loading

Logout succeed

Logout succeed. See you again!

ebook img

Deep Semantic Ranking Based Hashing for Multi-Label Image Retrieval PDF

file size5.5 MB
languageEnglish

Preview Deep Semantic Ranking Based Hashing for Multi-Label Image Retrieval

Deep Semantic Ranking Based Hashing for Multi-Label Image Retrieval FangZhao YongzhenHuang LiangWang TieniuTan CenterforResearchonIntelligentPerceptionandComputing InstituteofAutomation,ChineseAcademyofSciences {fang.zhao,yzhuang,wangliang,tnt}@nlpr.ia.ac.cn 5 1 0 Abstract Semantic ranking supervision 2 Deep feature pr ceivWeidthinthcreearasipnigd ignrtoewretshtsofinwleabrgiemascgaelse, ihmaashgiengrehtraiesvrael-. tree, sky Query im representations A Researcheffortshavebeendevotedtolearningcompactbi- age . . . 9 nary codes that preserve semantic similarity based on la- D CV] 1 btshoeeamlvhseaa.nnHntdoiolctewsyesterivtmuecbrp,telumeernoebsiowtnfeaoilrmflytaehsxgeipesmlseoialhrasearsdsio.htcyi.iHnagTeterhmdeeewwcthioetomhdppmsroluaepxlroteimspdelueealstliiagdlbeneveeeeldpsl Mturletiele, vseuln s, esmkyatic building, car atabase image list . . . . . . . . .. . . . . . similarity semanticrankingbasedmethodforlearninghashfunctions . s thatpreservemultilevelsemanticsimilaritybetweenmulti- Compact c label images. In our approach, deep convolutional neu- Multi-label images CNN models hash codes [ ral network is incorporated into hash functions to jointly Figure 1. The proposed deep semantic ranking based hashing. 2 Solidandhollowarrowsindicateforwardandbackwardpropaga- learn feature representations and mappings from them to v tiondirectionsoffeaturesandgradientsrespectively. Hashfunc- hash codes, which avoids the limitation of semantic rep- 2 tionsconsistofdeepconvolutionalneuralnetwork(CNN)andbi- 7 resentation power of hand-crafted features. Meanwhile, a nary mappings of the feature representation from the top hidden 2 ranking list that encodes the multilevel similarity informa- layersofCNN.Multilevelsemanticrankinginformationisusedto 6 tion is employed to guide the learning of such deep hash learnsuchdeephashfunctionstopreservethesemanticstructure 0 functions. An effective scheme based on surrogate loss is ofmulti-labelimages. . 1 used to solve the intractable optimization problem of non- 0 smooth and multivariate ranking measures involved in the 5 learning procedure. Experimental results show the supe- 1 datadistribution. Recently,variousdata-dependenthashing riorityofourproposedapproachoverseveralstate-of-the- : methods have been proposed, which learn hash functions v arthashing methodsinterm ofrankingevaluation metrics accordingtothedatadistribution. Someofthemmainlyfo- i X whentestedonmulti-labelimagedatasets. cusonpreservingthemetricstructureofthedataintheorig- r inalfeaturespace,suchasspectralhashing[32]andbinary a reconstructive embedding [14]. However, distance metrics 1.Introduction (e.g., Euclidean distance) in the original space sometimes cannotmeasurewellthesemanticsimilaritythatisessential Representingimagesefficientlyisanimportanttaskfor forimageretrieval. large scale content-based image retrieval. Binary hashing has attracted extensive attention due to computational and Topreservesemanticstructureofthedata,hashingmeth- storage efficiencies of binary hash codes. It aims to map ods with supervisory information in form of class labels high-dimensionalimagedatatocompactbinarycodesina havebeenfurtherdeveloped[24,27,28,19,17]. Through Hammingspacewhilemaintainingsomenotionofsimilar- formulatinghashfunctionlearningasaclassificationprob- ity (e.g., metric similarity in the original feature space or lem or as an optimization problem of pairwise relation semanticsimilaritybasedonlabels). based loss functions, these methods are able to learn hash Earlyhashingmethodsaredata-independent,suchaslo- codes which preserve binary semantic similarity. But in calitysensitivehashing[5]anditsvariants,whichuseran- practiceimagesareusuallysimultaneouslyassociatedwith dom projections as hash functions without exploring the multiplesemanticlabels, andinthiscasethesimilarityre- lationshipbetweentwoimagesismorecomplexandisusu- The rest of this paper is organized as follows. Related ally relevant to the number of common labels that images work is briefly discussed in Section 2. The proposed deep have. Consequently, a multilevel measure (such as very semantic ranking based hashing is formulated and opti- similar, normally similar and dissimilar) is required to de- mizedinSection3. Experimentalevaluationsarepresented scribe the similarity, which cannot be handled well by the inSection4. Finally,Section5concludesthispaper. abovemethodsandhasnotbeenstudiedwell. 2.RelatedWork Besides,thelearningcapabilityofthestandardpipeline followed by most hashing method, i.e., firstly extracting As described before, the existing hash methods can be features like GIST [21] and SIFT [18] as image represen- roughly divided into two categories: data-independent and tations,andthenlearningmappingsfromtheserepresenta- data-dependent. Here we mainly discuss data-dependent tions to binary codes, is inadequate for dealing with rela- hashmethodspreservingthesemanticstructurewhichthis tively complex semantic structure due to the semantic in- paperfocuseson. Iterativequantizationwithcanonicalcor- formation loss in the hand-crafted features. Thus more ef- relation analysis (CCA-ITQ) [8] utilizes CCA with labels fectivesemanticfeaturerepresentationisalsodesirable. toreducethedimensionalityofinputdataandbinarizesthe In this paper, we introduce a novel framework based outcomethroughminimizingthequantizationerror, where on semantic ranking and deep learning model for learning only the pointwise label information is exploited to guide hash functions that preserve multilevel similarity between hash function learning. By comparison, some approaches multi-label imagesin the semantic space. An overall view try to preserve the semantic similarity based on pairwise of the proposed framework termed deep semantic ranking relation. Boosted similarity sensitive coding (BSSC) [24] basedhashing(DSRH)isillustratedinFig. 1. Hereweuse assigns each pair of data points a label to learn a set of deepconvolutionalneuralnetwork(CNN)[13]toconstruct weak classifiers as hash functions. Semi-supervised hash- hash functions to learn directly from images, which pro- ing (SSH) [28] minimizes an empirical error over the la- vides much richer sematic information than hand-crafted beled pairs of points and makes hash codes balanced and features. Meanwhile, we learn such deep hash functions uncorrelatedtoavoidoverfitting. Motivatedbylatentstruc- with semantic ranking supervision which is the order of a tural SVM, minimal loss hashing (MLH) [19] proposes a rankinglistderivedfromsharedclasslabelsbetweenquery pairwise hinge-like loss function and minimizes its upper and database images. The learning is a joint optimization boundtolearnsimilarity-preservingbinarycodes. of feature representation and mappings from them to hash Furthermore, order-preserving approaches, which are codes, and it is more effective than the conventional two- more related to this paper, explicitly use ranking informa- stage pipeline. A ranking loss defined on a set of triplets tioninobjectivefunctionstolearnhashcodesthatpreserve isusedassurrogatelosstosolvetheoptimizationproblem thesimilarityorderinthefeatureorsemanticspace. Order resulting from nonsmooth and multivariate ranking mea- preservinghashing(OPH)[31]formulatesanalignmentbe- sures, and then the stochastic gradient descent algorithm tweenthesimilarityorderscomputedrespectivelyfromthe canbeusedtooptimizemodelparameters. Weevaluatethe original Euclidean space and the Hamming space, which proposed DSRH method on a couple of multi-label image canbesolvedusingthequadraticpenaltyalgorithm. Onthe datasetsandcompareitwithseveralstate-of-the-arthashing basis of [19], hamming distance metric learning (HDML) methodsbasedonbothhand-craftedfeaturesandactivation [20]developsametriclearningframeworkbasedonatriplet featuresfromtheCNNmodel.Experimentalresultsdemon- ranking loss to preserve relative similarity. However, this stratethatourmethodisabletocapturecomplexmultilevel triplet loss function only considers local ranking informa- semanticstructureandsignificantlyoutperformsotherhash- tion and is limited in capturing information about multi- ingmethodsinrankingquality. level similarity. By using a triplet representation for list- Our main contributions include: 1) A novel hash func- wisesupervision,ranking-basedsupervisedhashing(RSH) tion learning formwork is proposed to combine semantic [29]minimizestheinconsistencyofrankingorderbetween ranking and deep learning model to address the problem thehammingandoriginalspacestokeepglobalrankingor- ofpreservingmultilevelsemanticsimilaritybetweenmulti- der. DifferentfromRSH,ourmethodleveragesdeeplearn- label images. To the best of our knowledge, it is the first ing model to discover deeper semantic similarity and can timetoexploitdeepconvolutionalneuralnetworkwithlist- scalewellonlargetrainingsets. Columngenerationhash- wise ranking supervision for hashing. 2) A scheme based ing (CGH) [15] and StructHash [16] combine ranking in- onsurrogatelossesisappliedtotheproposedframeworkto formationwiththeboostingframeworktolearnaweighted effectivelysolvetheoptimizationproblemofrankingmea- hammingembedding. Incontrast,ourmethodneedsnoex- sures. 3) Our method booststhe benchmark of multi-label traweighttorankhashcodes. image retrieval, achieving the state-of-the-art performance Deep learning models, particularly deep convolutional intermsofrankingevaluationmetrics. neural networks (CNNs), have achieved great success in various visual tasks such as image classification, annota- F u ttrWpioalonianntknh,gigenriigreenttplroCiaoeslNwv.saNeb[lra3sfsau0etnl]oddrueClseopeNabrrejNanesecsrintamhntadaakvtegiietnoeegnbcsetilliemeoonasnirslena[xbir1pnia3tlgsyo,ercd7mea,dpoe4atinrnb,itcit3rlh.ii0ptey,Gsl.ee6otSt]nasogasdmkmuesee-t. 5 colnavyoelrustion l(F)aCyaer F-counllynected l(F)aCyber -conllynected Hash layer al. [7]incorporateawarpapproximaterankingintoCNNs 224×224 Deep Hash code warped image representation forimageannotation. Thereareafewhashingmethodsthat Figure2.Thestructureofdeephashfunctions. Aninputimageis alsousedeepmodels. Salakhutdinovetal. [23]useadeep firsttransformedtoafixedsize, andthengoesthroughfivecon- generative model as hash functions. Similarly, Torralba et volutionlayersandtwofully-connectedlayers,whichprovidesa al. [27] model a deep network by using multiple layers of deep feature representation. Finally, the hash layer generates a RBMs. Given approximate hash codes learned from pair- compact binary code. The hash layer is also directly connected wisesimilaritymatrixdecomposition, Xiaetal. [33]learn tothefirstfully-connectedlayer(FCa)inordertoutilizediverse hash functions using CNNs to fit the learned hash codes. featureinformationbiasedtowardvisualappearance. However,thesemethodsdonotexplicitlyimposetherank- ingconstraintonthedeepmodels,whichcannotfigureout normalization and max pooling. Unlike image classifica- themulti-levelsimilarityproblem. tion, hash codes are expected to contain global feature in- 3.OurMethod formation within an image when used for retrieval. Thus insteadofcroppinganimage,wewarpallpixelsintheim- Ingeneral,ahashfunctionh:RD →{−1,1}istreated agetotherequiredsize. Inspiredby[26],weaddabypass- as a mapping that projects a D-dimensional input onto a ingconnectionbetweenthefirstfullyconnectedlayer(FCa) binary code. Assume that we are given a set of class la- (calledtheskippinglayer)andthehashlayertoreducethe bels L = {1,...,C} and a dataset D = {xn}Nn=1 where possibleinformationloss. Wearguethatthefeaturesfrom each data point x ∈ RD is associated with a subset of thesecondfullyconnectedlayer(FCb)ofCNNaredepen- labels Y ⊆ L, our goal is to learn a set of hash func- dentonclassestoomuchandhavestronginvariance,which tions h(x) = [h1(x),h2(x),...,hK(x)] that generates K- isunfavorableforcapturingsubtlesematicdistinction.Thus bit (K (cid:28) D) binary codes while preserving the semantic we connect the hash layer to both the two fully-connected structureofdatapointswithmultiplelabels. layers to enable it encoding more diverse information bi- ased toward visual appearance. Accordingly we define a 3.1.DeepHashFunctions deephashfunctionas: A good form of hash functions is important for ob- taining desirable hash codes. As mentioned earlier, most h(x;w)=sign(wT[f (x);f (x)]), (1) a b conventional hashing methods first extract visual features likeGISTandSIFTfromimagesandthenlearn“shallow” wherewdenotesweightsinthehashlayer,fa(.)andfb(.) (usually linear) hash functions upon these features. How- denote feature vectors from the outputs of the layers FCa ever, these hand-crafted features have limited representa- andFCbrespectivelyandcanberepresentedasthecompo- tion power and may lose key semantic information which sition of the functions of previous layers. Here bias terms is important to the task of similarity search. Here we con- and parameters of fa(.) and fb(.) are omitted for the sake siderdesigningdeephashfunctionsusingCNNstojointly of concision. To obtain a K-bit binary code, h(x;W) = learnfeaturerepresentationsfromrawpixelsofimagesand [h1(x;w1),h2(x;w2),...,hK(x;wK)]canbecomputed. theirmappingstohashcodes. Thisnon-linearhierarchical 3.2.SemanticRankingSupervision hash function has more powerful learning capability than theshallowonebasedonfeaturesextractedinadvance,and When each data point in D is associated with a single thus is able to learn feature representations more suitable class label, pairs of points could be labelled as either sim- formultilevelsemanticsimilaritysearch. ilar or dissimilar according to whether they have the same AsshowninFig. 2,weconstructhashfunctionsthrough label,andthelearningprocedureofhashfunctionsissimply incorporating the CNN model whose architecture is the tomaketheHammingdistancesbetweenbinarycodessmall sameas[12]. Adeepfeaturerepresentationiscomputedby (large) for similar (dissimilar) pairs. However, in the case forward propagating a mean-subtracted 224 × 224 image ofmultiplelabels,thereexitsmultilevelsimilaritybetween through five convolutional layers and two fully connected data points depending on how many common labels they layers, and then fed into the last hash layer to generate a have. To preserve such multilevel semantic structure, one compactbinarycode. Pleasereferto[13,12]formorede- ofthemostessentialwaysisthatforindividualdatapoints, tails about the geometry of the convolutional layers, local we keep the ranking order of neighbors computed by the Hamming distance consistent with those derived from se- usedinRankingSVM[11]forleaningtorankwhereascore manticlabelsintermsofrankingevaluationmeasures. functionforrankingislearned. AssumewehaveasamplepointfromDasaqueryq.For From the definition of NDCG, it can be observed that thequeryq,asemanticsimilaritylevelrofadatabasepoint thetoprankeditemshavealargergainfactorforthescore, x with q can be calculated based on the number of their whichbetterreflectstheperformanceoftherankingmodels commonlabels. Themostsimilardatabasepointsarethose in practical image retrieval systems, because users usually sharingallthelabelswithq,andassignedalevelr =|Y |. pay most of their attentions to the results on the first few q Accordingly, the second similar points, which share any pages. Thuswewishthattherankingoftheseitemscould |Y |−1 of the labels, are assigned a level r = |Y |−1. be predicted more accurately than others. However, (3) q q At last, the dissimilar points share none of the labels and treatsalltripletsequally, whichisnotdesired. Inspiredby are assigned a level r = 0. And then we can obtain a [1],wemodifytherankinglossbyaddingadaptiveweights ground-truthrankinglistforqbysortingthedatabasepoints relatedtothesimilaritylevelsofdatabasepoints: indecreasingorderoftheirsimilaritylevels. Accordingto theground-truthranking,variousevaluationcriteriacanbe Lω(h(q),{h(xi)}Mi=1)= used to measure the consistency of the rankings predicted M (cid:88) (cid:88) byhashfunctions,suchastheNormalizedDiscountedCu- ω(r ,r )[δd (h(q),h(x ),h(x ))+ρ] . i j H i j + mulativeGain(NDCG)score[10],whichisapopularmea- i=1j:rj<ri sureintheinformationretrievalcommunityanddefinedas: (4) 1 (cid:88)p 2ri −1 AccordingtoNDCG,theweightωcanbegivenby: NDCG@p= , (2) Z log(1+i) 2ri −2rj i=1 ω(ri,rj)= Z (5) wherepisthetruncatedpositioninarankinglist,Zisanor- where Z is the normalization constant in (2). The higher malization constant to ensure that the NDCG score for the therelevanceofx andqisthanthatofx andq,thelarger i j correct ranking is one, and r is the similarity level of the i declinetheNDCGscorewouldsufferifx isrankedbehind i i-th database point in the ranking list. Directly optimizing x . And thus the larger weight should be assigned to this j suchrankingcriteriaisintractable,whichinvolvesminimiz- triplet. Whenω(r ,r )≡1,itcorrespondsto(3). i j ing nonsmooth and multivariate ranking losses. One solu- Given the dataset D as a training set, we wish to learn tionistoregarditasaproblemofstructuredoutputlearn- hash functions that optimize the rankings for all query ingandoptimizetheproblembystructuredSVM.Butthis points q from D. Based on the surrogate loss (4) and the frameworkisnotsuitablefordeeplearningmodelwhichis hashfunction(1),theobjectivefunctioncanbegivenbythe usedtoconstructourhashfunctions. Nextwewilldiscuss empiricallosssubjecttosomeregularization: asimplebuteffectiveschemebasedonsurrogateloss. (cid:88) F(W)= L (h(q;W),{h(x ;W)}M ) 3.3.OptimizationwithSurrogateLoss ω i i=1 q∈D,{xi}Mi=1⊂D To circumvent the problem of directly optimizing the ranking criteria, we try to use a surrogate loss as the risk + α(cid:13)(cid:13)(cid:13)mean(h(q;W))(cid:13)(cid:13)(cid:13)2+ β (cid:107)W(cid:107)2. (6) thatthelearningprocedureminimizesinpractice. Givena 2 (cid:13) q (cid:13)2 2 2 query q and a ranking list {x }M for q, we can define a i i=1 Similar to [20], the second term is the balance penalty rankinglossonasetoftripletsofhashcodesasfollows: whichisusedtoencourageeachbitaveragedoverthetrain- ingdatatobemean-zeroandtomakesuremorestablecon- L(h(q),{h(xi)}Mi=1)= vergenceofthelearningprocedure.Andthethirdtermisthe (cid:88)M (cid:88) L2 weight decay which penalizes large weights [12]. Due [δd (h(q),h(x ),h(x ))+ρ] , (3) to the discontinuous sign function in (1), the optimization H i j + i=1j:rj<ri of (6) is difficult. To address this issue, we relax h(x;w) to: whereM isthelengthoftherankinglist,[.]+ =max(0,.), h(x;w)=2σ(wT[fa(x);fb(x)])−1, (7) δd (h,h ,h ) = d (h,h )−d (h,h ), d (.,.) is the H 1 2 H 1 H 2 H whereσ(t) = 1/(1+exp(−t))isthelogisticfunction. In Hammingdistanceandρisamarginparameterwhichcon- ordertofacilitatethegradientcomputation, werewritethe trolstheminimummarginbetweenthedistancesofthetwo hammingdistanceastheformofinnerproduct: pairs. This surrogate loss is a convex upper bound on the pairwise disagreement which counts the number of incor- K−h(q;W)Th(x;W) rectlyrankedtriplets. Thistypeof surrogatelosshasbeen dH(h(q;W),h(x;W))= 2 (8) (a) (b) Figure3.Rankingperformanceevaluations(NDCG,ACGandweightedmAP)ofdifferentcomponentsusingvariousnumbersofhashbits ontwodatasets:(a)MIRFLICKR-25Kand(b)NUS-WIDE. whereK isthenumberofhashbits. 4.Experiments Stochastic gradient descent is used to minimize the ob- Wetesttheproposedhashingmethodontwomulti-label jectivefunction.Itcanbeobservedthatthelossfunction(4) benchmark datasets, i.e., MIRFLICKR-25K [9] and NUS- is actually a summation of a sequence of weighted triplet WIDE [2]. We present quantitative evaluations in terms losses. Foranyonetriplet(q,x ,x ),if i j of ranking measures and compare our method with unsu- 1 pervised methods: iterative quantization (ITQ) [8], spec- (h(q;W)Th(x ;W)−h(q;W)Th(x ;W))+ρ>0, 2 j i tralhashing(SH)[32],andsupervisedmethodsusingmulti- label and ranking information respectively: CCA-ITQ [8], thederivativesof(6)withrespecttohashcodevectorsare hammingdistancemetriclearning(HDML)[20]. givenby: We set the mini-batch size for gradient descent to 128, and impose dropout with keeping probability 0.5 on the ∂F α fullyconnectedlayerstoavoidoverfitting. Theregulariza- = mean(h(q;W)) ∂h(q;W) Nq q tionparameterαandβ intheobjectivefunction(6)areset 1 to1and5e−4 respectively. Thelengthoftheground-truth + ω(r ,r )(h(x ;W)−h(x ;W)) (9) 2 i j j i ranking list used for training is set to 3, which can be cre- atedbytakingoneitemsharingallthelabelswithaquery, oneitemwithoutanycommonlabelandoneitemhavingat ∂F 1 leastonecommonlabel. Forallcomparedmethods,weuse =− ω(r ,r )h(q;W), (10) ∂h(x ;W) 2 i j thebestsettingsreportedintheirliteratures. i ∂F 1 The ImageNet ILSVRC-2012 dataset [22] is utilized to = ω(r ,r )h(q;W). (11) ∂h(x ;W) 2 i j pre-traintheCNNmodelbyoptimizingmultinomiallogis- j ticregressionobjectivefunctionintheimageclassification wherethemeanvalueiscomputedoveronemini-batchand task. This dataset contains about 1.2 million training im- N isthesizeofamini-batch. Thesederivativevaluescan ages and 50,000 validation images, roughly 1000 images q be fed into the underlying CNN via the back-propagation in each of 1000 categories. We use the pre-trained param- algorithmtoupdatetheparametersofeachlayer. eters of convolutional layers and fully-connected layers to (a) (b) Figure4.ComparisonofrankingperformanceofourDSRHandotherhashingmethodsbasedonhand-craftedfeaturesontwodatasets:(a) MIRFLICKR-25Kand(b)NUS-WIDE. initializetheCNNpartofhashfunctionsinourmethod. In semantic concepts. Since the website of the dataset does ordertoensurefairness,weapplythefeaturesfromthepre- not provide raw image data but the URLs of images, for trained CNN model to the compared hashing methods as learning deep feature representations we download these well. Furthermore, the compared methods are carried out images ourselves from the web. However, we only col- using the features that are learned through fine-tuning the lected 226,265 images as some of those URLs have been CNNmodelonthemulti-labeldatasetsinourretrievaltask. invalid now. We randomly sample 5000 images for test- ing queries and the rest is used for training and retrieval. 4.1.Datasets The dataset includes six types of low-level features ex- TheMIRFLICKR-25Kdataset[9]consistsof25,000im- tracted from these images: bag of words based on SIFT ages collected from the social photography website Flickr. feature,colorhistogram,colorcorrelogram,edgedirection All images are annotated for 24 semantic concepts includ- histogram, wavelet texture and block-wise color moments. ingvariousscenesandobjectscategoriessuchassky,night, Weconcatenatethemallandgeta1134-dimensionalfeature foodandtree. Moreover,14oftheseconceptsareusedfor representationforeachimage. astricterlabeling,i.e.,animageisannotatedwithaconcept 4.2.EvaluationCriteria again only if the concept is salient. Thus we have total 38 semanticlabelswhereeachimagemaybelongtoseveralla- Inourexperiments,NormalizedDiscountedCumulative bels. 2000imagesarerandomlyselectedastestingqueries Gain(NDCG)[10], AverageCumulativeGain(ACG)[10] andtheremainingimagesareusedasthedatabasefortrain- and weighted mean Average Precision (mAP) are used to ingandretrieval. Following[25], a3857-dimensionalfea- measure the ranking quality of retrieved database points. ture vector for each image is extracted by concatenating As mentioned before, NDCG defined in (2) evaluates the Pyramid Histogram of Words (PHOW) features, Gist and rankingofdatapointsbypenalizingerrorsinhigherranked MPEG-7descriptors, whichwillbeusedforthecompared itemsmorestrongly. methods. ACGiscalculatedbytakingtheaverageofthesimilarity The NUS-WIDE dataset [2] is a relatively larger image levelsofdatapointswithintop-ppositions: dataset containing 269,648 images annotated with 81 con- p cepts. It is also from Flickr, but more challenging than 1 (cid:88) ACG@p= r , (12) MIRFLICKR-25K due to more images and more diverse p i n=1 (a) (b) Figure5.ComparisonofrankingperformanceofourDSRHandotherhashingmethodsbasedonactivationfeaturesofpre-trainedCNN ontwodatasets:(a)MIRFLICKR-25Kand(b)NUS-WIDE. where r is the similarity level of the data point on the i- theaveragedrankingperformancebecauseitassignslarger i thpositionofaranking. ACGactuallyisequivalenttothe weights to more relevant database points and weakens the precisionweightedbythesimilaritylevelofeachdatapoint. effect of the less relevant ones. Connecting the first fully- mAP is the mean of average precision for each query. connectedlayertothehashlayercanalsoimprovetheper- Sincethesimilaritylevelrcanbebiggerthanone,wecom- formance because more information biased toward visual puteaweightedmAPusingACG: appearancecanbeutilizedwhichmaybeimportantforcap- turingmultilevelsemanticsimilarity. Q 1 (cid:88) mAP = AP (q), (13) w Q w 4.4.MethodComparison q=1 (cid:80)M Π(r >0)ACG@p We also compare the proposed DSRH with other hash AP = p=1 p , (14) methods based on hand-crafted features. Fig. 4 illustrates w M r>0 the scores of NDCG, ACG and weighted mAP of these where Π(.) ∈ {0,1} is an indicator function and M is methods using various numbers of bits. We can see that r>0 thenumberofrelevantdatapoints. the performance of our method is significantly better than other methods based on hand-crafted features in all cases. 4.3.EvaluationofDifferentComponents By using the CNN model to construct hash functions, our To analyze the effectiveness of several important com- method have higher learning capability and is able to ex- ponents in the proposed DSRH, we remove the connec- ploitmoresemanticinformationthanthehashingmethods tion between the hash layer and the skipping layer and set trainedonhand-craftedfeatureswhichareusuallyextracted ω(r ,r ) ≡ 1 in (4) to evaluate their influence on the fi- byunsupervisedandshallowmodels. i j nal performance. These two models are called DSRH-NS We further evaluate the compared hashing methods on andDSRH-NS-NW.HereNSdenotesnoskippinglayerand the features obtained from the activation of the last hid- NWdenotesnoadaptiveweight. Fig. 3showstheresultsin den layer of the CNN model pre-trained on the ImageNet therankingmeasures. dataset. Thisactivationfeaturecanbeseenasagenericvi- We can see that using the surrogate loss with adaptive sualfeatureandhasbeenusedinobjectrecognition,domain weights can improve the ranking quality of top-100 rele- adaptionandscenerecognition[3]. TheresultsofNDCG, vant items in terms of NDCG and ACG at the expense of ACG and weighted mAP are shown in Fig. 5. Although (a) (b) Figure6.ComparisonofrankingperformanceofourDSRHandotherhashingmethodsbasedonactivationfeaturesoffine-tunedCNNon twodatasets:(a)MIRFLICKR-25Kand(b)NUS-WIDE. the activation features boost the ranking performance of DSRH, we also attempt to concatenate the activations of the compared methods by a large margin, our method still thelasttwohiddenlayersoftheCNNmodelasfeaturerep- hasbetterperformancebecauseweconstructthedeephash resentationsandapplythemtothecomparedhashingmeth- functiontojointlylearningfeaturerepresentationsandhash ods. However, the performance of the compared methods codes, which can utilize semantic supervision information trained using these features become even worse. It further to obtain features more fitted to the retrieval datasets. It is validatestheeffectivenessofthestructureofourhashfunc- more effective than learning hash codes from the features tionwhichhasatightcouplingwithCNN. learnedinadvance. To further verify the superiority of our method, we use 5.Conclusion the activation features fine-tuned on the retrieval datasets, Inthispaperwehaveproposedtoemploymultilevelse- i.e., MIRFLICKR-25K and NUS-WIDE, to evaluate the mantic ranking supervision to learn deep hash functions compared methods as well. Specifically, we retrain the based on CNN which preserves the semantic structure of CNN model for multi-label image classification by using multi-label images. The CNN model with listwise rank- cross-entropycostfunction. WereporttheresultsinFig. 6. ing supervision is used to jointly learn feature representa- Itcanbe seenthatour method stillachievesthebest rank- tions and mappings from them to binary codes. The re- ingperformance,whichshowsthatthemultilevelsemantic sulting optimization problem of nonsmooth and multivari- ranking supervision can make hash function learning bet- aterankingmeasureissolvedbyusingarankinglossona ter preserve the semantic structure of multi-label images. setoftripletsasthesurrogateloss,whichmakesstochastic CCA-ITQ also uses multi-label information, but dose not gradientdescentcouldbeusedtooptimizemodelparame- explicitly learn with the ranking. HDML performs even terseffectively. Extensiveexperimentsdemonstratethatthe worse than the unsupervised ITQ because it only consid- proposedmethodoutperformsotherstate-of-the-arthashing ers binary similarity relationship which harms the seman- methodsintermsofrankingquality. tic structure in the fine-tuned features. Note that using the featuresfine-tunedbymulti-labelsupervision,theunsuper- Acknowledgments visedITQperformsalmostaswellasCCA-ITQwhichisits supervisedversion,evenbetterintermsofweightedmAP. This work was supported by the National Basic Re- Similar to the skipping layer in the hash function of search Program of China (2012CB316300), National Nat- ural Science Foundation of China (61175003, 61135002, [17] W.Liu,J.Wang,R.Ji,Y.Jiang,andS.Chang. Supervised 61420106015,U1435221),andCCF-TencentOpenFund. hashingwithkernels.InProc.IEEEConf.Comp.Vis.Pattern Recogn.(CVPR),2012. 1 References [18] D. G. Lowe. Object recognition from local scale-invariant features. InProc.Int.Conf.Comp.Vis.(ICCV),1999. 2 [1] Y.Cao,J.Xu,T.Liu,H.Li,Y.Huang,andH.Hon.Adapting [19] M.NorouziandD.J.Fleet. Minimallosshashingforcom- ranking svm to document retrieval. In Proc. Annual ACM pactbinarycodes. InProc.Int.Conf.Mach.Learn.(ICML), SIGIRConf.,2006. 4 2011. 1,2 [2] T.-S.Chua,J.Tang,R.Hong,H.Li,Z.Luo,andY.-T.Zheng. [20] M. Norouzi, D. J. Fleet, and R. Salakhutdinov. Hamming Nus-wide: Areal-worldwebimagedatabasefromnational distancemetriclearning. InProc.Adv.NeuralInfo.Process. universityofsingapore. InProc.oftheACMInt.Conf.on Syst.(NIPS),2012. 2,4,5 ImageandVideoRetrieval,2009. 5,6 [21] A.OlivaandA.Torralba.Modelingtheshapeofthescene:A [3] J. Donahue, Y. Jia, O. Vinyals, J. Hoffman, N. Zhang, holisticrepresentationofthespatialenvelope. International E.Tzeng, andT.Darrell. Decaf: Adeepconvolutionalac- journalofcomputervision(IJCV),2001. 2 tivationfeatureforgenericvisualrecognition. InProc.Int. [22] O. Russakovsky, J. Deng, H. Su, J. Krause, S. Satheesh, Conf.Mach.Learn.(ICML),2014. 7 S. Ma, Z. Huang, A. Karpathy, A. Khosla, M. Bernstein, [4] A. Frome, G. S. Corrado, J. Shlens, S. Bengio, J. Dean, A. C. Berg, and F. Li. Imagenet large scale visual recog- M.Ranzato,andT.Mikolov.Devise:Adeepvisual-semantic nitionchallenge. CoRR,abs/1409.0575,2014. 5 embeddingmodel. InProc.Adv.NeuralInfo.Process.Syst. [23] R.SalakhutdinovandG.Hinton. Semantichashing. Inter- (NIPS),2013. 3 nationalJournalofApproximateReasoning,2009. 3 [5] A. Gionis, P. Indyk, and R. Motwani. Similarity search in [24] G. Shakhnarovich, P. A. Viola, and T. Darrell. Fast pose highdimensionsviahashing. InProc.Int.Conf.VeryLarge estimation with parameter-sensitive hashing. In Proc. Int. DataBases(VLDB),1999. 1 Conf.Comp.Vis.(ICCV),2003. 1,2 [6] R. Girshick, J. Donahue, T. Darrell, and J. Malik. Rich [25] N. Srivastava and R. Salakhutdinov. Multimodal learning featurehierarchiesforaccurateobjectdetectionandseman- withdeepboltzmannmachines. InProc.Adv.NeuralInfo. tic segmentation. In Proc. IEEE Conf. Comp. Vis. Pattern Process.Syst.(NIPS),2012. 6 Recogn.(CVPR),2014. 3 [26] Y.Sun,X.Wang,andX.Tang. Deeplearningfacerepresen- [7] Y.Gong,Y.Jia,T.Leung,A.Toshev,andS.Ioffe.Deepcon- tationfrompredicting10,000classes. InProc.IEEEConf. volutionalrankingformultilabelimageannotation. CoRR, Comp.Vis.PatternRecogn.(CVPR),2014. 3 abs/1312.4894,2013. 3 [27] A.Torralba,R.Fergus,andY.Weiss. Smallcodesandlarge [8] Y. Gong, S. Lazebnik, A. Gordo, and F. Perronnin. Itera- imagedatabasesforrecognition.InProc.IEEEConf.Comp. tivequantization: aprocrusteanapproachtolearningbinary Vis.PatternRecogn.(CVPR),2008. 1,3 codesforlarge-scaleimageretrieval. IEEET.PatternAnal- [28] J.Wang,S.Kumar,andS.-F.Chang. Semi-supervisedhash- ysisMach.Intelli.(TPAMI),2012. 2,5 ingforscalableimageretrieval. InProc.IEEEConf.Comp. [9] M.J.HuiskesandM.S.Lew. Themirflickrretrievaleval- Vis.PatternRecogn.(CVPR),2010. 1,2 uation. InProc.ACMInt.Conf.MultimediaInfo.Retrieval, [29] J. Wang, W. Liu, A. X. Sun, and Y. Jiang. Learning hash 2008. 5,6 codes with listwise supervision. In Proc. Int. Conf. Comp. [10] K.JarvelinandJ.Kekalainen. Irevaluationmethodsforre- Vis.(ICCV),2013. 2 trieving highly relevant documents. In Proc. Annual ACM [30] J. Wang, Y. Song, T. Leung, C. Rosenberg, and Y. Wu. SIGIRConf.,2000. 4,6 Learningfine-grainedimagesimilaritywithdeepranking.In [11] T.Joachims. Optimizingsearchenginesusingclickthrough Proc.IEEEConf.Comp.Vis.PatternRecogn.(CVPR),2014. data.InProc.ACMKnowledgeDiscoveryandDataMining, 3 2002. 4 [31] J.Wang,J.Wang,N.Yu,andS.Li.Orderpreservinghashing [12] A. Krizhevsky. One weird trick for parallelizing convolu- forapproximatenearestneighborsearch.InProc.ofthe21st tionalneuralnetworks. CoRR,abs/1404.5997,2014. 3,4 ACMInt.Conf.onMultimedia,2013. 2 [13] A. Krizhevsky, I. Sutskever, and G. E. Hinton. Imagenet [32] Y.Weiss,A.Torralba,andR.Fergus. Spectralhashing. In classification with deep convolutional neural networks. In Proc.Adv.NeuralInfo.Process.Syst.(NIPS),2008. 1,5 Proc.Adv.NeuralInfo.Process.Syst.(NIPS),2012. 2,3 [33] R.Xia,Y.Pan,H.Lai,C.Liu,andS.Yan. Supervisedhash- [14] B.KulisandT.Darrell. Learningtohashwithbinaryrecon- ingforimageretrievalviaimagerepresentationlearning. In structive embeddings. In Proc. Adv. Neural Info. Process. Proc.Twenty-EighthAAAIConf.onArti.Intel.(AAAI),2014. Syst.(NIPS),2009. 1 3 [15] X.Li,G.Lin,C.Shen,A.vandenHengel,andA.R.Dick. Learninghashfunctionsusingcolumngeneration. InProc. Int.Conf.Mach.Learn.(ICML),2013. 2 [16] G.Lin, C.Shen, andJ.Xin. Optimizingrankingmeasures forcompactbinarycodelearning.InProc.Eur.Conf.Comp. Vis.(ECCV),2014. 2

See more

The list of books you might like