe7rn]aolnsoooefr tPainsBsdSuFeeoasmnrwdbeeaesdcrtehdoerfaedixgdeeiindngirp7noa0urB%apof,fuieanitnhmaasinnonodliumltsaiueotmcn4ti8oooCnvfeetodrhvnreieagretnh6iatg,nhtoihmtr.eanT7lshwlewamtsaih.ssseSaudlneitadshleyrwezseeeerdceti.tmipEorenxosstcrieanwscste1eer3dde stract/94/3.biolre deparaffinized,rehydratedingradedethanol,andstainedwithhematoxylinand /6p t[h3e0]siaglnlalledtratonsadudceevreslompomoethnetnoefdugnecnoei,leSdmoov,iwduitchtsAimnhmr2u-tcarnet eDoisaignno(Hst&icsE,)A. Stleacnttiao,nGsAw)ebreefdoerehymdorautnetdinignweitthhanaocloavnedrslHipi.stoclear (National 7, 1-1rod. females. Immunohistochemistry(IHC)wasperformedonmouseorgansfixedin4% 2o In this study, we generated a mouse model with condition- paraformaldehyde,washedwithPBS,treatedwithserialdilutionsofethanol, /24rg ally activated NOTCH signaling in the Mu¨llerian duct to epmerbfoerdmdeedd iunsinpgaratfhfien,aanntid-NsOecTtCioHne1daunstiinbgodystan(1d:a4r0d0,praobto2c7o5l2s.6;IHACbcwamas, 3445. determine its impact on the development of the female Cambridge, MA) recognizing the C-terminal part of the protein. Protein 8 b reproductive tract and fertility. Analysis of mutant females detection was performed using a Vectastain ABC kit (Vector Laboratories, y showedthattheactivationoftheNOTCH1pathwayresultedin Burlingame, CA) as recommended. The color was developed with diamino- gu e their infertility associated with the abnormal development of benzidine as chromogen. Samples were counterstained with Harris hematox- s the oviducts, inflamed uterus, and increased vascularization ylin.StainedslideswereexaminedwithaCarlZeissAxioA1Microscopeand t on aOnlddehremfeomrrahlaegsingdeovfelbolpoeodd vuetsesreilnseinvethine rtehprroomdubcotisvise,traanctd. iMmiacgroesscowpeyr,eLLcaCp,tuTrhedornbwyooadn,NAYxi)o.Cam MRc5 CCD camera (Carl Zeiss 01 A Theproliferationofthesomaticcellsinmutantandwild-typePostnatalDay p oviductal, ovarian and uterine cysts. (P) 100 oviducts was analyzed using rabbit polyclonal to Ki67 (1:1000; ril 2 ThermoScientific,FairLawn,NJ).ThepercentageofKi67-positivecellswas 0 1 MATERIALS AND METHODS evaluatedinatleast500cellsindifferentpartsoftheoviductsin3femalesper 9 group,andtheaveragenumberswerecomparedusingStudentt-test. Mouse Strains and Breeding Thenumberofendometrialglandswasanalyzedinuterinesagittalsections isolated from four P100 Amhr2-cre, RosaNotch1 females and four RosaNotch1 Thisstudywascarriedoutinstrictaccordancewiththerecommendationsin femalelittermates.Atotalof20randomviewsat320magnificationwasused the Guide for the Care and Use of Laboratory Animals of the National forcountingineachsample,andtheaveragenumberofglandsperviewwas Institutes of Health (NIH). The protocol was approved by the Institutional usedfortheStudentt-testanalysis. Animal Care and Use Committee of Florida International University. Gt (ROSA)26Sortm1(Notch1)Dam/J(RosaNotch1)micewereobtainedfromtheJackson RNA Isolation and Real-Time Quantitative RT-PCR Laboratory(BarHarbor,ME).RosaNotch1micecontainasequenceencodingan intracellular portion of the mouse Notch1 gene, but lacking the C-terminal Total RNA was extracted from tissue samples with a Trizol reagent PEST domain, inserted into the GT (ROSA)26Sor locus. Expression of the (Ambion,Austin,TX).Afteradditionofchloroformandcentrifugation,thetop Notch1fragmentisblockedbyaloxP-flankedSTOPfragment.Thetruncated aqueouslayercontainingtheRNAwasremovedandaddedtoanequalvolume cytoplasmic fragment encoded by the Notch1 sequence causes constitutive ofisopropanol,mixedbyinversion,andincubatedatroomtemperaturefor10 signalingactivity[31].Amhr2tm3(cre)Bhr(Amhr2-cre)micewereobtainedfrom min.SampleswerethentransferredtoanRNeasyspincolumn(QiagenRNeasy the Mutant Mouse Regional Resource Center at the University of North Kit) and centrifuged for 15 sec at 10000 rpm before resuming the Qiagen 2 Article 67 NOTCH OVERACTIVATION INFEMALE REPRODUCTIVE TRACT D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do FIG.1. Activation of Notch transgene inAmhr2-cre,RosaNotch1 femalescauses abnormalreproductive tractvascularization and absenceofoviduct /am ccferomeilaitnrlaegns..sAgNe)onAercetacivnoadmteGbdianapaldlteiholenpDrwimNasoedrtscehtde1ecrwtievadesdinpfrraeonsmeynoatfistnihnetghlteeissoeuxveoisdnufrcaotsm(aORcdoo)s,nautNrtooetlrcuhfo1srf(eUDmtN)a,Alaensq.duCaorlevit-aysr.pyBe(c)OiIfn)i,ccbrpeuraitmsneeodrtsviawnsecthrueelauhrsieezadarttitoo(Hnc)oongffefienrmmomaplirecesrDeepnNrcoAedoouffcttthihveeeAmomrughtaarn2ns-t rticle-ab www (arrowheads)andinflameduteriinP100virginmutants.Uncoiledoviduct(Od;dashedlinearea)circlesaroundtheovary(Ov)inmutant. stra.b RNeasykitprotocolfromthestepatwhichbufferRW1isadded.Qualityand females,whereasnosuchbandwasdetectedinmutantheartor ct/94/3iolre concentration of RNA was analyzed with a Nanovue (GE Healthcare inanyofthesiblingRosaNotch1controlmousetissues(Fig.1A). /6p 7r BwPMCiaaosRdscissiy(eoqnnnPtc,hCeesRWs,i)zPIe)iwdttaasubsnsudiprngegghrfe,aonrPeVmA-see)prd,seocturiefscaiiDcntegNdpAGrfiomokrTietDarsq(NTaihqnsePerCmacRooRnSMteacamailesPintneltearifxtii2cMo)n.iM,xQaau(nsPadtenrortccimtDyaectNiglveAaer, TRlehoaesdarienNfgootcrtheo1,aainnlletahlceetiwvparaetsisosenunccocefeosNsffouAtlcmhinhrtfr2ea-mncsragele,enrreeec.pormodbuinctaitvioenorogfatnhse, , 1-12/24od.org (Eppendorf, Westbury, NY) according to the manufacturers’ instructions. Amhr2-cre, RosaNotch1 female mice (n ¼ 12) were mated 34. 4 ThreedilutionsofRNAwereusedasstandards,andvalueswerenormalizedto with wild-type males of proven fertility for 3 mo, but failed to 58 bcsoo-afmtcwptiaanrr.eatTi(vGheerCaprteh(l2Pa–atiDdvDeCSto)fofmtlwdeathrceohdaI.nngRce.e,sLiunlatsmJwoRlelNrae,AaCnAlael)vyezfleodrwusatssainticgsatiGlccaruallpashtiegPdnaidfbiPycarintshcmee fpermodaulecseshanoyweodffnsoprrminagl.feTrthieliitry,laitstedrmesactreibecdonptrreovlioRuosslyaN[o3tc1h]1. by gue usingStudentt-test.ThesequencesoftheprimersareshowninTable1. Docicssuercretinocne ooffvfaivgeinaPl1p0l0ugmsuretavnetalefedmthalaetsno1n0edoafytsheaffteemratlhees st on RESULTS waspregnant.Therewerenoimplantationsites,andtheiruteri 01 appeared to be enlarged, highly vascularized, and dark purple A p Amhr2-cre, RosaNotch1 Females Are Infertile in color. In five control female mice, multiple implantation ril 2 sites were identified 10 days after vaginal plug detection. 0 Transgenic mice with NOTCH1 gain of function in the 1 9 stromalandmusclecellsofthefemalereproductivetractandin Analysisoffivevirginmutantfemalesofthesameagerevealed the gonads were generated by using a cre-loxP strategy. that the uterus enlargement and excessive vascularization was Transgenic Amhr2-cre mice express Cre recombinase in alsopresent,andthuswasindependentofcopulation(Fig.1B). granulosa cells in ovary and in the developing (from E12.5) Abnormal vascularization in reproductive organs was detected and adult female reproductive tract in endometrial stromal even in newborn females (Fig. 2B). The most remarkable cells,aswellasinmyometrium,butnotinluminalorglandular featureinthefemalereproductivetractwastheanatomyofthe epithelium [26, 30, 32–34]. In diheterozygous Amhr2-cre, mutantoviducts.Normalmouseoviductwaspresentincontrol RosaNotch1 transgenic females, the Cre-driven recombination RosaNotch1 females as a complex, coiled, tubal structure with betweentwoloxPlociledtotheexcisionoftheSTOPcassette several longitudinal folds (Figs. 1B and 2A). The mutant andthusactivationoftheNotch1transgene.ThePCRanalysis oviducts did not develop coils, and had instead encircled the confirmed the presence of a 650 bp PCR amplicon derived ovary; they were shorter and thicker than normal. As in the fromtheactivatedRosaNotch1transgeneinDNAextractedfrom uterus, hemorrhaging blood vessels were clearly visible in uterus,ovary,andoviductof27-day-oldAmhr2-cre,RosaNotch1 mutant females (Figs. 1B and 2A). 3 Article 67 FERGUSON ETAL. D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do /am rticle w -aw bw s tra.b ct/94iolr /3e /6p 7r FIG.2. UncoiledoviductsinAmhr2-cre,RosaNotch1mutantfemales.A)Controlandmutantoviducts(Od;dashedlinedarea)atP2,P27,andP100.In , 1-12od.o controlRosaNotch1females,theoviductformscoilsandislocatedbetweentheovary(Ov)anduterus(Ut).Mutantoviductcirclesaroundtheovary.Notean /24rg excessivevascularizationwithhemorrhagingbloodvessels(arrowheads).B)AbnormaldevelopmentoftheisthmusanduterotubaljunctioninAmhr2-cre, 34. RosaNotch1mutantoviducts.Histologicalsectionsofwild-typeandmutantuterotubaljunctionsatdifferentages.Inthetoppanel,theP27oviductsare 45 8 markedwithadashedline.Mutantisthmusopensdirectlytotheuterinelumen(areamarkedwitharectangle).Thereisaprogressiveoutgrowthofthe b mutant longitudinal folds (dashed line in second to fourth rows) leading to constrictions (Co) of the lumen and the formation of cysts (C). Inf, y g infundibulum;Od,oviduct;Ov,ovary;Uo,uterotubaljunction.Noteanexcessivevascularizationwithhemorrhagingbloodvessels(arrowheads).Bars¼1 u e mm(A),500lm(first,third,andfourthrowsinB),and200lm(secondrowinB). s t o n 0 In order to determine the cause of the observed female Abnormal Oviduct Development in Female Mice with 1 A infertility, four mutant females were separated from the male p following identification of a plug, and then dissected after 4 Constitutive Activation of NOTCH1 Signaling ril 2 days. In all four females, the reproductive tract appeared Groups of three Amhr2-cre, RosaNotch1 and control 01 9 enlarged, highly vascularized, but anatomically well devel- RosaNotch1 female littermates were dissected at different time oped, except for the uncoiled oviduct. The oviducts from the points after birth to determine the impact of Notch1 activation females were dissected and then attempted to be flushed to on the reproductive tract condition (Fig. 2). At all ages in the release any trapped blastocysts. However, these efforts failed mutants, prominent hemorrhage of the blood vessels was due to apparentblockage of theoviduct lumen preventing free detectedalongthereproductivetract.Eveninneonatalfemales, flowoftheinjectedmedia.Thus,theobservedinfertilitymight leaking blood vesselswereclearlyvisible. Most strikingly,the be, at least in part, the result of either the blockage of sperm mutant oviducts did not develop normal coils as seen in the transportintotheoviductfromtheuterusorofoocytesfromthe wildtype,andwereinsteadloopedaroundtheovary,encircling ovary. it(Fig.2A).Thehistologicalanalysisoftheoviductsincontrol and mutant animals revealed further abnormalities (Fig. 2B). Despite the aberrant formation of the oviduct, the three major structuresoftheoviduct(infundibulum,ampulla, andisthmus) could be identified in the mutants (Fig. 2B). The uterotubal 4 Article 67 NOTCH OVERACTIVATION INFEMALE REPRODUCTIVE TRACT D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do /am rticle w -aw bw s tra.b ct/94iolr /3e /6p 7r , 1-1od. 2o /2r 4g 34. 4 5 8 b y g u e s t o n 0 1 A p ril 2 0 1 9 FIG.3. HistologicalanalysisofmutantoviductsatDays100and200.A–C)ControlandmutantoviductsatP100andP200.Theinfundibulum(Inf)and theampullaarepresentinmutantoviducts.B)Bendingofmutantoviductformsconstrictions(Co;arrows)intheoviductlumen.Hemorrhageisshown withthearrowheads(BandC).MutantP200ovaryhasalargeovariancyst(OvC)(C).DandE)Progressivedisorganizationofciliatedandsecretory epithelialcells(arrowheads)inthemutantampulla.Alargenumberofcellularvacuoles(arrows)andthelossofciliaonepithelialcellscanbeseenin P200 mutants (F). NOTCH1 immunostaining in control (G and J) and mutant P100 (H and K) and P200 (I and L) oviducts. Arrows show nuclear localizationofNOTCH1instromalcellsofthemutantoviducts(H,J,andL).ArrowheadsinG–LshowoviductalepitheliumandendothelialNOTCH1 staining.Bars¼500lm(A–C),25lm(D–F),50lm(G–L).Ut,uterus. 5 Article 67 FERGUSON ETAL. oviducts in mesenchymal cells, and nuclear staining was present in both stromal and epithelial cells (Fig. 3, G–L), as well as in the endothelial cells of blood vessels of normal oviductsandinhemorrhagingbloodvesselsinmutants(Fig.3, G–L). The histological appearance suggested an overgrowth of cells in mutant oviduct (Fig. 4). The Ki67 staining in mutant oviducts was mainly present in dense cell areas within the stroma. Comparisons of cell proliferation using Ki67 antibody revealed a significant increase (P¼0.0015) of Ki67-positive stromal cells in P100 mutant oviducts (Fig. 4). Mutant Females Develop Uterine and Ovarian Cysts and D o Vascular Thrombosis w n lo In younger animals, the mutant uteri, ovaries, and vagina a d were of normal size; however, even newborn mutants ed displayed disorganized vascularization of all reproductive fro organs, with extensive collapsed and leaky blood vessels m h causing pronounced hemorrhage. In younger mutant females, ttp tthheatoovfecraolnltraonlatfoemmiaclaels.uTtehreinneusmtrbuecrtuoref ewnadsomcoemtripaalragblalendwsitihn s://ac a theuteriwascomparablebetweenthetwogroupsatP100(48.3 d e 63.6endometrialglandsperviewinwildtypeand39.567.2 mD inmutants;P¼0.32).Inolderfemales(P200),normalstructure ic.oow u of the myometrium and endometrium was progressively pn affected by an increased number of vascular abnormalities .colo ma (Fig. 5). There was no NOTCH1 expression detected in /bd endometrial glandular epithelium, but strong staining was ioe present in the endothelial cells of blood vessels in normal lrepd females and in dilated blood vessels of mutants (Fig. 5, C–F). rodfro In mutant females, the ovarian histology revealed normal /am developmentinP2,P27,andP100animals,withfolliclesatall rticle w developmental stages and corpora lutea (Fig. 6). Increased -aw vascularization and dilated blood vessels were detected in all bsw mutant ovaries. In 8-mo-old mutant females the ovary often tra.b had cysts. ct/94iolr Analysisofthereproductivetractof27-,100-,and200-day- /3e old females revealed the presence of uterine and ovarian cysts /67pr FfeIGm.al4e.s.CInocnrteraosle(dAsatnrodmCa)lacnedllApmrohlirf2e-rcarteio,nRoinsamNoutctah1ntmouvtiadnutc(tBinanPd10D0) iufnetmerooalldteuebrmaalicnjeiumnaacnltdsio.nfTivhaereewamiloodfs-tttyhfpreeequcuteoernnuttsrlyo(lFsaifwgfe.ecr2teeBda).gaeFrdeivateowm1as-uytatehnaert , 1-12/24od.org oviducts(Od)stainedwithKi67.Arrowheadsshowstromalareasusedto and killed. All mutant females exhibited abnormal uterine 34. 4 count the positive cells. C) The difference between control (n¼3) and morphology; three females also had ovarian cysts (Fig. 7A). 58 mutant (n¼3) in Ki67-positive stromal cells is significant (P , 0.01). Gross anatomy of the reproductive tract appeared abnormal, b Columnsrepresentthemean6SEM(n¼3foreachgenotype).Ov,ovary. with large uterine growths, uncoiled oviducts, and ovaries that y g Bars¼500lm(AandB)and20lm(CandD). were dark purple in color. ues H&E staining of a uterine swelling revealed banded t o n junction in wild-type mice is a small opening of the oviduct staining, characteristic of an acute thrombus (Fig. 7B), but no 0 1 into the uterine horn; in mutants, this simple connection was evidence of a hemangioma. Other cysts were filled with cells. A p suetevreursely(Fdigis.o2rgBa)n.iSzeedctiaonndsthoef itshtehmovuisdoupctesnefrdomdirePc1t0ly0inmtoutathnet S1tianindiincagtewditthhaatntthibeoudtieersinfeorgrsomwotohthwmasunscoltedaecrtiivnedanfdrocmaveeiothlienr ril 20 1 females showed that the oviduct was bent in several places smoothmuscleorendothelialcells(datanotshown);however, 9 alongitslength(Fig.3).Attheseparts,theoviductlumenwas these cells showed a strong staining for NOTCH1 (Fig. 7Bd). often blocked due to the overgrowth of oviduct longitudinal folds(Fig.3B).Theregularmuscularislayerthatwasvisiblein Activation of Notch1 Causes Up-Regulation of Wnt4 normaloviductwasalsogrosslyrearrangedinmutantfemales. The WNT family ligands, WNT4, WNT5A, and WNT7A, With age, fragmentation of the oviduct tubule progressed, and are expressed in the female reproductive organs and play a in P200 females we observed oviducts consisting entirely of prominent role in their differentiation. The expression of these small cysts (Fig. 3C). While both ciliated and secretory genes was measured by quantitative RT-PCR (qRT-PCR) in epithelial cells were present in mutant oviducts, their normal theuteri,oviducts(Fig.8),andovaries(datanotshown)in27- structurewasprogressivelydisorganizedinolderfemales,with day-old Amhr2-cre, RosaNotch1 mice, and compared to the a large number of cellular vacuoles in secretory cells and a littermate controls. The most dramatic change was detected in decrease in the number of cilia on the ciliary cells (Fig. 3F). the expression of Wnt4, which was significantly higher (P , NOTCH1expressiondetectedbyIHCwasincreasedinmutant 0.05) in the mutant oviducts (Fig. 8). There was about a 50% 6 Article 67 NOTCH OVERACTIVATION INFEMALE REPRODUCTIVE TRACT D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do /am rticle w -aw bw s tra.b ct/94iolr /3e /6p 7r , 1-1od. 2o /2r 4g 34. 4 5 8 b y FIG.5. Increasedvascularizationandhemorrhagingbloodvessels(arrowheads)intheP100Amhr2-cre,RosaNotch1mutantuterus.Controluterusshows gu e normalstructureoftheuterus(A,C,andE).Themutantmyometriumisseverelydisorganized,buttheendometrialglands(Eg)arenormallydevelopedin s mutants(B,D,andF).TheinsetsinCandDshowtheabsenceofNOTCH1expressioninglandularepithelium.NOTCH1expressioninendothelialcells t o n ofnormalbloodvesselsincontrol(E)andinhemorrhagingbloodvesselsinmutant(F)isindicatedbyarrowheads.Bars¼are200lm(AandB)and50lm 0 (C–F). 1 A p ril 2 increase in Notch1 expression in mutant oviduct; however, it split-1)weresignificantlyalteredinthemutants,althoughboth 0 1 was not statistically significant. No difference was detected in showed a trend of higher expression levels in the mutant 9 the expression of Notch1 in mutant uteri. oviduct. No change was detected in Myc, Gli1, and Ptch1 The expression of Wnt5a and Wnt7a was unchanged in between the mutant and control oviducts. P21 (Cdkn1a) is mutant mice compared to sibling controls. The expression of another downstream target of Notch1, and its expression was cyclinD2,(Ccnd2),apositiveregulatorofG1progression,was unaltered in the mutant oviducts, as was also the case with cyclin-dependent kinase 6 (Cdk6) (Fig. 8). slightly lower (P , 0.05) in the mutant oviducts compared to the littermate controls (Fig. 8). Transcriptional targets in the hedgehog signaling pathway were also measured, as crosstalk DISCUSSION betweenpathwayshasbeenpreviouslynotedandtheactivation We investigated the effect of conditional activation of of Smo (Smoothened) in female reproductive tract caused Notch1 signaling on the development of the female uncoiled oviducts [30]. Smo was unchanged between mutant reproductive tract by generating Amhr2-cre, RosaNotch1 and control in oviduct and uterus. Neither fibronectin nor the females. These mice express the NOTCH1 intracellular downstream target of NOTCH1, Hes1 (hairy and enhancer of domain in ovarian granulosa cells, in the mesenchyme of 7 Article 67 FERGUSON ETAL. D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do /am rticle w -aw bw s tra.b ct/94iolr /3e /6p 7r , 1-1od. 2o /2r 4g 34. 4 5 8 b y g u e s t o n 0 1 A p ril 2 0 1 9 FIG.6. DevelopmentofovariancystsinAmhr2-cre,RosaNotch1mutantfemales.Shownarecontrolandmutantovariesofdifferentages.NotethatP3and P27mutantovariescontainanormalnumberofantralfollicles(F)atdifferentstagesofdifferentiation.Corporalutea(Cl)arealsopresentinmutants.Large ovariancyst(markedwith*)ispresentin8-mo-old(8M)mutantovary.Bars¼100lmforP3and500lmforP27,P100,and8M. the developing Mu¨llerian duct, and then in the oviduct and and uncoiled. Our results revealed that the induction of uterine stromal cells. Analysis of females revealed a number Notch1 signaling results in the upregulation of Wnt4 in the of anatomical and histological abnormalities in the reproduc- oviducts of the mutant females, indicating crosstalk between tive tracts. The most noticeable change was in the formation the NOTCH and WNT pathways. We also observed a of the oviducts, which lacked the coiling normally seen in decrease in the cell cycle checkpoint regulator Ccnd2 in the wild-type females, and were instead looped around the ovary oviducts of young mutant females, but an increase of Ki67- 8 Article 67 NOTCH OVERACTIVATION INFEMALE REPRODUCTIVE TRACT D o w n lo a d e d fro m h ttp s ://a c a d e mD ico .ow u pn .colo ma /bd ioe lred p rofr do /am rticle w -aw bw s tra.b ct/94iolr /3e /6p FcyIGst.i7n.b.UBt)erVinareiocuysstustienriAnmehcyr2st-scr(em,aRrokseadNwotcihth1m*)uwtainthtfceemlladleesb.rAis)(Ua)t,ereionsein(UoptChiilnicas)eacnredtioovnar(iba)n,o(OrdvCenisnebc)ecllysgtrsoiwntmhu(cta)nwteferemiadleens.tiHfieCd,.h(edm)NorOrhTaCgHin1g 7, 1-1rod. expressionwasdetectedinthecellswithinthecystshowninc.Bars¼200lm(a–c),20lm(insetinb),and50lm(d). 2/2or 4g 34. 4 positive stromal cells in older mutant oviducts, suggesting development of the embryos. The latter could be further 5 8 higher cell proliferation rates. analyzed by embryo transfer accompanied by the analysis of b y Conditional activationof theNotch1pathwayin thefemale steroid production in mutant females. g u reproductivetractresultedininfertility,andexaminationofthe The role of Notch1 expression in the uterus has been found e s uterus revealed an acute inflammatory response in the uterine to be critical for completion of decidualization. Reduction in t o n horns of both virgin females and females mated with males, Notch1expressioninfemaleswithafloxedNotch1alleleanda 0 1 with no evidence of embryos or implantation sites. In aged cre transgene driven by a progesterone receptor (Pgr-cre) A mlarugteantutfeerminaelesth,rwoemobbosseersv,ehdeemnolarrrgheadgirnegprobdlouocdtivveetsrsaecltss,waintdh wcahuiscehd aareredkuncotiwonnintoexrpergeuslsaitoen sotfroWmnatl4daencdidBumalpiz2a,tiboont.h Ionf pril 2 0 ovarian cysts. The infertile phenotype seen in the Amhr2-cre, addition, many G1/S cell cycle checkpoint genes were 19 RosaNotch1 females appear to be primarily a result of the deregulated, and a number of proapoptotic factors increased abnormal oviduct development, although abnormal ovulation [35]. Pgr-cre is expressed in all postnatal uterine cells in and uterine decidualization might also contribute to infertility. contrast to Amhr2-cre, which is absent from uterine epithelial The malformed structure of the oviduct appears to restrict the cells and active only in uterine stroma cells [26, 36]. Notably, sperm or oocyte movement, or, if fertilization does occur, the no implantation sites were found in the uterus of the mutant migration of embryos to the uterus for implantation. The females in our experiments. Moreover, we observed uterine presenceofnormalfolliclesandcorporalutea,atleastinyoung enlargement, characteristic of inflammation even in virgin females,indicatesthattheovaryisfunctional,althoughamore females. This leads us to suggest that the decidualization detailed analysis of the functions of granulosa cells where process is sensitive to expression levels of Notch1. Amhr2-creisexpressed[33]willbeneeded.Thissuggeststhat The extensive disorganized vasculature and hemorrhage the primary cause of infertility appears to be mechanical and leading to thrombosis in mutant females indicates that the priortotheimplantationstage.Itisnotclear,however,whether activation of NOTCH1 in stromal endometrial cells or in the mutant uterus is able to support implantation and myometriumcellswhereAmhr2-creisexpressedmaysignalto 9 Article 67 FERGUSON ETAL. presented data do not pinpoint the exact target cells or tissues responsible for oviductal and uterine abnormalities, as Amhr2- cre is expressed in various sites of the reproductive tract. It is not clear either at what level NOTCH1 needs to be overexpressed to cause the mutant phenotype observed here. A more detailed analysis of NOTCH1 expression at earlier stages of development might answer these questions. The oviductal phenotype seen in the reproductive tract of Amhr2-cre, RosaNotch1 females is similar to that seen in mice with a conditional b-catenin knockout, driven by Amhr2-cre. Ablation of b-catenin resulted in uncoiled oviducts and a reductioninthesizeofuterinehorns[27].Inthosemutants,no differences in the Wnt5a and Wnt7a expression were noted by D o whole-mount in situ hybridization on E15.5 and E19.5 w n mesonephroi, although no data on Wnt4 were supplied [27]. lo a Interestingly, unlike the other models, the ovary of the d e conditional b-catenin knockout mutant was encased in a d fluid-filled (believed to be follicular fluid) cyst [27]. Uterine fro m glandswereunaffectedincontrasttoWnt7aknockoutandmice h withconstitutive activation ofSmogene[25,38–40].Analysis ttp s of the Dicer knockout females also revealed abnormal oviduct ://a coiling, as seen in our mutant females. Many of these mutants c a had fluid-filled cysts forming from P28 in the isthmus region de mD [28,29].InsituhybridizationofWntgenesidentifiedabnormal ico expression of Wnt4 and Wnt5a in the luminal epithelium and .ow u Wnt4, Wnt5a, and Wnt11 in the glandular epithelium of the pn uterus [28]. Another study identified significantly elevated .colo ma expression of Wnt4, Wnt5a, and Wnt7a in the mutant oviducts /bd [29]. iolreed Abnormalities of Mu¨llerian-derived structures were also p seen in females exposed in utero to diethylstilbestrol (DES), a rodfro FIG. 8. Gene expression analysis in Amhr2-cre, RosaNotch1 mutant sdyenscthriebtiecdehsterroeg,enDE[2S1-,tre4a1t]e.dSfimemilaalrestohtahde umnuctoainletdf,emshaolerst /articlem w females. A) Real-time qRT-PCR analysis of Wnt ligands, cyclin D2, oviducts wrapped around the ovary, no clear demarcation -aw smoothened,andNotch1inthereproductivetractof27-day-oldAmhr2- bw betweentheoviductanduterus,andaproliferationofcolumnar s Hvcareelud,egRsehoaosraegNnsooitcgrhnm1aalfilenizmgeadplaettoshwt(hnaey¼eixnp7rt)eh.sesBioo)nvAidonufacblty-asoicfsti2no7fg-degnaeyen-oeanlddtafrpegrmeetsaselenoste.fdTthhaees ecpelilthinelfiiultmratliionnin.gGethneeleuxmperens,scioynstafnoarlmysaitsioonf,uatnedrininefRlaNmAmaftroormy tract/94.biolr thepercentageofthegeneexpressionin controltissues(100%)(n¼7). DES-treatedfemalesshowedadecreaseinexpressionofWnt7a /3e Columnsrepresentthemean6SEM.*P,0.05. and Wnt4, but an increase in Wnt5a expression [42] mediated /67pr tthhraotuNgOhTeCstHro1gerengruelcaetepstoarssuEbSseRt1ofoErSERS1R-2ta.rIgtehtagsenbeeseninsbhroewasnt , 1-12od.o theendothelialcellsofbloodvessels,resultingintheobserved cancer cells [43]. Further analysis of ESR/NOTCH crosstalk, /24rg inflammatory phenotype and dilated blood vessels. Interest- as well as the detailed analysis of steroid production and 34. ingly a somewhat similar phenotype was recently described in 4 mice with constitutive NOTCH signaling in endothelial cells sreigqnuairleidn.g in females with NOTCH1 overexpression, is 58 b [7].However,itisalsopossiblethattheappearanceofthecysts In contrast to Amhr2-cre, RosaNotch1 females, no defects in y g andotherabnormalitiesinoldermutantfemalesissecondaryto the formation of the oviducts in Wnt4 conditional knockout ues the infertile phenotype and possible hormonal changes. females using Amhr2-cre were noted [44]. The latter mutants t o We have detected an increasein NOTCH1 immunostaining had smaller ovaries than their sibling controls and were 50% n 0 in stromal cells in mutant uterus and in oviducts. While no less fertile. Histologically, the ovaries had fewer follicles and 1 A increased staining was seen in uterine glandular or luminal p epithelium, there were variations of NOTCH1 expression in wanedrelamrgoereanattrreatlicf,olwliictlhesre[d4u4c]e.dInnucmonbdeirtsioonfalbomthutcaonrtspoorfaWluntet4a ril 20 oviductal epithelium. As Amhr2-cre was not reported to be 1 generated with progesterone receptor-driven Cre, there was a 9 expressed in epithelial cells, it is possible that detected significant reduction of uterine glands [45]. The differences in variations reflect endogenous NOTCH1 expression changes uterine expression of Pgr-cre and Amhr2-cre may account for throughout the estrous cycle, as recently described [37]. the unaffected uterine glands in the Amhr2-cre, RosaNotch1 Surprisinglywe didnotdetect asignificant increaseofNotch1 females described here. The Pgr-cre transgene is expressed in expression or its target genes in the P27 female reproductive epithelial cells, whereas Amhr2-cre is not. It appears that, in tractbyqRT-PCR.TheexpressionofendogenousNotch1gene our mice, aberrant activation of NOTCH1 in the mesenchyme in RNA isolated from total organs might mask the differences alters the expression of Wnt4 to which the Mu¨llerian duct is betweenmutantandwild-typeanimals.Itcanbealsosuggested highly sensitive. thatthepreviouslyreported[26,27]lowefficiencyorchimeric It was shown that Wnt4 plays a crucial role in the expression of Amhr2-cre might be responsible. The more development of the Mu¨llerian duct, as Wnt4 knockout females severephenotypeseeninolderanimalscanbe,infact,aresult werecompletelymasculinizedanddonothaveMu¨llerianducts of a gradual accumulation of cells with the recombinant [23]. Given the misexpression of Wnt4 in both Dicer and Smo transgene and hence increased NOTCH1 expression. The conditionalmousemodels[28,30],itisthereforepossiblethat 10 Article 67

See more

The list of books you might like