Logout succeed
Logout succeed. See you again!

Field Induced Nodal Order Parameter in the Tunneling Spectrum of YBa$_2$Cu$_3$O$_{7-x}$ Superconductor PDF
Preview Field Induced Nodal Order Parameter in the Tunneling Spectrum of YBa$_2$Cu$_3$O$_{7-x}$ Superconductor
Field Induced Nodal Order Parameter in the Tunneling Spectrum of YBa Cu O 2 3 7−x Superconductor G. Leibovitch,∗ R. Beck,† Y. Dagan, S. Hacohen, and G. Deutscher School of Physics and Astronomy, Raymond and Beverly Sackler Faculty of Exact Sciences, Tel-Aviv University, Tel Aviv, 69978, Israel 8 (Dated: February 4, 2008) 0 0 WereportplanartunnelingmeasurementsonthinfilmsofYBa2Cu3O7−x atvariousdopinglevels 2 under magnetic fields. By choosing a special setup configuration, we have probed a field induced n energyscalethatdominatesinthevicinityofanodeofthed-wavesuperconductingorderparameter. a We found a high doping sensitivity for this energy scale. At Optimum doping this energy scale is J in agreement with an inducedidxy order parameter. Wefound that it can befollowed down tolow 9 fieldsat optimum doping, butnot away from it. 2 PACSnumbers: 74.72.Bk,74.50.+r ] n o I. INTRODUCTION and other possible spectral contributions. We have con- c cluded that data taken in decreasing fields is essentially - r free of Doppler shift effects and can be used to identify p It is by now well established that cuprate supercon- finiteenergynodalstates. Weconfirmedthatthisenergy u ductors have an order-parameter with a dominant d- follows the predicted square root of field behavior at op- s wave symmetry, characterized by node-lines along the . timum doping. By extending our measurements to 20 t [110] and equivalent directions1. Nodal quasi-particles a mK, we were able to follow the evolution of these states m become then the dominant low energy excitations2. In- down to fields of the order of a few 1000 Gauss, where teresting phenomena have been predicted to occur when - the Landau level interpretation is excluded due to the d the d-wave superconductor is subjected to a magnetic long length of the corresponding trajectories. Finally we n field perpendicular to the superconducting planes: an reportthatthedopinglevelhadastronginfluenceonthe o energy gap should develop at the nodes, that increases splittingbehavioroftheZBCP.Thesquarerootbehavior c with the square root of the applied field. This has been [ isnotobeyedatlowfields whendeviatingfromoptimum explainedbyLaughlin3 whoassumesanadditionalimag- doping. Such deviations were reported before14,15, how- 2 inaryid componentwhichincreaseswiththe magnetic xy ever, the data was taken in increasing fields and was an v field. Discrete Landau energy levels were also predicted admixture of the studied phenomena and Doppler shift. 2 to develop in the nodal regions by Gor’kov-Schrieffer4 6 and Anderson5. However,the observationof nodal finite In the new data presentedandstudied in this paper, the 3 Doppler shift contribution is essentially eliminated, and energylevelshasencounteredtheoreticalandexperimen- 2 the doping effect appears far more clearly. In Summary, 1 tal difficulties. our results favor the existence of additional id order xy 6 Ithas been argued,that inthe mixed state,superfluid parametercomponentpredictedbyLaughlinratherthan 0 screening currents result in a Doppler-shift of the Lan- that ofthe formationofnodal energylevels predictedby / t dau levels larger than the level spacing, rendering their Gor’kov-Schrieffer4 and Anderson5. a m observationimpossible4,6,7,8. ThisDopplershiftwillalso This paper willbe organizedasfollows: webegin with obscure a possible idxy component.9. Tunneling experi- a theoretical background of the Doppler-shift effect. In - d ments performed along a nodal direction, which should Sec. IIIwepresentourexperimentalsetupenablingusto n inprinciplebeanidealmethodtoprobenodalstates,are distinguishbetweenthetwocontributions. Ourtunneling o dominated by low energy Andreev - Saint James (ASJ) results at optimum doping will be shown together with c surfacestatesduetothed-wavesymmetry,resultingina the low temperatures measurements at 20mK (Sec. IV). : v characteristicZeroBiasConductancePeak(ZBCP).The We then compare our results to theory in Sec. V and i degeneracy of the Andreev - Saint-James states is lifted finish with our conclusions and findings. X by screening currents splitting the ZBCP, an effect that r can be confused with that of nodal finite energy levels. a Spontaneoustimereversalsymmetrybreakingeffectsare II. THEORETICAL BACKGROUND alsosometimesobserved10,11,12,13,14. Inaddition,itisnot trivialto distinguish betweenthe predictions ofthe Lan- We wish to discuss the differences between two the- dauStates andofthe minorityorderparametertheories. oretical approaches regarding the development of finite This is because, the energy of the first Landau level is nodal energy states under applied magnetic fields. equal to the amplitude of the idxy component predicted In the first approach, by Laughlin3, the free energy by Laughlin. ofad-wavesuperconductorsubjectedtoamagneticfield To address these difficulties we have used field cycles perpendiculartothesuperconductingplanescanbemin- that enable us to distinguish between the Doppler shift imized by the inclusion of an additional id component xy 2 two approaches lead to the same energy exactly: ε(B)= 2 ¯hω ∆ (1) a c ± p 2 Nonetheless, there are substantial differences between k 1 b these two approaches. While the Gorko’v-Schrieffer- y Andersontheoryassumesthattheorderparameterisnot k x altered by the magnetic field, its modification is a key prediction in Laughlin’s theory. The latter also predicts g a transition temperature above which the d-wave sym- metry is recovered. Finally Gor’kov-Schrieffer-Anderson B predict a series of energy levels while Laughlin only pre- dicts a finite gap value. Tunneling along a nodal direction of a d-wave super- FIG.1: (color online) Schematicillustration oftheelectronic conductor is done through a surface where zero energy momentum space in a d-wave superconductor under an ap- boundstatesarepresentduetotheinterferenceofquasi- plied magnetic field. The x and y axis are parallel to the particles that undergo Andreev - Saint-James reflections [100] and [010] crystallographic directions perspectively. For from lobes of the order parameter having phases that simplicity we assume: a cylindrical Fermi surface, a dx2−y2- differ by π13,16. These bound-states should appear as a wave superconducting gap and nodes at ±45o from the prin- conductance peak at zero bias in an in-plane tunneling cipalaxes,andamagneticfield,B,paralleltothezaxis. The spectrum17. AsshownbyFogelstro¨metal.,thiszerobias quasi-particlescycleofmultipleAndreev-Saint-Jamesreflec- 1 peaksplitsintotwospectralpeaksduetoaDoppler-shift tions forming the nodal energy level is marked by the solid line. As an alternative theoretical description for the energy fromsuperfluidcurrentsflowingparalleltothesurface15. scale an induced idxy order parameter (marked in purple) The peaks bias are proportional to vs ·pF, where vs is is predicted to develop mainly in the vicinity of the nodes. the superfluid velocity and p the Fermi momentum of F The collimation of the injected electrons in a planar tunnel- the probed states. For example, when a magnetic field, ing configuration of the experiment is marked by the green H, is applied parallel to the surface, Meissner currents triangles for two different junction orientations. Thefield in- Doppler-shift will produce spectral peaks which are lin- duced nodal energy scale can only be probed for tunneling ear with H up to a field of the order of the thermody- along thenode direction (left triangle). namical critical field where saturation is reached (about 1 Tesla in the case of YBa Cu O (YBCO)). 2 3 7−x Since a nodal energy scale and a Doppler shift will to the main dx2−y2 component (illustrated in Fig. 1 by both split the zero bias conductance peak under an ap- the id order parameter marked in purple). The id pliedfield,ashasbeenobserved10,11,12,14,onemustfinda xy xy component breaks the symmetry in such a way that op- methodtodistinguishbetweenbothmechanismsandde- posite currents will flow on opposite faces of the sample terminethedifferenceinthepredictedfielddependences. creatingamagneticmomentparalleltothe appliedfield. Anobviousdifference betweenthemis thatfieldinduced If the moment and the applied field are parallel to each nodalenergyscalesarebestobservedintheabsenceofsu- other the free energy will be minimized. perfluid currents, while a Doppler shift effect exists only in their presence. In the second approach, following Anderson5, we con- A method, which we have already used18, consists in siderthemotionofaquasi-particleinanodalregion(Fig. performing magnetic field cycles. Meissner currents are 1). Under an applied magnetic field B, it acquires a ve- quitedifferentinincreasinganddecreasingfieldsbecause locity component parallel to the Fermi surface. In the the Bean-Livingston barrier which can retard the pene- absence of a superconducting order parameter,it will be tration of vortices through strong surface currents, up in one of the Landaulevels,determined by the cyclotron to a field of the order of the thermodynamical critical frequencyω = eB ,whereeisthequasi-particlecharge, c m∗c field, is only effective against flux penetration (increas- c is the speed of light and m∗ is the effective electron ing fields) and not against flux exit (decreasing fields). mass. However, when ¯hω < ∆, where ∆ is the ampli- c As a result, strong surface Meissner currents, on the tudeofthesuperconductinggap,theusualcyclotronmo- scale of the London penetration depth, exist only in in- tion is not possible. Instead, as schematically described creasing fields19,20,21. Other types of current that can in Fig. 1, a series of Andreev - Saint-James reflections produce a Doppler shift are screening currents around in momentum space will occur13. This process can only vortices22 and Bean’s critical state currents23. The lat- occur at certain energy levels for which the total phase ter reversesign with field reversal, and in high fields, ex- change during a Saint-James cycle is a multiple of 2π. tends into the entire thickness of the sample. They are Theseenergylevelscorrespondvaluesofthecurrentthat typicallyweakerthanthe Meissnercurrentsinthe Bean- flows around the Fermi surface. Livingston regime. Interestingly,theamplitudeoftheminoritycomponent Inplanartunnelingexperiments,electronsareinjected isthesameastheenergyofthefirstLandaulevel4,5. The across a dielectric barrier into the superconductor. The 3 transmission probability decays exponentially with the perature, respectively. Second, we ensure that the high increasing angle between the electron’s momentum and bias conductance is insensitive to the magnetic field and the normalto the interface resulting in a collimatedcur- temperature below the YBCO critical temperatureas, as rent. Inatypicaljunctionthemomentumdivergencehas expected for tunneling spectroscopy. a angle of 10-20 degrees known as the tunneling cone. Our sample and the field configuration are favorable The width of this cone,which canvary slightly from one for several reasons. First, the magnetic field is applied junction to another, will influence the Doppler shift of parallel to the surface (which avoids threading the tun- the zero energy surface bound states. however, it will nel junction with vortices) and at the same time per- not modify the energy of nodal states nor that of an in- pendicular to the CuO planes, as required for the ob- 2 duced id order parameter component. servation of finite energy nodal states. Second, the un- xy In summary,a zerobias conductance peak is expected desired Doppler-shift due to superfluid currents is mini- to appearina d-wavetunneling alongthe node direction mized because in our geometry v p is at a minimum s · F andtosplitintotwospectralpeakswhenamagneticfield since the dominant currents flow parallel to the inter- isappliedperpendiculartotheCuO planesduetoafield face. Third, by comparing data taken in increasing and 2 induced nodalenergy scale or via a Doppler-shift effect. decreasing fields it is possible to identify the effect of The twoeffects behave differently in a magnetic field. In the Doppler-shift due to strong surface Meissner cur- thenextsection,weshowawaytominimizetheDoppler- rents that exist only in increasing fields19,20,21. There- effect which allowed us to probe the field induced nodal fore, measurements in decreasing fields are less affected energy scale alone. by the Doppler-effect. Also, the intensity of the Meiss- ner currents themselves can be minimized by using films whose thickness is smaller than the London penetration III. EXPERIMENTAL depth18,29. Finally,wehaveperformedexperimentsboth on (110) and (100) orientated films. While for the [110] direction we expect to probe the field induced energy Thin YBCO films were grown using DC off-axis sput- scale, for the [100] direction it should not be observed. tering deposition. In order to minimize (103) oriented We emphasize that in our method due to the planar ge- grainsabufferlayerofPrBa Cu O wasfirstdeposited 2 3 7−x ometry of the junction and the resulting tunneling cone, using RF off-axis sputtering on top of the substrate24. we probe a specific direction in k-space rather than the WeusedaSrTiO andLaSrGaO substratesforthe(110) 3 4 k averagedlocal density of states as probed by scanning and (100) oriented films respectively. These films have a tunneling microscopy. well defined [001] direction parallel to the surface of the film. θ 2θ x-ray diffraction patterns showed the rele- − vantpeaksforthedesiredorientation. Scanningelectron IV. RESULTS microscopy and atomic force microscopy showed a well definedcrystallographicgrowthandsurfaceroughnessof a few nanometers. Resistivity measurements showed the A. Probing the field induced nodal energy scale expected in-plane anisotropy. In addition, the tempera- ture dependence of the ab plane resistivity allowed us to In Fig. 2 we show tunneling spectra for an optimally estimate the doping level in our films. It changes from a doped (110) oriented film as a function of magnetic field positivecurvatureforoverdoped,linearwithtemperature applied perpendicular to the CuO planes. We notice 2 for optimally doped and negative curvature for under- thatthespectralpeakbiasvalues,δ(H),arealwayslarger doped films25,26,27,28. I-V characteristics were measured inincreasingratherthanindecreasingfields. Inaddition, using a current source and a digital voltmeter. The tun- the peak seen in decreasing fields is well defined for all neling conductancespectra werecalculatedby differenti- fields, while that seen in increasing fields becomes very atingtheI(V)curves. TableIshowsthecharacterization broadandis too broadto be identified (Fig. 2), while in values forthe 15representativejunctions usedinthe fig- decreasingfields it remains welldefined up to more than ures of this paper. 22 T (see for example Fig. 7). In our experiments the tunneling junction is created We demonstrate in Fig. 3, and 4 that the spectral by placing an indium electrode on top of the surface peak bias value does not increase linearly at low fields, of freshly prepared thin YBCO films. At the metal- and does not saturate at high field. This is in contradic- superconductor interface a thin insulating indium-oxide tion with the Doppler shift theory of Zero Energy Sur- layeristhenformed,whichisstableoverweeksandmany face Bound States. A substantial difference between the thermalcycles. Wecanverifythequalityofthetunneling behavior of (100) and (110) oriented films is observed. junction by severalmethods. First, by loweringthe tem- While for thin (110) films, the spectral peaks are clearly perature below the indium critical temperature we can seen even at low fields, no such peaks canbe detected in measurethewell-knowindiumtunnelingspectrumwhich thin (100) films. Since in (100) films, the only splitting dominatesthelowenergyspectra. Alsotheindiumspec- mechanismis the Doppler shift effect, the absence of the trumdisappearsasweincreasethemagneticfieldorheat spectral peaks in such films is indicative of the insignif- up the sample above the indium’s critical field and tem- icance of that effect in films thinner than the London 4 TABLEI:Samplescharacterization. Asexplainedinthetext,fromtheresistivitytemperaturedependencemeasurement,R(T), we can estimated the samples doping. The zero field spectral peak bias value is noted as δ0. Tc is the temperature at zero resistivity. The transition temperature width is determined bya Gaussian fit to dR at thetransition. dT Name Figs. Orientation Thickness(˚A) Doping regime Tc(K) Tc width(K) δ0(mV) T(K) S1 2,5,7 (110) 1600 optimal 88.1 1.4 0 0.3 S2 3 (110) 1600 optimal 90 1 0 4 S3 3 (100) 1000 under 84 1.5 0 4.2 S4 4,7 (110) 1200 optimal 88.2 1.3 0 0.02 S5 6 (110) 1200 over 87.3 1.5 1.4 4.2 S6 7 (110) 600 under 87 1 0 4.2 S7 7 (110) 1200 over 87.7 0.3 1.3 4.2 S8 7 (110) 1200 over 85.7 1.1 1.6 4.2 S9 7 (110) 1200 over 88.3 0.8 1.8 1.3 S10 7 (110) 1200 over 86.7 0.7 1.8 1.3 S11 7 (110) 1200 over 87.7 0.8 1.9 1.3 S12 7 (110) 1200 over 88.3 0.6 1.5 1.3 S13 7 (110) 1200 over 88.0 1 1.35 1.3 S14 7 (110) 1200 over 87.9 0.3 2.25 1.3 penetration depth. Upon increasing the (100) oriented thickness, tunneling cone and surface barrier formation. films thickness, the contribution of the Doppler shift is In contrast with the difficulties encountered in trying also increased and the spectral peaks are recovered12. to explain the data shown in Fig. 2 and Fig. 3 by a The third qualitative evidence supporting the ar- Doppler shift of zero-energysurfacebound-states, a field gument that we probe a field induced nodal energy induced nodal energy scale provides a reasonableexpla- scale rather than a Doppler-shifted zero bias conduc- nation. As shown in Fig. 4, the data taken in decreas- tance peak comes from the shape of the tunneling con- ing fields fits the predicted square root dependence on ductance at zero bias. While the Doppler shifted ZBCP the magnetic field. The field hysteresis shown in Fig. 2 results in a V-shape conductance15,22, one expects a U- and Fig. 3 can be understood as due to a Doppler shift shaped conductance at zero bias for the field induced by Meissner currents in increasing fields; the peaks are nodal energy scale 30. Because it is difficult to distin- shifted to higher bias and are broadened until they can- guish between these two shapes due to thermal popula- not be identified anymore in very high fields. tion effects, one should perform measurements at very To summarize, we have shown that for an optimally- low temperatures. In Fig.4 we show tunneling spectra dopedsample,tunnelingmeasurementson(110)oriented taken at 20mK under high magnetic fields. The ob- filmrevealanenergyscalethatcanbeunderstoodeither served U-shaped conductance is in agreement with the as an additional complex order parameter in the form of field induced nodal energy scale scenario and contrasts idxy or as the first Landau state in the vicinity of the the Doppler shift model. d-wave node. We have therefore demonstrated that a Doppler shift due to Meissner screening currents does not play an im- portantrole in our tunneling measurements of thin films B. Implausibility of nodal Landau levels in decreasing fields. However, the effect of a nearby vortex22, or Bean’s critical state currents23 could still After ruling out the Doppler shift effect, we now con- takeplace ina decreasingmagnetic field. These currents centrate on distinguishing between the nodal Landau reversetheir polarity whendecreasingthe magnetic field states approach of Gor’kov-Schrieffer4 and Anderson5 from the maximum value reached. If they dominate, the and the nodal order parameter component predicted by totalcurrentshouldbe zeroatsome field. Inthis case,a Laughlin3. AlthoughthefirstLandaulevelandthenodal zerobiaspeak shouldreappearata finite magneticfield. orderparameterhaveidenticalfielddependences,thefol- Such a behavior was never observed, ruling out that the lowing evidences favor the later. spectralpeaksindecreasingfieldsarisefromthe effectof An important feature is observed in Fig. 4: only two a nearby vortex or a strong Bean critical state currents peaks at δ are visible. This is incompatible with the (see for example a field cycle in Fig. 8). theoriesin±refs.4,5, whichpredicta seriesof energylevels Finally we note that the peak position measured in that should manifest themselves as peaks in the tunnel- decreasing fields is extremely reproducible, for a variety ing spectrum. These peaks have never been observed. of samples and junctions. This is in contrast with the One could argue that the higher energy levels are hid- expected behavior of the Bean critical currents and the den due to scattering. The visibility of the first peak Doppler shift effect that are strongly dependent on film at relatively high temperatures (T > 4.2K) under small 5 0.40 4 (a) 0H=1T (b) 0H=3T (110) film, 1600¯ 0.40 3 ) V 0.35 m ) -1 0.35 ( 2 ( V d / dI (c) 0H=8T (d) 0H=10T 1 0.40 0.40 Increasing Decreasing 2 (100) film, 1000¯ 0 0.35 0.35 0 2 4 6 8 10 12 H (T) 0 FIG. 3: (color online) Spectral peak bias value, δ, as a function of magnetic field at 4.2 K. Black triangles (dia- -5 0 5 10 -5 0 5 10 monds) represent the peak positions in decreasing (increas- Bias (mV) ing)magneticfieldsfora(110)orientedfilmhavingthickness of 1600˚A(sample S2). While a Doppler-shift in increasing FIG. 2: (color online) Tunneling spectra, dI/dV(V), for var- fields prevents observation of the field induced nodal energy ious magnetic fields (sample S1, at 0.3 K). Increasing from scale, the measurements in decreasing fields are free of the zero magnetic field (black) and decreasing from 16 T (red), Doppler-shift effect and allow unambiguously identification they present different tunneling spectra in a given magnetic ofthefieldinducednodalenergy scale. Dashedpurplelineis field. We define 2δ as the distance between the two maxima a fit to δ = AH12, with A = 1.02± 0.05 meV/T12 in excel- in the spectrum. For a given magnetic field, δ(H) is always lent agreement with Eq.(1). The red circles represent (100) larger in increasing fieldsthan in decreasing one. This is due orientedfilmwithathicknessof1000˚A(sampleS3). Thefield to the Doppler-shift effect resulting in shifting and smearing induced nodal energy scale are not observed, as expected. the field induced nodal energy scale peaks to higher biases in increasing magnetic fields. In fields higher than 4 T, the peaks can only be identified in decreasing magnetic fields. the applied field is of the order of 100T. But in fact the nodalscaleisobservedatlowtemperatures(20mK)down magnetic fields (H 0.3T) suggests that the scattering to a fraction of a Tesla (Fig 4). processes are not s≃trong enough to obscure the higher Two additional indications favoring Laughlin’s theory peaksat20mKand9T,yet,thesepeaksarenotobserved overGor’kov-Schrieffer-Andersonwillbediscussedinthe in Fig. 4. the following sections: the effects of doping in section Furtherevidencecomesfromestimatingthetrajectory IVCandafirstorderphasetransitionofthefieldinduced length at the node area. If we define θ as the angle from nodalenergyscale measuredbyElhaleletal.29 insection the anti-nodal direction at which the particles meet the V. superconductinggap∆andperformanAndreev-Saint- James reflection, and α as the trajectory angle mea- sured from the node we±get α = 2(45 θ). Using Eq. 1 C. Effect of doping on field induced nodal energy − scale we calculate α for small angles to be α = ε = 2 h¯eB. ∆ mc∆ q Inthenodearea,thetrajectorycanbetreatedclassically 1. Underdoped case using the cyclotron frequency ω . In the node vicinity, c the trajectory time t= α gives the trajectory length x: ωc For underdoped samples at zero field only a single peak is observed at zero bias (the ZBCP). We shall now ¯hmc demonstrate that this is not due to the thermal smear- x=tVf =2reB∆Vf (2) ing of two peaks at finite energy. To do that we reduced the temperature to 0.3K while applying a small mag- where Vf is the Fermi velocity. Using Eq. 2, we calcu- netic field perpendicular to the c-axis (and parallel to late that for B = 1 Tesla, ∆ = 20meV and Vf = 106smec the sample’s surface). This field quenches superconduc- the trajectory length is 8600˚A which is several times tivity in the indium counter electrode but has no effect largerthanthe film’s thickness. Scattering fromthe sur- on the ZBCP as has been demonstrated by Krupke and facewillnotallowtheformationofLandaustates,unless Deutscher12. The results are shown in Fig. 5. The sam- 6 2 20 mK 0.3T 4 V) -1 )1.4 3 V) m dV ( 4T (m ( * dI/ 2 1 H 9T 1 17T 1.2 0 -3 0 3 0 1 2 3 4 1/2 1/2 0 Bias (mV) ( 0H) (T ) 0 1 2 3 1/2 1/2 ( H) (T ) 0 FIG. 4: (color online) (a) Tunneling spectra taken at 20mK FIG. 6: Spectral peak value, δ, as a function of the square- in decreasing magnetic fields (sample S4). Note theconstant rootappliedmagneticfield(sampleS6). Thelineisalinearfit conductance in the vicinity of zero bias supporting the exis- 1 tenceofanenergyscaleε=±δ(H)(b)Spectralpeakvaluein tothehighmagneticfielddata. Ithasaslopeof0.9meV/T2. decreasing fields versus square root of the applied magnetic field measured at 20mK. thelineis a fittohigh fieldshaving 1 a slope of 1.01 meV/T2. 5 1.2 H||C=0, H C=0.1T H||C=1T, H C=0 ) ) nt.1.1 V u m arb. (1 SS14 SS1101 V (1.0 S6 S12 S7 S13 d I/ S8 S14 d0.9 0.5 S9 T=0.3K -20.0 -10.0 0.0 10.0 20.0 Bias (mV) 0.1 1 10 H (T) 0 FIG.5: Tunnelingconductancefora(110)filmtakenat0.3K FIG.7: (coloronline)Spectralpeakpositions,δ,asafunction (sample S1). The black line measured in magnetic field of ofmagneticfieldforvariousdopinglevelsfilmsatlog-logscale. 0.1 T applied parallel to the CuO2 planes where the indium Alldatashownherewastakenindecreasingmagneticfield. In counterelectrodeisinitsnormalstatewithoutfieldinducing overdopedfilmsthetunnelingspectrumexhibitspeaksatzero spectral peaks. The red curve is for 1 T in increasing fields magnetic field, where for underdoped ones peaks are missing appliedperpendiculartotheCuO2planes,wherefieldinduced atlowmagneticfields. Allδ valuescoincideathighmagnetic nodal energy scale peaksare observed. 1 fieldsandfollowthedashedlinehavingaslopeof1meV/H2. pleisslightlyunderdopedatT =88.1K. Theblacksolid c lineshowsasharpzerobiaspeakwithoutanyobservable splitting. An upper limit for the bias of possible spon- taneous peaks is extracted from this measurement to be 2k T =0.06meV. We notethatevenat16T,wedonot peak is observed at zero bias. Upon increasing the mag- B observe any zero bias peak splitting under this configu- netic field a field induced nodal energy scale appears at ration, which ensures the sample’s orientation. By con- lower energies when compared to the case of optimum trast, when the field is applied parallel to the sample’s doping, until it reaches a cross-overfield (marked by H∗ c-axis, the two spectral peaks at 2.2 meV are clearly in Fig. 6) at which it recovers the optimally-doped √H ± seen. behavior. In unserdoped samples there appears to be a In Fig. 6 we show a typical field dependence of the well defined field below which the ZBCP does not split. nodal energy scale. At low fields up to 1 Tesla, a single This field increases rapidly with underdoping. 7 2. Overdoped case All overdoped samples exhibit spontaneous zero field spectral peaks. Dagan and Deutscher14 have shown a 3.5 correlation between the spontaneous spectral peak bias values, δ , and the rate at which this bias increases with 0 field. They concluded that the spontaneous peaks are 3.0 due to a modification in the order-parameter symmetry ) V near the surface in the vicinity of optimum doping from m 2.5 pure d wave for underdoped samples, to d id or ( xy − ± d is in overdoped ones. ± 0 6 T In this section we present a study of overdoped sam- 2.0 6 0 T ples with different oxygen doping levels in high decreas- 0 -6 T ing magnetic fields starting from fields as high as 32.4 -3 0 T 1.5 T. The results are summarized in Fig. 7. For slightly 0 1 2 3 4 5 6 overdoped films (see all data points above the dashed H|(Tesla) 0 line), we find zero field spectral peaks, with a minute shift at low magnetic fields. The zero and low magnetic fielddataarequalitativelyinagrementwiththemeasure- FIG.8: (coloronline)Spectralpeakposition,δ,asafunction mentsofDaganandDeutscher14. However,newbehavior of theabsolute magnetic field in both polarities (sample S5). is observed at high magnetic fields. At these high fields, Wefound no evidence that the polarity of the magnetic field influencesthepeak position for a given field. all data points collapse to a single line having a slope 1 of 1 meV/H2 (dashed line). This is the same slope as foundathighfields foroptimally dopedandunderdoped spectral peaks will be shifted by an external magnetic samples. field and for a clean interface, no magnetic field shifted It has been suggested that finite energy peaks can re- peaks should be observed. However, an earlier study by sult from trapped vortices and their associated Doppler shifting super-current at the surface22. Another expla- Dagan and Deutscher14(see also Fig. 7) shows the oppo- site trend. At low magnetic fields, junctions showing a nation could be a minority imaginary component of the superconducting order-parameter15,31. Both cases break spontaneous spectral peak shift to a lesser degree than those showing a zero bias conductance peak. This rules timereversalsymmetry,asthespontaneouscurrentsflow out impurities as a possible explanation for spontaneous in a specific direction. Applying additional currents peaks. should then result in either increasing or decreasing the net current, assuming that the time reversal symmetry is broken macroscopically. However, we find no differ- ences in the tunneling spectra for both polarities. This V. DISCUSSION is shown in Fig. 8. When the magnetic field is increased forazerofieldcooledsamplethespontaneouspeakvalue As mentioned before both theories - Laughlin’s3 shouldreduceforaboutone halfofthe samples;orwhen id theory and Landau-states by Gor’kov-Schrieffer - xy the induced current is opposite to the spontaneous one. Anderson4,5 result in exactly the same field dependence However, in over 100 junctions measured in this study for the induced nodal scale. However, there are two we never observed that the spontaneous peak’s bias de- main differences between these approaches that can be creased with increasing magnetic field. checked experimentally. First, Laughlin predicts a weak Theoretical studies by Asano et al.32,33 and Kalenkov first-order phase transition to the idxy state which is et al.34 show that surface impurities could also result in not predicted by the Landau-state theorem. This phase spontaneous spectral peaks. These models predict that transition was in fact demonstrated recently by Elhalel scattering of impurities cause bound states that dom- et al.29. Second, the Gor’kov-Schrieffer - Anderson the- inate the low bias spectrum. However the Andreev - ory predicts a series of states while in Laughlin’s theory, Saint-James bound states will still be present, and a only one energy scale appears. The second peak is not three peaked structure at zero-bias should be present. observed, even down to 20mK. Additionally, we showed We did not observe such behavior in any of the junc- that the trajectories between two successive Andreev - tions presented here. Moreover,accordingto these mod- Saint-James reflections are much longer than the films els, the “impurity” spectral peaks bias value should be thickness. It is therefore unlikely that such states exist proportional to the amount of impurities at the surface. in the thin films used in our measurements. In the case of a clean junction, a zero bias peak should Laughlin’s theory however,has no doping dependence, be present. However, when a magnetic field is present, whichisakeyfeatureobservedinourmeasurements. Fol- a splitting via an Aharonov-Bohm like phase shift will lowing Laughlin, Deutscher et. al.35 suggested a doping occur32. This means that at high bias the zero field dependence correction to the free energy in the form 8 VI. SUMMARY F =aδ2+bδ3 cδB (3) − Inconclusion,tunnelingexperimentsrevealedthatthe spectrum of quasi-particle states in nodal regions of a Here b andc are calculatedby Laughlin. a is a doping d-wave superconductor is profoundly modified by apply- dependent term, a = a (x x ), where a is a negative constant and x is the o0ptim−alccarrier con0centration. ing a magnetic field perpendicular to the CuO2 planes. c Doppler-shift of the field induced nodal energy scale has Using Eq. 3, we calculate a minimum F for δ = 0 6 been identified, and as expected, is large enough to pre- at zero field only in the overdoped regime where x>x , c vent observation of a field induced nodal energy scale, whileathigherfieldsthesquarerootbehaviourofδ isre- howeverit has been minimized by choosing an appropri- coveredforbothunderdopedandoverdopedregimes. We ate geometry. We showed that the zero field spectral can therefore conclude that our data is better described peaks cannot be explained by either inelastic scatter- by the modified Laughlin’s theory3,35 with an additional ing or trapped vortices at the surface, but rather by a order parameter component. domain-like structure of minority order-parameter com- We have shown that time-reversal symmetry is not ponents with alternatingsigns. We studied the interplay broken, macroscopically, even when spontaneous spec- between the spontaneous spectral peaks with the forma- tral peaks appear in the tunneling measurements. An tionofthefieldinducednodalenergyscaleandfilmdop- experiment, similar in concept, was conducted by Tsuei ing. Although the low energy states are in agreement et al. where they measured the spontaneous half flux- with theories based either on the explicit description of quantum vortex in a tri-crystal experiment and found Andreev - Saint-James reflections by the order parame- no difference between spontaneous vortices at opposite ter away from the nodes4,5, or on a free-energy expres- polarities36. The tri-crystal experiment claimed to rule sion that takes into account a gain in energy due to the out a minority component to the superconductor order- interaction between the applied field and the magnetic parameter. moment created by an id component3. But the ab- Because our measurements, as well as the tri-crystal xy senceofhigherenergylevelpeaksandunreasonablylong ones, are macroscopic, domain regions with alternating length of the trajectories that would be necessary to ob- spontaneouscurrentdirectionscanreconcilebothexperi- serveLandaulevelsareincontradictionwiththe former, mentalresults. The originofsuchregionscouldbealter- while the doping dependance and the first order phase nating minority order-parameters having id or is ± xy ± transitionobservedby Elhalelet al.29, areinfavorofthe symmetries as both plus and minus states are degener- existence of a field induced id order parameter. ate. In fact, such configurations could be energetically xy favorable. In such a case, at the domain wall region the spontaneous current should be zero. Our technique has Acknowledgments the advantage that it can probe the zero magnetic field state,andthemicroscopictime-reversalsymmetrybreak- ing, regardless of the spontaneous currents direction at This work was supported by the Heinrich Herz- the microscopic scale. MinervaCenterforHighTemperatureSuperconductivity Since the order-parameter changes over a length scale andby the ISF.Aportionofthis workwasperformedat set by the superconductor coherence length, one should the National High Magnetic Field Laboratory, which is be able to find nanometerscaleregions(the domainwall supported by NSF Cooperative Agreement No. DMR- region) where the minority component order-parameter 0084173, by the State of Florida, and by the DOE. We is zero, while, in other regions (inside the domains), it acknowledge the assistance from Roman Mints, Alexan- should be finite. Only a microscopic study, for example der Gerber and Enrique Gru¨nbaum. G.D. wishes to ac- with a scanning tunneling microscope, may be able to knowledge the hospitality of Stanford University during probe such domains. Furthermore, in the domain wall the final preparation stage of this work. Y.D. acknowl- region, the order-parameter symmetry should be purely edgesthe supportfromGIF.R.B.acknowledgesthe hos- d-wave. Therefore, measurements aiming at detecting pitality of Richard Greene and the center for supercon- node-line excitations, such as thermal conductivity, may ductivity research at the University of Maryland, where be dominated by the domain wall regions. preliminary results for this work were obtained. ∗ Electronic address: [email protected] 4 L. P. Gor’kov and J. R. Schrieffer, Phys. Rev. Lett. 80, † Both first authors contributed equally to the paper; Cur- 3360 (1998). rent address: University of California, Santa Barbara 5 P. W. Anderson,cond-mat/9812063 (1998). 1 C. Tsuei and J.Kirtley,Rev.Mod. Phys. 72, 969 (2000). 6 B. Jank´o, Phys.Rev.Lett. 82, 4703 (1999). 2 J. Orenstein and A. Millis, Science 288, 468 (2000). 7 A. Mel’nikov, J. Phys. Condens. Matter 11, 4219 (1999). 3 R. B. Laughlin, Phys. Rev.Lett. 80, 5188 (1998). 8 M. Franz and Z. Tesanovic, Phys. Rev. Lett. 84, 554 9 (2000). 25 Y. Dagan and G. Deutscher, Europhys. Lett. 57, 444 9 A. Aubinand K.Behnia, Science 280, 11 (1998). (2002). 10 J. Lesueuret al.,Physica C 191, 325 (1992). 26 A. P. Mackenzie, S. R. Julian, D. C. Sinclair, and C. T. 11 M. Covington et al.,Phys. Rev.Lett. 79, 277 (1997). Lin, Phys.Rev. B 53, 5848 (1996). 12 R. Krupke and G. Deutscher, Phys. Rev. Lett. 83, 4634 27 I. Terasaki, Y. Sato, S. Miyamoto, S. Tajima, and (1999). S. Tanaka, Phys.Rev.B 52, 16246 (1995). 13 G.Deutscher,Rev.Mod.Phys. 77,109(pages27)(2005). 28 H. Castro and G. Deutscher, Phys. Rev. B 70, 174511 14 Y.Dagan andG. Deutscher,Phys.Rev.Lett. 87, 177004 (2004). (2001). 29 G. Elhalel, R. Beck, G. Leibovitch, and G. Deutscher, 15 M. Fogelstr¨om, D. Rainer, and J. A. Sauls, Phys. Rev. Phys. Rev.Lett. 98, 137002 (2007). Lett. 79, 281 (1997). 30 Y. Tanuma, Y. Tanaka, and S. Kashiwaya, Phys. Rev. B 16 C.-R. Hu,Phys. Rev.Lett. 72, 1526 (1994). 64, 214519 (2001). 17 Y. Tanaka and S. Kashiwaya, Phys. Rev. Lett. 74, 3451 31 M. Fogelstr¨om, D. Rainer, and J. A. Sauls, Phys. Rev. B (1995). 70, 012503 (2004). 18 R. Beck et al.,Phys.Rev. B 69, 144506 (2004). 32 Y.Asano,Y.Tanaka,andS.Kashiwaya,Phys.Rev.B 69, 19 C.BeanandJ.Livingston,Phys.Rev.Lett. 12,14(1968). 134501 (2004). 20 J. Bussieres, Phys.Lett. 58A, 343 (1976). 33 Y.Asano,Y.Tanaka,andS.Kashiwaya,Phys.Rev.B 69, 21 J.R.Clem,in13th International ConferenceonLowTem- 214509 (2004). perature Physics Boulder, Colorado, 1972,editedbyK.D. 34 M. S. Kalenkov, M. Fogelstrom, and Y. S. Barash, Phys. Timmerhaus,W.J.OSullivan,andE.F.Hammel(Plenum Rev.B 70, 184505 (2004). Press, New York,1974), p. 102. 35 G.Deutscher,Y.Dagan,A.Kohen,andR.Krupke,Phys- 22 S. Graser et al., Phys. Rev. Lett. 93, 247001 (pages 4) ica C 341, 1629 (2000). (2004). 36 C. C. Tsuei, J. R. Kirtley, G. Hammerl, J. Mannhart, 23 C. P.Bean, Phys. Rev.Lett. 8, 250 (1962). H.Raffy,andZ.Z.Li,Phys.Rev.Lett. 93,187004(2004). 24 S.Poelders,R.Auer,G.Linker,R.Smithey,andR.Schnei- der, Physica C 247, 309 (1995).