Logout succeed
Logout succeed. See you again!

Electrocatalysts for Hydrogen Oxidation Reaction in Alkaline Electrolytes PDF
Preview Electrocatalysts for Hydrogen Oxidation Reaction in Alkaline Electrolytes
Review CiteThis:ACSCatal.2018,8,6665−6690 pubs.acs.org/acscatalysis Electrocatalysts for Hydrogen Oxidation Reaction in Alkaline Electrolytes Elena S. Davydova,*,† Sanjeev Mukerjee,‡ Fred́ eŕ ic Jaouen,§ and Dario R. Dekel*,† † TheWolfsonDepartmentofChemicalEngineeringandtheNancy&StephanGrandTechnionEnergyProgram(GTEP),Technion − Israel Institute of Technology, Haifa 3200003, Israel ‡ Department of Chemistry and Chemical Biology, Northeastern University, Boston, Massachusetts 02115, United States §Institut Charles Gerhardt Montpellier, UMR 5253, CNRS, UniversitéMontpellier, ENSCM, 34095 Montpellier, France * S Supporting Information s. e cl arti ABSTRACT: In the past 5 years, advances in anion- d 0:06:50 (UTC). y share publishe Sacdcceoeehlvvnlsieederl(vuoaAeclptEmnirvMeeeecanFertlnCymtsoie)dfwmeaonsbartdrtikachvsnaaelnehnsbcaeeevxdghetiangvanseenhinnoioegworn-apon-tefei-oxnltcinhefheadoatpnfegtaArhefffEeooMrrmmddFeaoaCmbnolsecbrerfcauafunoesrelrrsectneaftultthlelesye-l. at 2atel of-the-art proton exchange membrane fuel cells. However, 8 m until now, these high AEMFC performances have been 201giti reached with platinum-group metal (PGM)-based anode and uly 17, ow to le csuatchhocdaetaclaytsatlsyssthso.uInldoinrdtehretonefuarlfiflulttuhreepboetefrneteiaolfoPfGAEMMsFaCnds,, V on Js on h epvroengrtuesasllyh,asfrbeeeenofachcireitviecdalinratwhemdeavteerloiaplsm.eAntlthoofuPgGhMg-rfreeaet N UNIoption hcaytdarlyosgtesnfoorxidthaetioonxyrgeeanctiroendu(cHtiOonR)r.eTachteiomnuinchblaoswicermHedOiaR, asicgtniviifitycaonftlPytleinssbaatstiecnmtioedniahcaosmbpeeanredpawidithtothtahteincaatcaildyswisasofitstehlef TERs for revealed only relatively recently. While several PGM-based composite materials have shown improved HOR activity in basic HEASdeline mfroemdiaP,GthMeHshOaRvekhinitehtiecrstorermesauinltsedsloinwehrigthhaannondeceeossvaerrypfootrenatniaildse,aslignnoifincpaonlatlryizraebdleuceilnegctrtohdeep.eIrnfoardmdaitniocne,oafttPemGMpts-frtoeemAoEvMeaFwCasy. a NORTharinggui Tmenheeimrsgbywraobnuaerldrsietbarsebinlaietyem)dashjotaorvebbbeaerfireirnemrolfyvoeerrscttohambeleils.ahrAegdef-utsnocdaolaevmederecnoptamlolyeumnthdeinesrtcsthoaafnlldtehinnisggeto.efTchthhniesolHroegOvyieRwomnpcerecehsteahnnetissomtthhieenrcbutaersrciehcnnmtouleondgdiaiecaraslntdahnuodrfdintlhegseom(feta.hgine., ed viorg/s HOR electrocatalysis in basic media and critically discusses the most recent material approaches. Promising future research wnloadbs.acs. dKiEreYcWtioOnsRiDnSt:hehyddervoegleonpomxeidnattioofntrheeacHtioOnR,anelieocntreoxcchataanlygestms efomrbaralknaelifnueelecleelcl,traolklyatleinseamreedailaso,eloeucttrloinceadta.lyst,platinum-groupmetal, Dos://pu non-noble p htt e e S 1. INTRODUCTION consider three cases toward PGM-free or Pt-free AEMFCs. In thefirstcase,weconsiderstudieswithPGM-basedanodesand Anion-exchangemembranefuelcells(AEMFCs) havereceived PGM-free cathodes. The power density spans between 50 and increasingattention for more thana decade, mainlybecause of 1500 mW cm−2,12−18 with the BoL performance highly their potential for resorting to electrocatalysts that are free of impacted by the oxygen reduction reaction (ORR) activity at platinum-group metals (PGMs) and, eventually, free of critical raw materials (CRMs).1,2 Recent achievements in developing thecathode.Inthesecondcase,weconsiderstudieswithPGM- anion-exchange membranes (AEMs) with high hydroxyl ion free anodes and cathodes. In this case, the BoL power density conductivity have allowed the fabrication of H -fed AEMFCs spansbetween40and120mWcm−2only,19−21asitisstrongly 2 reaching impressive peak power densities of 1.8 and 0.5 W limited by the very low hydrogen oxidation reaction (HOR) cm−2 with cathodes fed with oxygen and air, respectively.3 activity of PGM-free catalysts to date. As a third case, we However, these recent high beginning-of-life (BoL) perform- considerPt-freeAEMFCswithaPd-basedcatalystateitherthe ances have been obtained with PGM-based catalysts at both anode18,22,23 or the cathode24,25 in combination with a non- electrodes,usuallywithPt/CatthecathodeandPtoraPt/Ru alloy at the anode.4−11 Received: February19, 2018 In an effort to logically organize and summarize the BoL Revised: May3, 2018 performance achieved in previously reported studies, we Published: May31, 2018 ©2018AmericanChemicalSociety 6665 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review PGM catalyst at the opposite electrode. In this case, power environmentat60°Cwasassumedtobe10−4Acm−2 , Pt densities of up to 500 mW cm−2 have been achieved.22 These i.e., ca. 2 times lower than the specific activity of Pt data show that while alternatives to PGMs already exist for nanoparticles at 0.9 V when measured under PEMFC AEMFCcathodes(case1),nocompetitivePGM-freecatalystis conditions at 80 °C (about 2 × 10−4 A cm−2 ).32 This Pt available today for AEMFC anodes (cases 2 and 3). assumption is in agreement with the slightly lower ORR This status can be explained historically, with the quest for activity on Pt single crystals in alkaline versus acidic PGM-free electrocatalysts for the ORR in acidic media having media.32Theseassumptionsresultinthemassactivityat greatlyhelpedindevelopingmetal−N−CcatalystsfortheORR 0.9 V of 50 A g −1, in line with experimentally reported in basic media as well.26−30 The ORR activity of some values in 0.1 MPKt OH.33 pyrolyzed Fe−N−C catalysts is now in fact comparable to, or (b) the Fe−N−C catalyst with the mass activity at 0.9 V of even higher than, that of Pt-based catalysts in basic media. 10 A g−1 (per total mass of catalyst).33 The Fe−N−C While the definition of surface-specific activity does not apply cathode loading was assumed to be 2 mg cm−2 (mostly to Fe−N−C catalysts, it is possible to compare Fe−N−C and carbon, leading to a ca. 50 μm thick cathode layer), Pt/C on the basis of volume-specific activity.31 In contrast, no which is on the lower end of the range of non-PGM suchtransferofknowledgehasbeenpossiblefortheHORfrom cathode loadings but leads to a sufficiently thin cathode acidic to basic media. No PGM-free catalyst has demonstrated layer for proper operation with air. The apparent reasonable HOR activity in acidic media to date. Attempts to resulting activity of such a Fe−N−C cathode is thus 2 developsuchcatalystshavebeenveryscarcebecauseofthevery × 10−2 A cm−2 at 0.9 V. The Tafel slope was also geom fast HOR kinetics on Pt in acidic media, implying that anodes assumed to be 90 mV decade−1 (as for Pt/C, for fair in proton-exchange membrane fuel cells (PEMFCs) require comparison). only an ultralow Pt loading to operate efficiently. The main (c) the40%Ag/Ccatalystwiththespecificsurfaceareaof50 advantage of AEMFCs versus PEMFCs, i.e. resorting to PGM- m2 g −1 and i = 10−5 A cm−2 (based on the above Ag s,0.9V andCRM-freecatalysts,isthusimpairedatthismomentbythe assumed specific activity for Pt and the one-order-of- low HOR activity of PGM-free catalysts in basic media. magnitude lower surface-specific activity for Ag vs Pt34) To illustrate this better, Figure 1 shows calculated polar- and the catalyst loading of 2 mg cm−2 (mass of Ag and ization curves for the anode and cathode in an AEMFC, C). The Tafel slope was also assumed to be 90 mV decade−1 (as for Pt/C, for fair comparison). While not represented in Figure 1, pure Mn oxide and bimetallic MnCo oxides have also shown high ORR activity in alkaline media, especially for nanostructured oxide particles with high surface area. From an analysis of selected literature and with an oxide content of 30−50 wt % on carbon for an optimized fuel cell catalyst, the ORR activity at 0.9 V was estimated to range from ca. 1 to 10 A g −1 for this class of cathodematerial.35−37Foratotalcathodelcoatadingof2mgcm−2 and a Tafel slope of 90 mV decade−1, the resulting calculated polarization curves would range from slightly below the Ag/C oneinFigure1uptotheexactsamecurveascalculatedforthe Fe−N−C one in Figure 1. For the anode catalysts, the following were assumed: (a) the40%Pt/Ccatalystwiththespecificsurfaceareaof50 m 2 g −1 and the exchange current density (i ) of 0.6 Pt Pt 0 mAcm−2,38−41thecatalystloadingof200μgcm−2(mass ofPtandC),andtheexchangetransfercoefficientof0.5 Figure1.PolarizationcurvesfortheHORandORRcalculatedusing (for both the anodic and cathodic directions). the Butler−Volmer equation for the HOR with exchange current (b) theNi/N-dopedcarbonnanotube(Ni/N-CNT)catalyst dsuernfsaictye-(sip0e)caifincdtahcetiTviatfyeleaqtua0t.i9onVforvtsheROHRERw(iithmassoarctiivityor, withi0=0.03mAcm−2,42thesurfaceareaof25m2g−1,a m,0.9V s,0.9V catalyst loading of 1 mg cm−2 , and the exchange respectively), mimicking the best-in-class PGM-based and PGM-free geom catalysts. transfer coefficient of 0.5 (for both the anodic and cathodic directions). The simulations of anode performance based on electro- representing best-in-class PGM-based and PGM-free catalysts. kinetic losses only (Figure 1) illustrate that the slow HOR The main assumptions made for the calculations include the kinetics is projected to cause significant voltage loss for the TafellawfortheORRandtheButler−Volmerequationforthe AEMFC at high current density. These calculations are HOR, a fuel cell temperature of 60 °C, and an AEM consistent with the experimental AEMFC data reported in characterizedbypH13.Forthecathodecatalysts,thefollowing the literature. For example, Sheng et al.38 reported an anode were assumed: overpotential (η) of >130 mV at the anode loading of 50 μg Pt (a) the 40% Pt/C catalyst with the surface area of 50 m 2 cm−2 and 1.5 A cm−2. In addition, Figure 1 shows that even Pt g −1 and i = 10−4 A cm−2 ,31,32 the Tafel slope of with a Pt/C anode and a significant Pt loading of 0.08 mg Pt s,0.9V Pt Pt 90 mV decade−1,33 and the catalyst loading of 600 μg cm−2, the anode overpotential at 1 A cm−2 is projected to be cm−2 (mass of Pt and C). The ORR specific activity at non-negligible. This is in contrast to the case of PEMFCs, 0.9 V (i ) of Pt nanoparticles in the AEMFC where the anode behaves almost as a nonpolarizable electrode. s,0.9V 6666 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review This difference is fundamentally explained by the 2 orders of Pt in acidic electrolytes, the reaction rate in the RDE becomes magnitude lower HOR activity on Pt (and other PGMs) in limited by hydrogen diffusion in the electrolyte toward the basic media compared with that in acidic media (Figure 2). electrode, even at very low overpotentials. The measured polarization curve (see Figure 3A, curve labeled η ) then diffusion Figure 2. HER/HOR exchange current densities measured in 0.1 M NaOH aqueous electrolyte. Data were recorded in a H-saturated 2 electrolyteatambientpressureand40°C.Reprintedwithpermission fromref 45. Copyright 2014Royal Society of Chemistry. WhilenoPGM-freecatalysthasshowndecentHORactivityin acidic media to date, slower kinetics toward the hydrogen evolution reaction (HER) in basic versus acidic media has also beenreportedforPGM-freecatalysts,43,44possiblysupportinga universal effect of pH on the rates of the HER and HOR. In summary, resorting to ultralow or even zero PGM content at the anode of an AEMFC with present PGM- or non-PGM Figure 3. (A) HOR/HER polarization curves on polycrystalline catalysts leads to an unacceptably high anode overpotential. platinum (Pt(pc)) in 0.1 M HClO at 1600 rpm, as measured (solid 4 NovelmaterialsmustbedesignedwhoseintrinsicHORactivity black line, ERDE) and after Ohmic drop correction (dotted red line, is higher than presently reached with existing materials and EiR‑free). The dashed black curve labeled ηdiffusion represents the theoretical curve for which there is no kinetic polarization of the whose surface is not blocked for the HOR catalysis by the electrode, only H concentration polarization. The inset shows the formation of oxide at low overpotential. 2 Koutecky−LevichplotobtainedatE=0.1VvsRHEfortheHORat In order to help foster rational approaches for the differentrotationrates.(B)HOR/HERpolarizationcurvesonPt(pc) development of highly active PGM-based and PGM-free in 0.1 M KOH at 1600 rpm.Reprinted with permission from ref 38. catalysts, this review covers a series of aspects of the HOR Copyright 2010 The Electrochemical Society. electrocatalysis, including the hypothesized HOR mechanisms in basic media and the effects of electrocatalyst affinity toward hydrogenorhydroxylchemisorptionontheHORkinetics.The only reflects a hydrogen concentration polarization that is not already developed mono- or bifunctional HOR electrocatalysts arereviewedinthelightofthisunderstandingandareclassified related to the kinetics (eq 1): accordingtothemechanismsbywhichtheycatalyzetheHOR. RT ⎛ i ⎞ η = ln⎜1 − ⎟ 2. ROTATING DISK ELECTRODE AND ALTERNATIVE diffusion 2F ⎝ ilim⎠ (1) METHODS TO MEASURE THE HOR ACTIVITY Thus, quantification of the HOR kinetics by the RDE method The rotating disc electrode (RDE) technique is the most is difficult for very active catalysts.38 This was explained only common experimental technique applied for the HOR kinetic recently to lead to a broad range of experimentally reported studies in liquid electrolytes.38,46,47 Applying the well-known values in acidic electrolytes.48,49 This limitation of the RDE Levich and Koutecky−Levich equations, one can correct the method is currently less important for PGM-based and even measured I versus E polarization curves for (i) Ohmic drop in more so for non-PGM-based HOR catalysts in alkaline media theelectrolyte(typically10−20ΩinRDEsetupsdependingon becauseoftheirloweractivity.ThisisshowninFigure3Bfrom the nature and concentration of the electrolyte, resulting in a the large positive shift of the experimentally measured RDE maximum Ohmic drop of ca. 10 mV at the diffusion-limited polarizationcurvesrelativetothetheoreticalcurveexpectedfor current density for an RDE tip geometric area of 0.2 cm2) and H concentration polarization only (eq 1). 2 (ii) the H diffusion limitation and extract the kinetic current In the future, for highly active HOR catalysts in alkaline 2 density values (polarization overpotential). One general electrolytes with i values too high to be measured with the 0 precaution to recall when applying the RDE to the HOR RDE technique, transient techniques such as rapid potentiody- reaction (a sometimes quasi-reversible reaction, depending on namic scanning50,51 or other steady-state methods that allow thecatalystandelectrolytepH)istheimpossibilityofassessing highermasstransport(microelectrodes)maybeused.48Forthe the HOR activity for catalysts whose exchange current density HOR kinetics evaluation on powder catalysts, the cavity is commensurate with or higher than the diffusion-limited microelectrode technique, which was developed for both currentdensity,i .Forexample,asaresultofhighi valueson liquid52 and solid electrolyte conditions,53,54 is also applicable. lim 0 6667 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review Figure4.(A)Structureoftheworkingelectrode,madeupofcatalystdepositedontoagold-coatedporouspolycarbonatetrack-etchmembrane.The poresarecoatedwiththehydrophobicamorphousfluoropolymertokeeptheporesopenforreactantgas(inthiscaseoxygen)toflowtothecatalyst from behind. (B) Comparison of the HOR polarization curves measured by the floating electrode and RDE methods using 2.2 μg cm−2 Pt/C Pt catalystat 10 mV s−1 at 298 K. Reprintedwith permission fromref 55. Copyright 2013The PCCP Owner Societies. As an alternative to the RDE method, the floating electrode an ultralow loading, e.g., 3 μg cm−2) while the cathode is Pt techniquewasproposedbyZalitisetal.55inordertoinvestigate coatedwithhighloadingofPt/C(e.g.,0.4mg cm−2),defacto Pt the HOR electrocatalysts. It combines the high mass transport acting as a reference electrode.57 By the use of this H pump 2 ratecharacteristic ofgas-diffusionelectrodesinfuelcellswitha method with an AEM, the i value of the HOR on Pt/C 0 flat, uniform, and homogeneous catalyst deposition process. interfacedwithananion-exchangeionomer(AEI)wasreported This approach closely mimicks the operating conditions of for the first time.58 It was found that the HOR activity at the AEMFCs or PEMFCs (gas-fed electrodes). Uniform Pt layers Pt/C−AEI(TokuyamaA201)interfaceisalmostthesameasin were produced with loadings down to 0.16 μg cm−2 and a 0.1MKOH,bothactivitiesbeingnearly2ordersofmagnitude Pt lowerthanthatmeasuredinacidicelectrolytes,eitherthePEM thickness of 200 nm on polycarbonate track-etch membrane filter/Aufloatingelectrodes(Figure4).TheHORrevealedfine electrolyte (Nafion 211) or 0.1 M HClO4. structure in the diffusion-limited current range and an 3. GENERAL PRINCIPLES OF THE HOR IN BASIC asymptotic current decay for potentials above 0.36 V due to MEDIA theformationofoxidesontheplatinumsurfaceandadsorption ofanions,whicharenotvisiblewithtechniqueslimitedbymass 3.1.PathwayoftheHORinAlkalineMedia.Itiswidely transport in aqueous media such as the RDE method. agreed,atleastforinorganicmaterials,thattheHORinalkaline media proceeds through a combination of the following Kinetic data on the HOR have also been obtained in single- elementary steps: (A) dissociative adsorption of molecular cell fuel cell applying the electrochemical hydrogen pumping mode(Figure5).56Inthesesystems,hydrogenoxidationoccurs dihydrogen, (B) electron transfer from molecular dihydrogen to the catalyst, and (C) discharge of the adsorbed hydrogen attheanode(workingelectrode)andhydrogenevolutionatthe atom. Hereafter we describe these three steps. cathode, with protons or hydroxyl ions transferred via the (A) Dissociative adsorption of molecular dihydrogen, H , proton-exchange membrane (PEM) or AEM, respectively. In without electron transfer, which is known as the Tafel (T2) order to study the HOR kinetics, the anode is coated with the reaction59 (eq 2): HOR catalyst under investigation (for PGM-based catalyst, at H2 + 2* → 2(*−Had) (2) whereH ismoleculardihydrogeninthevicinityofthecatalyst 2 surface, * is an active site, and H is a chemisorbed hydrogen ad atom(oradatom).ThedissociationenergyoftheH molecule 2 is4.52eVataseparationof0.74Å.60Oneoftherequirements imposed on the catalytic materials is affinity toward molecular hydrogenchemisorption.Therefore,the*−H bindingenergy ad is believed to be a crucial factor controlling the HOR kinetics.39,61 The surface intermediate of adsorbed hydrogen onPtmicroelectrodeswasshowntobeindependentofsolution pH.62Also,aswasrevealedpreviouslyforchalcogenides(RuS , 2 Co-doped RuS ),63 the ability to dissociate H at room 2 2 temperature is a necessary but not sufficient criterion for the HOR catalyst. Figure 5. Representation of a PEM device operating in hydrogen pumping mode. Humidified hydrogen is fed at the anode, and dry The dissociative adsorption of the diatomic molecule H2, a nitrogenisfedatthecathode.Thehydrogenmoleculedissociatesinto central step in many industrially important catalytic processes, protonsandelectronsattheanode,andthelatterrecombineintoH isgenerallyassumedtorequireatleasttwoadjacentandempty 2 at the cathode. atomic adsorption sites (or vacancies).64 The need for 6668 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review ensembles of PGM atoms is experimentally supported by the controllednumberofadjacentactivesites(havinginitiallyhigh lack of the HOR activity of Pt atoms atomically dispersed as HBE) “diluted” by inactive atoms in order to tune the HBE. PtS moieties on a sulfur-doped carbon matrix.65 H is known (B) Electron transfer from molecular dihydrogen to the 4 2 tobe achemically reactive gas, which adsorbs dissociatively on catalyst, which is known as the Heyrovsky (H) reaction69 (eq most transition metal surfaces with heats of chemisorption 3): between 60 and 120 kJ mol−1. For example, according to the linear dependence θ − p 0.5,64 hydrogen is considered to H2 + OH− + * → (*−Had) + H2O + e− (3) H H2 − adsorb in the atomic state. whereOH isinthevicinityofthecatalystsurface.Thespecies According to Christmann,66 the preferential adsorption site is argued not to be OH− but most likely OH .18,22,70 If this is ad has high coordination. Threefold sites are favored on diagonal, the case, the H reaction could be written as eq 4: trigonal,andhexagonalsurfaces,whilefourfoldsitesaretherule for tetragonal surfaces. The latter should therefore adsorb H H2 + (*−OHad) ⇄ (*−Had) + H2O (4) 2 more strongly for a given metal. There is ample evidence that withtheassumptionthatthereactionisprecededbyhydroxide strong chemisorption of a hydrogen atom requires three to adsorption (eq 5): seven adjacent metal atoms, coined as the ensemble effect.67 Mitsuietal.68haveshownthatthecreationofactivesitesforH OH− + * ⇄ (*−OHad) + e− (5) 2 dissociation involves the formation of individual vacancies and Thus, it is supposed that the catalyst surface should be their subsequent diffusion and aggregation, with the coupling oxophilic, or “hydroxophilic”, in order to provide bifunctional between these events determining the activity of the catalyst catalysis (Figure 6),22,70,71 which will be discussed in section surface. Their scanning tunneling microscopy observations of 4.2.Inalkalinemedia,thecatalyticsurfacehastoprovideactive the transient formation of active sites for the dissociative sites for the coadsorption of hydrogen atoms and hydroxide adsorption of H molecules on Pd(111) revealed that two- 2 species, whereas in acid all of the accessible active sites are vacancy sites are inactive. Two-vacancy sites have low H 2 destined to uniquely chemisorb hydrogen atoms. This could sticking probability and zero H adsorption events (Table 1). 2 explain, among other reasons, why catalysts exhibit several times to several orders of magnitude lower electrochemical Table 1. Active-Site Statistics for Vacancy Clusters for HOR activity in alkaline environments compared with acidic Pd(111) at 65 K in 2 × 10−7 Torr H2 As Determined by environments (Figure 2).38,39,45,58 Scanning Tunneling Microscopy with a Frame Time of (C) Discharge of the adsorbed hydrogen atom (H ), which 75 s68 is called the Volmer (V) reaction72 (eq 6): ad vmaecaanncaydcsolursptteironsizteim(eat(osm)s) 2>2×104 3330 4150 5120 (*−Had) + OH− → * + H2O + e− (6) H stickingcoefficient <0.0001 0.005 0.008 0.008 Nondissociative adsorption of hydrogen to form a hydrogen 2 meanclusterseparationtime(s) 590 710 670 820 moleculeionintermediatewasalsoproposedbyHoriuti73,74as therate-determiningstep(RDS)forsomesubstratesaccording to the following reactions (eqs 7 and 8): AregqguriergeadtefsorofeffithcrieeentorHmodriesshoycdiartoiognen. Avtachanigchieesr acroevethraegreesfooref H2 + * ⇄ H2M → H+2M + e− (7) 2 Had, indirect interactions come into play, which are in most H+M ⇄ MH + H+ (8) casesrepulsive.Theyleadtoasubstantialloweringoftheinitial 2 metal−hydrogen binding energy (HBE), a phenomenon called The essential feature of the Horiuti mechanism is that the inducedsurfaceheterogeneity.Consequently,weaklyheld(and hydrogen molecule adsorption step is not accompanied by chemically reactive) hydrogen species are formed. The hydrogen dissociation and requires only a single-atom catalyst observations made by the authors68 might be used as an for the reaction. In the Heyrovsky−Volmer (H−V) sequence, approach to synthesize new electrocatalytic materials with a hydrogen adsorption is dissociative but requires only a single Figure6.SchematicrepresentationsofthehypothesizedbifunctionalmechanismintheHORelectrocatalysison(A)Pd/C−CeO,(B)PdNi,and 2 (C) Ni(OH)/Pt(111). CeO in (A), Ni in (B), and Ni(OH) in (C) provide the active sites for adsorption of reactive OH , and Pd (or Pt) 2 2 2 ad providestheactivesitesfordissociativeadsorptionofH andproductionofH ,whichthenreactswithOH .Reprintedwithpermissionfromrefs 2 ad ad 18and 70.Copyright 2016Elsevier and 2013Springer Nature,respectively. 6669 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review site. Only the Tafel−Volmer (T−V) sequence requires dual g n dtarmpdeAfstrorieienliriotlaeffsaueaoteoITnnshcccctensvdos.ththot,ridifricideieoacueoo7swinenarn5goncc.dthtihsphixsiutiaWvmooicerotbdetfhrsimhrnsyaioesbto.eticnnhieabitmchsoTtrhlaeaeeaetneubhdplhmtteiearenbPtshlatirnoreeeswtaotahsasoaeitriteunssyrermtsetueoeydgplgynsrfgerbtatfwioaeponea-omtsnsgclitrfnhuiltheeeeoeleserna.ievraebghoddetsheynhdsueRTtbodtairrhgsh−DoirtrPiesnboaovroVtSsgtefegcur,,sdne7imtiacintah6tnthhHhetbeaeieysgtyvs−tddheemnohfrieVreiofffaeotqros,trueyetgaelgerdse9ebsaahepucen:nssndy5lue-otd1dtaopagsnlfisterrahcooeetHtaetinmahgxhsootoceoeeeneoslxnrturfiioThRuddctdnyetopaeDhiidlatusrPaeSitnrsonlco(thodo,dvtHnewgrcttio.deihhboaH7aVnneeee)6s- ExpectedConsequencesThereof hypothesizedconsequences 1.Dual-siteadsorption. ff2.Noelectrolyteeect. ff3.Nosupportmaterialeect. ff4.Nosizeeect. ff5.Nospillovereect.*−6.TheHbindingenergyisthecrucialfactoradcontrollingtheHOR/HERkinetics.1.Dual-siteadsorption.ff2.Spillovereect. *−3.TheHbindingenergyisthecrucialfactoradcontrollingtheHOR/HERkinetics.*−4.OHadsorptionisthecrucialfactorcontrollitheHOR/HERkinetics. d1tNdscRhwwisweo0ieyohhsaqncdo:tcsOeei4u1ahasrshrr9detoeeeHea=aa+neglrnnfe−cecgθtdcn=eh1neaisl)tFiica,mrSRiocrwkoasatrgofTan−onenicertHtdsn/sdHhdhipFeeti22teeonr(xh,hktacp1hnganheantc(arieo−sitvgs−astp5fveooen1aTot2eloθrydhllrpfsdy,)ηtaeorchrcg)okaoel−nreeibncpayenu=ecasoffiemnvoattelsaoiaaFrncfeoirblleg0ikludneeifiotpcneenrhθttutrxehtheaoo2soposealpffoy(pftmoe2fttlatlhsahttαeehneottheetcfheidoaeηntee,dlrtH)uRxhowiTmpcRsDenOuieastDSrRrfhage(ifinSamnalPtfos,cdoht-etens(plhlenlelpochoetabPecaapawdRxy)tlstehits).enDdroaatgaA(Sdhikdct7n,iiatestnc0ioadootTe1nrion(trrbmd−1ti(eaceehM09otcVVsαdqee))tf. fitsinBasicSolutionsConrmedExperimentallyand experimentalevidence↔1.TheHORrateisclosetotheHDexchangerateinthegas2251phase.2.TherateofoxidationofpreadsorbedHisatleastanorderofad76magnitudegreaterthantheHORrate.*−3.TheHORissize-independent,whileoxidationofHisad38size-dependent.θawithaslope4.ThereisalinearcorrelationbetweeniandHUPD46of2.625.iisnotpH-dependent.0 fi−391.GoodtofthedatatotheButlerVolmerequation.2.ThereisacorrelationbetweentheHORactivityandtheHBEa39derivedfromtheHpeakpotential.UPD3.IdenticalactivitiesaredeterminedfromtheHORmeasurements45chargetransferresistance.andtheHUPD values i = 0.233 mA cm−2 , n = 2, and α = 0.43. ys 0 Pt al The reported data on the HOR kinetics and mechanism for at −e platinum-based electrocatalysts in basic media in the temper- oc + ature range of 2−70 °C are summarized in Table S2. ectr HO2 ThissectionhassummarizedthepossibleHORmechanisms El + * in alkaline media, considering in detail the Tafel, Heyrovsky, d e → Volmer, and Horiuti mechanisms. Experimental evidence for as − B H eachmechanismisprovided,whichreveals,asoutlinedinTable t- O 2, that the HOR mechanism is still disputable, even for well- P + n ) studied Pt catalysts. In the next section, more attention is paid o Had to the role of dissociative chemisorption (Tafel reaction) of ms *− hydrogen on the kinetics of the HOR. nis ):( atHshcclhtaehriohneanenaOanesdt3nddgHHtemdR.drlbct2tieo22Hshiotoec.ikgeero⇄+yaieiaennmlnnTdHn−mes2hreeht2fBtsoOhoietieoiHhtsEcaegutyrreHsleme+,nhel.iHrls−idnocWg+totcEaoghhh⇄adtBemhRealsto2yynatuii/elpnlneeffi2Hyeib−limdaHeasxtetcOitxiirmhepissn2eesaitRcrOsgnieioacnntp(sbmfsr+Ecerbodeabee.aniabweameoyNc2selseetcfeeoerbeir.r−vgtoffvie(aHuipHfeytelltylstre.qyiorutctttudhSroceoo1eeohrrnotc1poloomaelf)ogomgtsaeaeletsraeoonlo,nnyangmtsntesdiuhuiditrocottseereiimhaC,fdlensaylHocsheecerraldteetBisiocacnbesmEil.ructedl)uieslricdaunrfs(tctiamerhdomhechcfseeqaareiece3ntrpcrsrm9ae1eemit,lp((4fos2yirio115toatcefs)h,oo12ri7atan:neea))7srrll Table2.SummaryofProbableHORMecha HORmechanism*→*−dissociation(Tafel):H+22(H)dual-siteH22ad dual-sitedischargeofadsorbedhydrogenatom(Volmer aHdenotesunderpotential-depositedhydrogen.UPD 6670 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review The HBE has a pure thermodynamic definition, sometimes interpreted as the reaction enthalpy (eq 13 or the simplified form,eq14)orasthemetal−hydrogenbindingenergy(eq15): ΔH = − E F − TS° /2 + gRT H H H (13) ad UPD 2 where ΔH is the enthalpy of hydrogen adsorption, E is Had HUPD the potential (vs the reversible hydrogen electrode (RHE)) of underpotential deposition (UPD) of hydrogen, S° is the standard entropy of H adsorption (−130.684 J moHl2−1 K−1), 2 and g is a dimensionless interaction parameter in the frame of Frumkinadsorption(g<0forattractiveinteractionsandg>0 for repulsive interactions);61 ΔH = − E F − TS° /2 H H H (14) ad UPD 2 for the Langmuir isotherm of adsorption (with g = 0); E = −D /2 − E F − TS° /2 Figure 7. Experimentally measured HER/HOR exchange current M−H H2 HUPD H2 (15) densities (marked as dots) over different metal surfaces in acid twhheedreissEoMc−iaHtioisntheneemrgeytaol−fthhyedHrogemnobleicnudlieng(4e3n2erkgJymaonld−1D).H612,7i8s slionleutiisotnhse,psilmotpteledkaisneatifcunmcotidoenlopflotthteedcaelicthuelarteadsaHfBuEnc.tTiohneosfotlihdebfrlueee 2 energyforhydrogenadsorptionaccordingtoeq17orasafunctionof Certain formulas can be obtained, for example eqs 1639 and HBE. Reprinted with permission from ref 79. Copyright 2005 The 17,79 to estimate the i0 value, which is the kinetic parameter at Electrochemical Society. or near equilibrium conditions (zero overpotential): ⎛ βFE ⎞ estimated from the HUPD peak potential values given the i = A exp⎜− peak⎟ assumption that H is identical to the HOR intermediate. 0 ⎝ RT ⎠ (16) Though the bindingUPeDnergy values are scattered depending on the type of material (bulk, pc, facet), the nature of the H where E is the potential of H desorption;39 peak UPD adsorptionsite(ontop,face-centeredcubic(FCC),monolayer i = k 1 exp⎛⎜−ΔGHad⎞⎟ v(MaluLe)s,eatrce.),caonrrdeltahteedcowveitrhagethoeftahteomsuicfacneubmybHerasd(oθf),tthheemHBaiEn 0 01 + exp(−ΔGHad) ⎝ kBT ⎠ components, as illustrated in Figure 8. The main components kBT (17) arerepresentedby18differentelementsofperiod4(Ti,V,Cr, where k is Boltzmann’s constant and ΔG is the free energy Fe, Co, Ni, and Cu), period 5 (Mo, Ru, Rh, Pd, and Ag), and B Had period 6 (W, Re, Os, Ir, Pt, and Au) that are potentially of hydrogen adsorption, which is described by the equation ΔGHad= HBE + 0.24 eV. A volcano-type correlation between coofnthsiedierrheidghasHc2omstipcokninegntpsroobfathbeiliHtyO(oRreslteiccktrioncgactaoleyffistcsibenect,aui.ese., the HBE values and exchange current densities with the theratioofthenumberofparticlesbeingboundtothenumber maximum at ΔGHad ∼ 0 eV was observed for the HER and hitting the surface).66 HOR (Figure 7).79 This section has provided the key equations relating The HBE is a thermodynamic parameter that can be thermodynamic parameters of the hydrogen adsorption/ employed to predict either the HOR or HER kinetics near desorption process such as the HBE, metal−hydrogen binding equilibriumwithoutdistinctiononthenatureoftheelectrolyte energy, and free energy of hydrogen adsorption. An extensive (acid or basic medium). However, this does not necessarily number of reported HBE values, along with other thermody- mean that the HBE values might be used to predict the HOR namicparameters,boththeoreticalandexperimental,havebeen kinetics far from equilibrium. Moreover, equality of the summarizedforaseriesofcatalysts(elementsofperiods4−6), theoretically predicted exchange current density values for the taking into account the type of material, nature of adsorption HORandHERdoesnotnecessarilyimplythesimilarityinthe site,andthecoverageofthesuface.TheHBEvalueshavebeen, kineticsandmechanismofthereactions.Forinstance,itiswell- within each given period of elements, successfully correlated known that the HER kinetics on Ni-based electrocatalysts with the atomic numbers of the elements, identifying Ni, Pd, suffers from deactivation via nickel hydride formation,80 and Pt as potentially highly reactive metallic elements for the whereas the HOR kinetics is limited by the surface passivation HER/HOR catalysis within the corresponding transition metal via nickel hydroxide formation.81 Another example supporting groups. Equations to calculate the values of exchange current this is given by Vilekar et al.82 in a theoretical study to explain density of the HOR, given the Tafel mechanism of the HOR, the strong asymmetry observed in current versus potential have also been given in this section. Since HBE is still curvesfortheHERandHORbranchesonPtin0.5MNaOH. considered one of the key HOR descriptors, the summarized The authors found that the H−V pathway is dominant in the data may temporarily serve as a useful reference database for regions −0.3 to −0.24 and +0.13 to +0.3 V vs RHE, whereas future studies. theT−Vmechanismdominatesintheregions−0.1to0Vand 3.3. Effect of Underpotential- and Overpotential- 0 to 20 mV vs RHE.82 DepositedHydrogen.TheHORoccursatpositivepotentials ThemajorityofHBEvaluesreportedintheliterature(Table with respect to the RHE. Thus, overpotential-deposited S1)weredeterminedtheroretically,withtheexceptionofsome hydrogen (H ), which is believed to form at negative OPD studies39,77,83 where the thermodynamic parameters were potentials and to precede the HER84 (the existence of the 6671 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review Figure8.PeriodicdependenceofselectedtheoreticallycalculatedHBEvaluesfordifferentelements:(A)period4:Ti,V,Cr,Fe,Co,Ni,andCu; (B)period 5: Mo, Ru,Rh, Pd, and Ag;(C) period 6:W, Re,Os, Ir, Pt,and Au. speciesisdisputedintheliterature),45isoutofthescopeofthe morepositivethantheRHErevealsthatnotallmaterialshaving current review. Cyclic voltammetry in the range of potentials high H sticking probability66 are able to host the so-called 2 6672 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review underpotential-deposited hydrogen atoms (H ). As an covered by H . On Pt(100) and Pt(111), the HOR onset UPD UPD example of such materials, we can find Re,85,86 Ni,87,88 appeared to correlate with the desorption of H . The UPD Fe,89−91 and Ti−Ni.92 Thus, H in aqueous solution is a Pt(111) surface with H coverage higher than 0.5 ML was UPD UPD phenomenon characteristic of certain metals,84 such as Pt,38 shown to be almost completely inactive for the HOR. Kinetic Rh,93 Pd,39 Ru,94 Ir,61,95 and Mo,96 both in acidic and basic analysis according to the empirical relation between H and UPD electrolytes. The origin of hydrogen underpotential deposition the number of bare Pt sites available for H dissociation (eq 2 ispurely thermodynamic; onthe other transition metals,H 18), UPD formation does not take place in the same or other potential H = i × (1 − θ )m regions because ofthe electrosorption ofO-containing species, UPD θHUPD=0 HUPD (18) namely, oxygen or hydroxide, which is energetically more favorable. Thus, the effect of HUPD formation can be ruled out rseitveefaolermdtohfatthPet(T1−11V)sienqauleknaclienewistohlumtio=n2f,owllhoewrseatshethiedePatl(d1u1a0l)- in the case of non-PGM catalysts but cannot be straightfor- surface does not fit the model in the sense that m = 0.5 does wardly excluded for PGMs. not have a physical meaning. Marković et al.46 hypothesized AninterestingquestionconcernstherolethatH mayplay UPD that there are sites for H dissociation on the Pt(110) surface in the electrochemical oxidation of hydrogen molecules. It is 2 that are not occupied by H , although a full monolayer of believed that the electrocatalytic oxidation of hydrogen UPD hydrogen is adsorbed. moleculesonPtessentiallyinvolvesatomicHinachemisorbed Strong inhibition of the HOR in the H potential region state, Pt−H , as a reactive intermediate. There are debates in UPD ad was also observed for Pt(111), Pt(100), and Pt(110) single- the literature on the chemical nature of Had,48,50,84 and crystal surfaces in 0.1 M KOH over the temperature range 2− currently there are two viewpoints. In one, HUPD is considered 60 °C;97 however, it was also proposed that OH coadsorbs as the intermediate involved in the HOR;84 in the other, it is with H onallthreesurfaces inthe H potentadialregion,98 UPD UPD believed that another form of adsorbed hydrogen acts as the accordingtothesignificantreactionratesofCOoxidationatE intDerimffeerdeinatteisaontdheHrmUPsDfaocrtsHaUsPaDbalnodckivnegryindteiffrmereednitatree.4a6c,9ti7vity <be0fo.1reVt.hAesoannseitnodfirtehcet pHrEooRf,wthasedmeatexrimmuinmedcotovebraeg0e.8o2f,H0.U7P8D, values for the HOR were obtained for Pt(111), Pt(100), and and0.65MLonPt(110),Pt(100),andPt(111),respectively(1 Pt(110)single-crystalsurfacesinbasicmedia(Figure9).46The ML ≡ 1 H per Pt), the rest likely being covered by OH . UPD ad HOR was shown to occur on Pt(110) even on a surface fully FortheHOR,theH reactioncanformallybeconsideredas UPD the Volmer reaction, which is the RDS. To support this hypothesis, Durst et al.45 compared the charge transfer resistance(CTR,R )fortheH reactionwiththeexchange CT UPD current density of the HOR/HER, derived from eq 19: RT i RT 1 i = × = × 0 F η F R (19) CT The exchange current density values for the Volmer reaction estimatedbyDurstetal.areverysimilartotheHORexchange current densities of ca. 200 mA cm−2 on Pt/C. In 0.05 M NaOH, the charge transfer resistance of 13−54 Ω cm−2 obtained on single-crystal Pt surfaces99 corresponds to 0.2− 0.5mAcm−2 whichisveryclosetothevalueof1.0mAcm−2 Pt Pt obtained for Pt/C in 0.1 M NaOH. One possibility for the reducedrateoftheVolmerstepinbasewouldbeahigherPt− Hbondstrength,whichwoulddecreasetheHORrate.Ahigher Pt−H bond strength is confirmed by the positive shift of the H peakswithrespecttotheRHEwithincreasingpH.These UPD shifts on Pt(553) and Pt(533)100 as well as on Pt(pc),101 amountto−10and−11mVvsRHEperpHunit,respectively (see other values of d(HBE)/d(pH) in Table S2). The H UPD peak shift translated into an HBE difference of 12.5−13.5 kJ mol−1 from pH 0 to pH 13. If the difference in the HBE is assumed to be proportional to the difference in the activation energy (according to the Brønsted−Evans−Polanyi relation- ship),102 then the difference in the HOR rate between pH 0 and pH 13 for Pt would amount to a factor of 120−200. This difference is in good agreement with the 210-fold difference in i values at pH 0 and pH 13 (see Figure 2),45 0,313K strengthening the hypothesis that the Volmer step is the RDS for the HOR on Pt. Figure 9. (A) Plots of the charge associated with the underpotential Itshouldbementionedthattheconclusionsonthenatureof depositionofhydrogenandadsorptionofhydroxylspeciesonPt(hkl). (B) Polarization curves for the HOR on Pt(hkl) in 0.1 M KOH at the RDS of the HOR, even for Pt, are still controversial. For 3600 rpm. Reprinted with permission from ref 46. Copyright 1996 example,ConwayandTilak84indicatedthat“thereseemstobe RoyalSociety of Chemistry. no dispute regarding the mechanism of the HOR on Pt (and 6673 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690 ACS Catalysis Review Pt-alloys) being rate-determining dissociative adsorption of Insummary,inthissectiontheeffectofH onthekinetics OPD H ”, referring to other studies50,51 to provide rationale for the inthepotentialrangeofhydrogenoxidationhasbeenruledout. 2 statement.Vogeletal.50andRossandStonehart51haveshown The section has discussed the role of H , which is UPD that the electrochemical reaction rate parameters are the same experimentally detected only for certain catalytic materials on smooth Pt, unsupported Pt black, and Pt crystallites such as Pt, Rh, Pd, Ru, Ir, and Mo and, to the best of our supportedongraphitizedcarbon. ThiscorrelateswiththeH − knowledge, is not detected on Ni-based materials. Thorough 2 D exchange in the gas phase both with and without literature analysis revealed two main contradicting hypotheses 2 chemisorbed carbon monoxide and is dependent only upon on the role of H in the HOR, namely, H as the UPD UPD thesurfaceareaoftheplatinumcatalyst.Therefore,theRDSfor intermediateinvolvedintheVolmermechanismversusH as UPD hydrogenmoleculeoxidationonPtwasassumedtobethedual- the blocking intermediate, with the second hypothesis being site dissociative chemisorption of the hydrogen molecule (H more likely. 2 → 2H+, i.e., the Tafel reaction). In recent work, Zheng et al.39 and Bhowmik et al.77 are inclined to directly relate the HBE 4. HOR ELECTROCATALYSTS value, which is considered to be linearly dependent on the 4.1. Overview of Different Material Classes. This H desorptionpotential,totheHORcurrentdensityinbasic UPD sectionsummarizesthemaintypesoftheHORelectrocatalysts media.ThismeansthattheVolmerreactionisconsideredtobe for alkaline media that have been investigated hitherto. Figure thehydrogenoxidationreactionRDS.Sincethesurfacesofreal 11 shows the element-based classification used in the present catalysts comprise sites with different specific activities (or reviewtodiscussthecharacteristicsandopportunitiesforthese turnover frequencies), an approach was proposed to correlate different state-of-the-art PGM and non-PGM HOR electro- the HOR activity and the number of active sites with similar catalysts. HBE.61 4.1.1. Platinum-Based Catalysts. As evidenced by the HUPD desorption profiles for Ir/C catalysts were deconvo- activity values presented in Tables S2 and S3, platinum is the luted into three peaks (likely to be for the (110), (111), and most active catalyst for the HOR in terms of exchange current (100) facets in the order of increase of the HUPD desorption density (Table S2) or mass activity at low overpotential (η = peak).103ThepopulationofsiteswiththelowestHBE,namely, 0.05or0.1V)(TableS3).DifferentformsofPt-basedcatalysts Ir(110) with an HBE value of −0.33 eV, was suggested to be were investigated to catalyze the HOR in basic electrolytes, responsiblefortheHOR.AsshownbyShengetal.,83theHOR including Pt(hkl) single-crystal facets,97 bulk/polycrystalline activityforpolycrystallinePtobtainedusingtheRDEmethodis Pt,49 carbon-supported Pt,39,40,45 Pt−metal alloys,6,105 Pt found to decrease with the pH. At same time, the HBE adlayers/islands,40 and core−shell structures.41,106 obtained from cyclic voltammograms (CVs) linearly increases Despite numerous studies on Pt-based materials, the details with the pH in buffer solutions (pH from 0 to 13) with the oftheHORmechanismandthenatureoftherate-determining slopes of −10 meV vs RHE per pH unit for Pt(110) and −8 step are still debated. The controversy arises over the meV vs RHE per pH unit for Pt(100). magnitude of the exchange current density i (discussed in 0 The universal correlation between i0 and HBE, which was section 2), the predominant mechanism (T−V, H−V, or dual- directly derived from the HUPD desorption potential value, pathT−V+H−V),andthenatureandcoverageofthereactive observed on Pt/C, Ir/C, Pd/C, and Rh/C catalysts (Figure intermediate H (see section 3.3). Conway and Tilak84 10)39 indicates that the HOR on those metals may share the ad summarized kinetic data for the HOR and concluded that the HORrateonPtisdeterminedbythedissociativeadsorptionof H .SincetheydidnotobserveapHeffectontheHORkinetics 2 onPtwhenmeasuredatdifferentpH>4(Figure12),Bagotzky and Osetrova62 came to the same conclusion. TheHORrateonasmoothPtsurfacewasshowntobeclose to the rate of hydrogen dissociation (i.e., the rate of H −D 2 2 exchange) measured in the gas phase (Figure 13).51 These results indicate that the electrolyte (in the pH range below 4) and/ortheelectrifiedinterfacedoesnotaffectthenatureofthe potential energy along the hydrogen−platinum reaction coordinate. This also leads to the conclusion that the HOR mechanismoversmoothPtislikelyaslowdual-sitedissociative adsorption of a hydrogen molecule followed by fast electro- chemical oxidation of H to H O+. ad 3 Figure 10. Correlation between the HOR/HER exchange current The HOR kinetics on Pt(pc) in 1 M KOH fits a direct density on Pt/C, Ir/C, Pd/C, and Rh/C and the HUPD desorption discharge mechanism identical to the overall reaction H2 + peakpotential. Reprinted fromref 39. 2OH− ⇄ 2H O + 2e−.49 It seems that the step of extracting 2 two electrons directly from H is slow, with an exchange 2 current density of 0.233 mA cm−2. Since essentially identical samereactionmechanism.Zhengetal.39assumethattheHOR values of the HOR specific exchange current density (0.69 ± proceedsviatheT−Vpathway,withtheVolmerreactionbeing 0.01 vs 0.57 ± 0.07 mA cm−2; Table S2), activation energy the RDS, and that the mechanism through which pH affects (28.9 ± 4.3 vs 29.5 ± 4.0 kJ mol−1), and charge transfer HBE is likely to be metal-independent. However, Santos et coefficient are observed on Pt(pc) and Pt/C, it was al.104showedthateventhough noH signalisregisteredon hypothesizedthatthereisnosignificanteffectofthePtparticle UPD Sn-rich Pt−Sn catalytic systems, they show higher exchange size on the HOR in 0.1 M KOH.38 In contrast, Stonehart and current density values compared with monometallic Pt. Lundquist75reportedacrystallitesizeeffectfortheoxidationof 6674 DOI:10.1021/acscatal.8b00689 ACSCatal.2018,8,6665−6690