loading

Logout succeed

Logout succeed. See you again!

ebook img

Dynamical mechanism of anticipating synchronization in excitable systems PDF

file size0.42 MB
languageEnglish

Preview Dynamical mechanism of anticipating synchronization in excitable systems

Dynamicalmechanism ofanticipating synchronization inexcitablesystems Marzena Ciszak,1 Francesco Marino,2 Rau´l Toral,1,2 and Salvador Balle1,2 1Departament de F´ısica, Universitat de les Illes Balears 2Instituto Mediterra´neo de Estudios Avanzados (IMEDEA), CSIC-UIB, Ed. Mateu Orfila, Campus UIB, 07122 Palma de Mallorca, Spain (Dated:February2,2008) We analyze the phenomenon of anticipating synchronization of two excitable systems with unidirectional delayed coupling whicharesubject tothesameexternal forcing. Wedemonstrate fordifferent paradigms of excitablesystemthat,duetothecoupling, theexcitabilitythresholdfortheslavesystemisalwayslowerthan that for the master. As aconsequence the twosystems respond toacommon external forcing withdifferent responsetimes. Thisallowstoexplaininasimplewaythemechanismbehindthephenomenonofanticipating synchronization. 4 0 0 2 The synchronization of nonlinear dynamical systems is a andtheyoftenoperateinfeedbackregimeinanoisyenviron- phenomenoncommontomanyfieldsofsciencerangingfrom ment,thestudyofthedelayedcouplingeffectsinapresence n biologytophysics[1],andithasbeenanactiveresearchsub- ofnoiseiscertainlyofwideconcern. a J ject since the work by Huygensin 1665. Recently, the syn- Theanticipatingsynchronizationregimehasbeenoftende- 2 chronization of chaotic systems in a unidirectional coupling scribed as a rather counterintuitive phenomenon because of 1 configurationhasattractedagreatinterestduetoitspotential the possibility of the slave system anticipating the unpre- applications to secure communication systems [2]. Particu- dictable evolution of the master [3, 5, 7]. The aim of this 1 larattentionhasbeenpayedtotheso-calledanticipatingsyn- v paperistoprovideasimpleclearphysicalmechanismforthis chronizationregime,anideafirstproposedbyVossin[3]. He 6 regimeindelayedcoupledexcitablesystems,showingthatthe 7 showedthat,insomeparameterregions,twoidenticalchaotic anticipationoftheslaveisduetoareductionofitsexcitability 1 systems can be synchronized by unidirectionaldelayed cou- threshold induced by the delayed coupling term. As a con- 1 plinginsuchamannerthatthe”slave”(thesystemwithcou- sequence,themasterandtheslave respondtoacommonex- 0 pling) anticipates the ”master” (the one without coupling). 4 ternal forcing with different response times. The proposed Morespecifically,thecouplingschemeproposedin[3]forthe 0 dynamicalpictureallowsustoexplainallthegeneralfeatures / dynamicsofthemaster,x(t),andslave,y(t)isthefollowing: of the phenomenonas well as to determine in a natural way t a themaximumpermittedanticipationtime.Theresultsaresus- m x˙ = F(x) (1) tainedbynumericalintegrationofthedynamicalequationsas - y˙ = F(y)+K(x−yτ) (2) wellasbysimpleanalyticalcalculations. d n where yτ ≡ y(t − τ). For appropriate values of the delay Adynamicalsystemcommonlyusedtostudyexcitablebe- o haviorisAdler’sequation,[12] c timeτ andcouplingstrengthK,thebasicresultisthaty(t)≈ : x(t+τ),i.e.theslave“anticipates”byanamountτ theoutput v i ofthemaster. x˙ =µ−cosx, (3) X Thisregimeanditsstabilityhasbeentheoreticallystudied r inseveralsystems,fromthesimplestonesdescribedbylinear a where x is an angular variable (modulo 2π) and µ the con- differential equations and maps where the mathematical de- trol parameter. For |µ| < 1, there are two fixed points at tails can be fully worked out[4, 5], to the more complicated onessuchassemiconductorlasers[6]operatinginthechaotic x± =±arccosµ,onebeingastablefocus(x−)andtheother (x ) an unstablesaddlepoint. If |µ| > 1, thereare nofixed regime. Experimentalevidence of anticipating synchroniza- + points,andtheflowconsistsinanoscillationofthevariablex. tionhasbeenshowninChuacircuits[7]andinsemiconductor ThislimitcycledevelopsthroughanAndronovbifurcationat laserswithopticalfeedback[8]. µ = ±1[13,14],wherethetwofixedpointscollideandan- This same phenomenonhas recently been shown to occur c nihilate. For|µ| < 1,thesystemdisplaysexcitablebehavior: also when the dynamics, instead of chaotic, is excitable. In ifwekickthesystemoutofitsstablestatewithalargeenough refs. [9] the effects of unidirectional delayed coupling be- perturbation,thetrajectorywillreturntotheinitialstate(mod- tween two identical excitable systems was studied for both ulo2π)throughanorbitthatcloselyfollowstheheteroclinic the FitzHugh-Nagumo [10] and Hodgkin-Huxley [11] mod- connectionofthesaddleandthenode. Duringthisorbit,the els. Itwasshownthat,whenbothsystemsareexcitedbythe systemisbarelysensitivetoexternalperturbationsofmoder- same noise, and for a certain range of coupling parameters, ateamplitude. therandomlydistributedpulsesofthemasterareprecededby those of the slave. This allowsfor predictingthe occurrence Inordertostudyanticipatingsynchronization,weconsider ofexcitablepulsesinthemaster. Sincemanybiologicalsys- twoidenticalAdler’ssystemswithdelayedunidirectionalcou- tems (as neurons and heart cells) exhibit excitable behavior pling underthe effectof an externalperturbationI(t) acting 2 perturbation amplitude p . Note that below the excitability 0 threshold,p <2arccos(µ)(equivalentlyµ<cos(p /2)),t 0 0 r doesnotexist.Forµ>cos(p /2)theresponsetimet isade- 0 r creasingfunctionofµwhichapproacheszeroasµ→1. This resultshowsthatthe responsetime ofan Adlersystem to an above-thresholdexternalperturbationprogressivelydecreases as the Andronov bifurcation point (|µ| = 1) is approached, inagreementwiththenumericalresultshowninFig. 2(right panel). FIG.1: Timeseriesofthemastersystemx(solidline)andslavesys- temy(dashedline)subjectedtowhiteGaussiannoiseofzeromean andcorrelationsh(ξ(t)ξ(t′)i = Dδ(t−t′),obtainedbynumerical simulationofeqs.(4,5).Otherparametersare:µ=0.95,K =0.01 τ =1.ThenoiseintensityisD=0.017. simultaneouslyonbothsystems, x˙ = µ−cos(x)+I(t) (4) y˙ = µ−cos(y)+K(x−yτ)+I(t) (5) FIG.2: Leftpanel: Responsetimetr versusµfortheAdlersystem xperturbedbyp0δ(t)withp0 = 2fromEq. 6. Rightpanel: time seriesforx(t)forµ=0.95(solidline)andµ=0.97(dashedline). WhenI(t) = ξ(t)iszero-meanGaussiannoise,anticipat- Bothsystemshavebeenperturbedatt0 =10byapulseofconstant ingsynchronizationoccursasshowninFig. 1,whereweplot amplitudep = 1.7andduration∆t = 0.4. Notethat,inagreement the master and slave outputsfor a particularvalue of K and withtheleftpanel,thesystemwiththelargervalueofµpulsesbefore τ. Notethattheslavesystemanticipatesthefiringofapulse theonewiththesmallervalue. in themaster bya time intervalapproximatelyequalto τ. If The fact that the response time decreases with lower ex- we increasethe couplingconstantK orthe delaytime τ be- citability threshold, and that in the coupledsystem the slave yond some values, anticipating synchronizationis degraded, can emit pulses that are not followed by a pulse in the mas- i.e.,theslavesystemcanemitpulseswhichdonothaveacor- ter,suggestthatthemechanismforanticipationinthemaster- respondingpulseinthemaster’soutput,althoughthereverse slave configuration is that the slave has a lower excitability caseneveroccurs. UponfurtherincreasingK orτ,theantic- thresholdthanthemaster. Thisissupportedbythefollowing ipationphenomenondisappears. Theresultsareanalogousto thoseobtainedin[9]fortheFitzHugh-Nagumomodel. qualitative argument: Imagine that at t = t0 both systems, − − Inordertounderstandthemechanismoftheobservedphe- masterandslave, are inthe reststate x(t0) = y(t0) = x−. nomenon,weanalyzethebehaviorofthemasteraloneunder Theeffectoftheperturbationchangesbothvaluestox(t+0)= the effectof a single perturbationI(t) = p0δ(t−t0) acting x(t−0) + p0, y(t+0) = y(t−0) + p0. Due to the coupling, at a certain time t . The effect of this perturbation appears the slave can be considered to have at this time an effective 0 onlyasadiscontinuityofthe,say,x(t)variableattimet0 as µeff(t0) = µ+K[x(t+0)−y(t+0 −τ)] = µ+Kp0. Since x(t+0) = x(t−0)+p0. The condition for the perturbation to µeff(t) > µalsoforalltimestsuchthatt0 ≤ t < t0+τ,the belargerthantheexcitabilitythreshold,isthatx(t+) > x . excitability threshold of the slave has been reduced and the 0 + responsetimedecreases. ¿From now on, we set the initial condition to be in the rest state,x(t−0)=x−,suchtheminimumvaluefortheamplitude To givea more rigorousevidencefor this explanation,we in order to excite a pulse is p > 2arccosµ and the system considernowtwocoupledsystems,Eqs.(4-5),inthepresence 0 ofasingleperturbationwhichwechoosetobeapulseofcon- develops a pulse after a certain response time t . This time r can be precisely defined as the time it takes x(t) to reach a stantamplitudepandduration∆t actingattimet0 inwhich − − givenreferencevalue,e.g. xr = π/2. FromEq. (2)wehave bothsystemsareinthereststatex(t0) = y(t0) = x−. The t = π/2 dx whichyields resultsarereportedinfig3. r Rx(t+0) µ−cosx For a sufficiently large perturbation, the master and the slaverespondwithanexcitablespikeandtheslavepulsean- 1 (1−b)(1+b−1tanx(t+0)) ticipates the master pulse (fig. 3a). For small perturbation t = ln 2 (6) r p1−µ2 (1+b)(1−b−1tanx(t2+0)) apmropploitrutidoenanlolyptuolstehseaarpepglieendersattiemdualunsd(bfiogth4csy).stHemowserevsepr,onand intermediateamplitudeof the perturbationtriggersthe emis- whereb =q11+−µµ. InFig. 2(leftpanel)weplottheresponse sionofanexcitablepulsebytheslavesystemwhilethemas- timeasafunctionoftheparameterµforagivenvalueofthe terrespondslinearly(fig3b). Thisconfirmsaloweringofthe 3 FIG. 4: The ratio between the slave and the master excitability thresholdasafunctionof K forτ1 = 0.05, τ2 = 0.2, τ3 = 0.35 andτ4 = 0.5. Consideredsystemhaveparameterµ = 0.95. Per- turbationisappliedattimet0 = 10withmagnitudep = 1.635and duration ∆t = 0.4. The dashed line corresponds to the constant excitabilitythresholdofthemaster. FIG.3: Responseofthemaster(solidline)andslave(dashedline) forthreedifferentamplitudesofthesingularperturbationofduration the anticipation time is approximately equal to τ. However, ∆t = 0.4 at time t0 = 10: (a) p = 1.7, (b) p = 1.65 and (c) p=1.61.Otherparametersareµ=0.95,τ =5andK =0.01. when τ ≫ tr, the anticipation time greatly differs from the delaytime,suchthattheslaveanticipatesthemasterbyatime intervalalwayslowerthant (5c). Thisisa reasonablelimit r excitabilitythresholdoftheslave ascomparedto themaster, totheanticipationtime:thepulsecannotanticipatethepertur- whichissystematicallyfoundforallcouplingparametersthat bationwhichcreatedit. Inotherwords,masterandslaveare yieldanticipatingsynchronization. InFig.4weplottheratio both”slaves” oftheexternalperturbation,althoughthepres- Rbetweentheminimumamplitudeoftheperturbationwhich ence of the master signal into the coupling term contributes generatesanexcitablepulseintheslaveandtheminimumam- to lower the excitabilitythresholdof the slave leadingto the plitudethatgeneratesapulsein themaster. Asshowninthe anticipationphenomenon. figures, the effect of this particular coupling scheme on the slavesystemistoloweritsexcitabilitythresholdinsuchway that the difference between the response time of the master andtheslavetoanexternalperturbationequalsapproximately thedelayinthecouplingterm,τ. Itisworthnotingthatwhen K or τ tend to zero, not surprisingly the thresholds for the slave and the master tend to be equal, while for largevalues ofτ thedifferencebetweenthetwothresholdsisverylarge. Clearly, the same reasoning can be followed if the pertur- bationappliedtobothsystemsisawhitenoiseprocess. This allowsustoexplainwhytheerroneoussynchronizationevents correspond to the slave system firing a pulse that is not fol- lowedbyapulseinthemaster:foraparticularnoiselevelthe master response is proportionalto the perturbationwhile the slave emits an excitablepulse. By increasing the noise level bothmasterandslaveemitexcitablepulses,eachpulseofthe slavebeinganticipatedrespecttothatofthemaster. Since,aswehaveshown,masterandslavesystemsrespond toexternalperturbationswithdifferentresponsetimes,aques- FIG. 5: Two coupled systems (master and slave) with a coupling tionwhicharisesiswhetheritispossibletochosetheparam- parameterK = 0.01anddelaytime(a)τ = 1, (b)τ = 5and(c) τ = 50. Both systems have µ = 0.95 and are perturbed at time eterssuchthattheanticipationtimeisarbitrarilylarge,inpar- t0=60withapulseofmagnitudep=1.7andduration∆t=0.4. ticular,largerthanthemasterresponsetime,τ > t , aresult r thatwouldviolatethecausalityprinciple. Inordertoanswer thisquestion,weplotinFig.(5)theresultsofintegratingEqs. 4,5undertheeffectsofasingleperturbationforthreedifferent Inordertoassessthegeneralityofourhypothesis,wehave valuesoftheparameterτ. Whenτ < t (5a)orτ ≈ t (5b), alsoconsideredtwodelayedcoupledFitzHugh-Nagumosys- r r 4 tems: x3 (x˙ ,x˙ ) = (x +x − 1,ǫ(a−x )) (7) 1 2 2 1 1 3 y3 (y˙ ,y˙ ) = (y +y − 1 +K(x −yτ),ǫ(a−y )) (8) 1 2 2 1 3 1 1 1 In the excitable regime, which occurs when |a| > 1, the system possesses a single steady state. As the critical value |a | = 1 is approached,the excitabilitythreshold is lowered c [15]. In this sense, the control parameter a plays the same roleastheparameterµinAdler’sequation. Infact,we have checkedthatalsointhiscasetheresponsetimeofthesystem toanexternalperturbationdecreasesasthecriticalvaluea is c approached(seeFig.6). FIG.7: Responseofthemaster(x1,solidline)andslave(y1,dashed line)fortwocoupledFitzHugh-Nagumosystemswitha=1.01,ǫ= 0.09,τ = 4,K = 0.1,afterperturbationatt0 = 200byapulseof amplitudepandduration∆t=1.Forlargeamplitude,p=0.4,case (a),bothsystemspulsewhereasforthesmalleramplitude,p= 0.3, thereisonlypulseintheslavevariable. FEDER through projects TIC2002-04255-C04, BFM2000- 1108 and BFM2001-0341-C02-01. S.B. acknowledges fi- nancialsupportfromMECthroughsabbaticalgrantPR2002- FIG. 6: Time series for the variable x1 of the FitzHugh-Nagumo 0329. system for a = 1.01 (dashed line) and a = 1.08 (solid line). In bothcases itisǫ = 0.09. Asindicated bytheverticaldotted line, thesystemisperturbedatatimet0 = 200byapulseofamplitude p=0.4andduration∆t=1.Notethattheresponsetimedecreases withincreasinga. [1] A.Pikovsky,M.RosemblumandJ.Kurths,Synchronization:A universalconceptinnonlinearsciences,CambridgeUniversity Wenowconsidertheunidirectionallydelayedcoupledsys- Press(2001). tem. We find, as in the Adler’s system, that the excitability [2] L. Pecora, T. Carrol, G. Johnson and D. Mar, Chaos 7 520 threshold for the slave is lower than that of the master, as (1997). [3] H. U. Voss, Phys. Rev. E 61, 5115 (2000); Phys. Rev. E 64, shown in Fig. 7 and that the maximum anticipation time is 039904(E)(2001);Phys.Rev.Lett.87,014102(2001). limited by the response time of the master. Finally, we note [4] E.Hernandez-Garcia,C.Masoller,C.R.MirassoPhys.Lett.A thatwehavealsofoundexactlythesamephenomenologyfor 29539(2002) twodelayedcoupledHodgkin-Huxleysystems. [5] O. Calvo, D.R. Chialvo, V.M. Eguiluz, C.R. Mirasso and R. Theubiquityofthiseffectis, inouropinion,anindication Toral,Chaos147(2003) that the lowering of the excitability threshold of the slave in [6] C.Masoller,Phys.Rev.Lett.862782(2001). adelayedcouplingschemeisageneralmechanismforantici- [7] H.U.Voss,Int.J.ofBifurc.andChaos121619(2002) [8] Y.Liu,Y.Takiguchi, P.Davis.T.Aida,S.SaitoandJ.M.Liu, patingsynchronizationinexcitablesystems. Thismechanism Appl.Phys.Lett.804306(2002) allows to explain all the observationsin the regime of antic- [9] M.Ciszak,O.Calvo,C.Masoller,C.Mirasso,R.Toral,Phys. ipating synchronization, in particular the erroneous firing of Rev. Lett. 90 (204102) (2003); R. Toral, C. Masoller, C. Mi- pulsesintheslavesystem.Inaddition,itevidencesthecausal- rasso,M.CiszakandO.CalvoPhysicaA325,192(2003). ityofthisphenomenon: themasterandslavesystemsfollow [10] R.FitzHugh,Biophys.J.,1,445(1961);J.Nagumo,S.Arimoto, theappliedexternalperturbations,althoughtheresponsetime S.Yoshizawa,Proc.IREEaust,50,2061(1962). of the slave system is shorter due to the effects of the cou- [11] A.Hodgkin,A.Huxley,J.Physil.(Lond.),117,500-544. [12] M.Eguia,G.MindlinPhys.Rev.E61,6490(2000). pling. Moreover,wehaveshownthattheanticipationtimeis [13] P.Coullet,T.Frisch,J.M.Gilli,S.Rica,Chaos4,485(1994). limited by the response time of the master system. The rel- [14] A.A. Andronov, E.A. Leontovich, J.J. Gordon, A.G. Maier, evance of this type of mechanism for the synchronizationof ”Theory ofbifurcations ofdynamic systemsonaplane”(Wi- coupledchaoticsystemsisanopenquestionthatwillbestud- ley,NewYork1973). iedinthenearfuture. [15] S.Barland,O.Piro,M.Giudici,J.Tredicce,S.Balle,Phys.Rev. WeacknowledgefinancialsupportfromMCYT(Spain)and E,68,036209(2003).

See more

The list of books you might like