loading

Logout succeed

Logout succeed. See you again!

ebook img

Exploring Resilience: A Scientific Journey from Practice to Theory PDF

pages126 Pages
release year2019
file size2.247 MB
languageEnglish

Preview Exploring Resilience: A Scientific Journey from Practice to Theory

SPRINGER BRIEFS IN APPLIED SCIENCES AND TECHNOLOGY  SAFETY MANAGEMENT Siri Wiig Babette Fahlbruch Editors Exploring Resilience A Scientific Journey from Practice to Theory SpringerBriefs in Applied Sciences and Technology Safety Management Series editors Eric Marsden, FonCSI, Toulouse, France Caroline Kamaté, FonCSI, Toulouse, France François Daniellou, FonCSI, Toulouse, France The SpringerBriefs in Safety Management present cutting-edge research results on themanagementoftechnologicalrisksanddecision-makinginhigh-stakessettings. Decision-making in high-hazard environments is often affected by uncertainty and ambiguity;itischaracterizedbytrade-offsbetweenmultiple,competingobjectives. Managers and regulators need conceptual tools to help them develop risk management strategies, establish appropriate compromises and justify their decisions in such ambiguous settings. This series weaves together insights from multiple scientific disciplines that shed light on these problems, including organization studies, psychology, sociology, economics, law and engineering. It explores novel topics related to safety management, anticipating operational challengesinhigh-hazardindustriesandthesocietalconcernsassociatedwiththese activities. Thesepublicationsarebyandforacademicsandpractitioners(industry,regulators) in safety management and risk research. Relevant industry sectors include nuclear, offshore oil and gas, chemicals processing, aviation, railways, construction and healthcare. Some emphasis is placed on explaining concepts to a non-specialized audience, and the shorter format ensures a concentrated approach to the topics treated. The SpringerBriefs in Safety Management series is coordinated by the Foundation for an Industrial Safety Culture (FonCSI), a public-interest research foundation basedinToulouse,France.TheFonCSIfundsresearchonindustrialsafetyandthe management of technological risks, identifies and highlights new ideas and innovative practices, and disseminates research results to all interested parties. For more information: https://www.foncsi.org/. More information about this series at http://www.springer.com/series/15119 Siri Wiig Babette Fahlbruch (cid:129) Editors Exploring Resilience fi A Scienti c Journey from Practice to Theory Editors Siri Wiig BabetteFahlbruch Faculty of HealthSciences, SHARE-Centre TÜV NordEnSys GmbH &Co. KG forResilience inHealthcare Berlin, Germany University of Stavanger Stavanger, Norway ISSN 2191-530X ISSN 2191-5318 (electronic) SpringerBriefs inApplied SciencesandTechnology ISSN 2520-8004 ISSN 2520-8012 (electronic) SpringerBriefs inSafety Management ISBN978-3-030-03188-6 ISBN978-3-030-03189-3 (eBook) https://doi.org/10.1007/978-3-030-03189-3 LibraryofCongressControlNumber:2018959268 ©TheEditor(s)(ifapplicable)andTheAuthor(s)2019.Thisbookisanopenaccesspublication. Open Access This book is licensed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits use, sharing, adap- tation,distributionandreproductioninanymediumorformat,aslongasyougiveappropriatecreditto theoriginalauthor(s)and thesource,providealinktotheCreativeCommonslicenceand indicateif changesweremade. The images or other third party material in this book are included in the book’s Creative Commons licence,unlessindicatedotherwiseinacreditlinetothematerial.Ifmaterialisnotincludedinthebook’s CreativeCommonslicenceandyourintendeduseisnotpermittedbystatutoryregulationorexceedsthe permitteduse,youwillneedtoobtainpermissiondirectlyfromthecopyrightholder. Theuse ofgeneraldescriptivenames,registerednames,trademarks,servicemarks,etc. inthis publi- cationdoesnotimply,evenintheabsenceofaspecificstatement,thatsuchnamesareexemptfromthe relevantprotectivelawsandregulationsandthereforefreeforgeneraluse. The publisher, the authors and the editors are safe to assume that the advice and information in this book are believed to be true and accurate at the date of publication. Neither the publisher nor the authorsortheeditorsgiveawarranty,expressorimplied,withrespecttothematerialcontainedhereinor for any errors or omissions that may have been made. The publisher remains neutral with regard to jurisdictionalclaimsinpublishedmapsandinstitutionalaffiliations. ThisSpringerimprintispublishedbytheregisteredcompanySpringerNatureSwitzerlandAG Theregisteredcompanyaddressis:Gewerbestrasse11,6330Cham,Switzerland Contents 1 Exploring Resilience – An Introduction . . . . . . . . . . . . . . . . . . . . . 1 Siri Wiig and Babette Fahlbruch 2 Resilience, Reliability, Safety: Multilevel Research Challenges. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Jean-Christophe Le Coze 3 Moments of Resilience: Time, Space and the Organisation of Safety in Complex Sociotechnical Systems . . . . . . . . . . . . . . . . . 15 Carl Macrae 4 Resilience Engineering as a Quality Improvement Method in Healthcare . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Janet E. Anderson, A. J. Ross, J. Back, M. Duncan and P. Jaye 5 Resilience and Essential Public Infrastructure . . . . . . . . . . . . . . . . 33 Michael Baram 6 Human Performance, Levels of Service and System Resilience . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 Miltos Kyriakidis and Vinh N. Dang 7 Precursor Resilience in Practice – An Organizational Response to Weak Signals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 Kenneth Pettersen Gould 8 Leadership in Resilient Organizations. . . . . . . . . . . . . . . . . . . . . . . 59 Gudela Grote 9 Modelling the Influence of Safety Management Tools on Resilience . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 Teemu Reiman and Kaupo Viitanen v vi Contents 10 Resilient Characteristics as Described in Empirical Studies on Health Care . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 Siv Hilde Berg and Karina Aase 11 Resilience from the United Nations Standpoint: The Challenges of “Vagueness” . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89 Leah R. Kimber 12 Building Resilience in Humanitarian Hospital Programs During Protracted Conflicts: Opportunities and Limitations. . . . . . . . . . . . 97 Ingrid Tjoflåt and Britt Sætre Hansen 13 Exploring Resilience at Interconnected System Levels in Air Traffic Management . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 Rogier Woltjer 14 Resilience in Healthcare: A Modified Stakeholder Analysis . . . . . . 113 Mary Chambers and Marianne Storm 15 Resilience: From Practice to Theory and Back Again. . . . . . . . . . . 121 Carl Macrae and Siri Wiig Chapter 1 Exploring Resilience – An Introduction SiriWiigandBabetteFahlbruch Abstract Resiliencehasbecomeanimportanttopiconthesafetyresearchagenda andinorganizationalpractice.Inthischapterwegiveanintroductiontotheresearch areaandsomeofthecurrentchallenges,beforewepresenttheaimofthebook. · · · · Keywords Resilience Safety Research Organizationalpractice Theoretical framework 1.1 Resilience–WhatIsIt? Resilience has become an important topic on the safety research agenda and in organizationalpractice(e.g.[1–6]).Numerousdefinitionsofresilienceexistwithin different research traditions, disciplines, and fields such as sociology, psychology, medicine,engineering,economics,ecology,politicalscience[7–11].Thecommon useoftheresilienceconceptrelatestotheabilityofanentity,individuals,community, orsystemtoreturntonormalconditionorfunctioningaftertheoccurrenceofanevent thatdisturbsitsstate. Manysimilaritiescanbeobservedacrosstheresilienceconceptapplications[8, 9, 12].Weoftenseeresilienceresearchliteraturereferringtodynamiccapabilities, adaptive capacity, and performance variation as key topics. Some group resilience literature into three general areas related to readiness and preparedness; response and adaptation; and recovery or adjustment and argue that researchers attempt to broadlycoverallthreeareasinonestudy,butindividuallyeachareareceiveslimited attentionresultinginadiverseliteraturebase[9].Othershaveidentifieddomainsof B S.Wiig( ) FacultyofHealthSciences,SHARE-CentreforResilienceinHealthcare, UniversityofStavanger,Stavanger,Norway e-mail:[email protected] B.Fahlbruch TÜVNORDEnSys,Berlin,Germany e-mail:[email protected] ©TheAuthor(s)2019 1 S.WiigandB.Fahlbruch(eds.),ExploringResilience,SpringerBriefs inSafetyManagement,https://doi.org/10.1007/978-3-030-03189-3_1 2 S.WiigandB.Fahlbruch resiliencesuchas:theOrganizationaldomain–addressingtheneedforenterprises torespondtoarapidchangingbusinessenvironment;theSocialdomain–addressing capabilitiesofindividuals,groups,communityandenvironmenttocopewithexternal stress;theEconomicdomain–addressingtheinherentabilityandadaptiveresponse thatenablefirmsandregionstoavoidmaximumpotentialloss;andtheEngineering domain–whichismainlyadoptedwithininthesafetyscienceastheintrinsicability ofasystemtoadjustitsfunctionalityinthepresenceofdisturbanceandunpredicted changes[8].Theresilienceengineering(e.g.[13, 14])domainhasattractedawide readershipinthesafetysciencethepastdecade,althoughithasahistorygoingback tothe1980sandrootedincognitivesystemengineering,humanfactors,andsystem safetyengineering[3]. 1.2 SomeCurrentChallenges Theshareduseoftheresiliencetermacrossdifferenttraditionsdoesnotimplyuni- fiedconceptsofresiliencenortheoriesinwhichitisembedded[12].Intheresilience literatureinmoregeneraltherehasbeenastrongfocusonbuildingtheories,however thereislackinempiricallyprovingthetheories[9,15].Thisisalsotrueforresilience asitisusedinthesafetyscience[10, 14].Thecurrentbodyofknowledgeoncom- plexadaptivesystemsandresiliencehasincreasedourunderstandingoforganizations and the challenges they face in particularly in relation to social and technological complexity,butitsuffersfrombeingtoogeneralizedandabstract.Identificationof whatconstitutesresiliencehashardlybeenclarifiedundertheonslaughtoftheoriz- ing and individual empirical cases [16]. A recent systematic review demonstrates that some scientific efforts have been made to develop constructs and models that presentrelationships;however,thesecannotbecharacterizedassufficientfortheory building [10, 17]. Other attempts to model resilience theoretical frameworks (e.g. [18])lackempiricaltesting.Thecurrentlackofwell-definedconstructsisascientific drawbackwithinthesafetyscience,asitistoounclearwhichphenomenaaretobe operationalized[10]. There is a need to develop a coherent integrative theoretical framework of resiliencemechanismstoenablelarge-scalecomparativelongitudinalstudiesacross multiplehigh-risksettingsandsectors(e.g.healthcare,transport,petroleum,nuclear power)andcountries[19,20].Amajorcurrentresearchchallengeistheabsentinte- grationofdifferentsystemlevelsfromindividuals,teams,organizations,regulatory bodies,andpolicylevel[10, 14, 21, 22],implyingthatmechanismsthroughwhich resilienceislinkedacrossthemicro/meso/macrolevelarenotyetwellunderstood. Forexample,mostcurrentresearchaddressesactivitiesoffront-lineworkers(micro level)(e.g.[1])andstressesfactorsofworksystemdesign,whiletopmanagement teams(mesolevel)[23]andleadershipfororganizationaladaptability[24],external contextualfactorandregulatorysystem(macrolevel)arelackingaskeyresilience dimensionsintheoreticalframeworks.Regulationisoftenthefirstleverthatpolicy makers and professional bodies reach for to drive improvements in safety, yet the relationship between regulation and resilience remains little explored and the role 1 ExploringResilience–AnIntroduction 3 ofregulationinproducingorpotentiallyunderminingresilienceperformance,needs investigationandtheorizing[21, 25]. The role of stakeholders in resilience is underexplored. Despite the literature withinforexamplehealthcarefocusingonpatientandnextofkinasco-creatorsof resilience, studies lack involvement of stakeholders [26, 27]. High-risk industries depend on collaboration across numerous stakeholders, of potential influence on resiliencewithinorganizationsandinasocietalperspective.Inordertounderstand howindividuals,groups,organizationsandcommunitiesneedtoadaptandrespond to internal and external change and context, stakeholder analysis (e.g. [28]) could addtothebodyofknowledgeinresilience.Thisisalsoofrelevanceforthepractical and operational approaches to resilience in terms of developing targeted strategies for different stakeholders and to establish for example collaboratives for sharing knowledge across levels to foster resilience when it depends on inter-professional collaborationandcollaborationacrosssysteminterfaces(e.g.[29, 30]),andacross different conceptualizations of resilience, safety and security which are often in contradiction(e.g.[31,32]).Currently,thisareaneedsexplorationofnewapproaches toensureoperationalizationofresilienceasamulti-stakeholderphenomenon. Thelatterillustratesthattherearenotonlytheoreticalandempiricalresearchchal- lengesrelatedtoresilienceresearch.Therearealsochallengesrelatedtothetransla- tionoftheoryintopracticebyprovidingpracticalguidancetodifferentstakeholders, onhowtodesignandoperateresilientorganizationsandtomaintainresilience(e.g. [33]).Thereisaneedfordevelopingtestablepropositionsandinterventionsrelated toresilienceandexploringthisinguidediterativecyclesofdesignandevaluation[10, 11].However,howthisbestshouldbeoperationalizedisstillunclear.Wearguein linewith[1]thatitwouldbeinterestingtowidentheperspectiveofresilienceapplied inthesafetydomainbylookingathowotherscientificdomainsoperationalizeit,and throughthismaygainnewinsightandpossibleimprovementinboththeorybuilding andtranslationoftheoryintointerventionsandpracticalsolutions. 1.3 WhatIsThisBookLookingfor? Thisbookdoesnotadvocateforonedefinitionoronefieldofresearchwhentalking aboutresilience;itdoesnotassumethattheuseofresilienceconceptsisnecessarily positiveforsafety.Weencourageabroadapproach,seekinginspirationacrossdiffer- entscientificandpracticaldomainsforthepurposeoffurtherdevelopingresilience atatheoreticalandanoperationallevelofrelevancefordifferenthigh-riskindustries. Theaimofthebookistwofold: 1. Toexploredifferentapproachesforoperationalizationofresilienceacrossscien- tificdisciplinesandsystemlevels. 2. To create a theoretical foundation for a resilience framework across scientific disciplinesandsystemlevels.

See more

The list of books you might like