loading

Logout succeed

Logout succeed. See you again!

ebook img

from globe artichoke, and its expression upon UV-C stress PDF

pages12 Pages
release year2009
file size0.47 MB
languageEnglish

Preview from globe artichoke, and its expression upon UV-C stress

View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Wageningen University & Research Publications PlantCellRep(2009)28:963–974 DOI10.1007/s00299-009-0695-1 GENETICS AND GENOMICS Isolation and mapping of a C30H gene (CYP98A49) from globe artichoke, and its expression upon UV-C stress Andrea Moglia Æ Cinzia Comino Æ Ezio Portis Æ Alberto Acquadro Æ Ric C. H. De Vos Æ Jules Beekwilder Æ Sergio Lanteri Received:16January2009/Revised:10February2009/Accepted:1March2009/Publishedonline:20March2009 (cid:1)Springer-Verlag2009 Abstract Globe artichoke represents a natural source of Keywords Globe artichoke (cid:1) C30H (cid:1) Genetic mapping (cid:1) phenolic compounds with dicaffeoylquinic acids along UV-C radiation with their biosynthetic precursor chlorogenic acid (5-caf- feoylquinicacid)asthepredominant molecules.Wereport the isolation and characterization of a full-length cDNA Introduction and promoter of a globe artichoke p-coumaroyl ester 30- hydroxylase (CYP98A49), which is involved in both Globe artichoke (2n = 2x = 34, Cynara cardunculus L. chlorogenic acid and lignin biosynthesis. Phylogenetic var. scolymus) is a perennial, allogamous, primarily vege- analysesdemonstratedthatthisgenebelongstotheCYP98 tatively propagated vegetable, native to the Mediterranean family. CYP98A49 was also heterologously expressed in basin. Its cultivation makes a considerable contribution to yeast, in order to perform an enzymatic assay with p- the agricultural economy of southern Europe, with Italy coumaroylshikimateandp-coumaroylquinateassubstrates. being the major world producer (about 470 Mt per year). Real Time quantitative PCR analysis revealed that Globe artichoke is used mostly for human food, although CYP98A49 expression is induced upon exposure to UV-C the polyphenolic content of its leaves is known to have radiation. A single nucleotide polymorphism in the therapeutic properties. The predominant phenolics present CYP98A49genesequenceoftwoglobeartichokevarieties in the leaf are the dicaffeoylquinic acids and chlorogenic used for genetic mapping allowed the localization of this acid (5-caffeoylquinic acid) (Lattanzio et al. 1994; Wang gene to linkage group 10 within the previously developed et al. 2003). These metabolites possess antioxidative, maps. hepatoprotective, diuretic and choleretic activity (Adzet et al. 1987; Gebhardt 1997; Brown and Rice-Evans 1998). Leafextractshavealsobeenreportedtoinhibitcholesterol biosynthesis, to contribute to the prevention of arterio- sclerosis and other cardiovascular diseases (Gebhardt 1998), and may inhibit HIV integrase, a key enzyme in NucleotidesequencedatareportedareavailableintheGenBank viralreplicationandinsertionintohostDNA(Slaninaetal. databaseunderaccessionnumber:FJ225121 2001). CommunicatedbyH.Judelson. Thereconstructionofthephenylpropanoidpathwayand the elucidation of the biological functions of secondary A.Moglia(cid:1)C.Comino(cid:1)E.Portis(cid:1)A.Acquadro(cid:1) metabolites is an area of active research (Douglas 1996). S.Lanteri(&) Phenylpropanoid compounds, which include flavonoids, DiVaPRA,PlantGeneticsandBreeding,UniversityofTorino, viaL.daVinci44,10095Grugliasco(TO),Italy lignin, coumarins and many small phenolic compounds, e-mail:[email protected] contribute to a multiplicity of plant functions, such as the strengthening of the cell wall, pigmentation of the flower, R.C.H.DeVos(cid:1)J.Beekwilder defense against pathogens and cell signaling (Boudet PlantResearchInternational,P.O.Box16, 6700AAWageningen,TheNetherlands 2007). 123 964 PlantCellRep(2009)28:963–974 To date few studies on phenylpropanoid biosynthetic tobacco upon both UV-B irradiation and insect feeding pathway have been performed in globe artichoke. Three (Cantos et al. 2001; Izaguirre et al. 2007). In globe arti- sequences with high similarity to PAL (phenylalanine choke, we have recently shown that exposure to UV-C ammonia-lyase), the first enzyme involved in the phenyl- consistently increases the level of the major dicaffeoyl- propanoid pathway, have been isolated (De Paolis et al. quinic acid isomer, while the exogenous application of 2008). Moreover, gene sequences encoding hydroxycin- either methyl jasmonate or salicylic acid has no such namoyltransferase (HCT and HQT), involved in the effect (Moglia et al. 2008). Furthermore we previously synthesisofchlorogenicacid,havebeenrecentlyidentified generated the first genetic map of globe artichoke, based (Cominoetal.2007,2009).Newinsightsarethusrequired on a two-way pseudo-testcross strategy (Lanteri et al. for identifying other genes involved in caffeoylquinic acid 2006). An F population was created by crossing ‘Ro- 1 synthesis and elucidating the causal relationships between manesco clone C3’ (a late-maturing, non-spiny type) with the various enzymes. ‘Spinoso di Palermo’ (an early-maturing spiny type), and The 30-hydroxylation of the phenylpropanoid ring is the progeny was genotyped using a number of marker essentialnotonlyforthesynthesisoflignin(Frankeetal. types, such as AFLP, S-SAP, SSR and M-AFLP (Lanteri 2002; Abdulrazzak et al. 2006; Chen and Dixon 2007), et al. 2006). but is also an important step in the synthesis of chloro- Themainobjectivesofthispaperare(a)thecloningofa genic acid (Schoch et al. 2006; Mahesh et al. 2007). C30H gene and its promoter from globe artichoke, (b) the The CYP98 family of plant cytochromes P450 has been study of its transcriptional regulation in response to UV-C designated as the family of enzyme that performs the irradiation and (c) the definition of the gene’s localization meta-hydroxylation step in the phenylpropanoid pathway in a previously developed map in relation to other DNA- (Fig. 1). This meta-hydroxylation is notcatalyzed on free based markers. The in vitro enzymatic assay of C30H was p-coumaric acid, but on its conjugates with shikimic, also performed. quinic or phenyllactic acids (Schoch et al. 2006). The proteinandencodinggenesinthisfamilyarealsoreferred to as C30H. Materials and methods The phenylpropanoid pathway is activated upon exposure to abiotic and biotic stresses, such as wounding, Plant material, DNA and RNA extraction UV irradiation and pathogen attack (Dixon and Paiva 1995; Treutter 2005). The involvement in the stress Seeds of globe artichoke (‘Concerto’, Nunhems) were response of chlorogenic acid has been reported, with its germinated on a 15-cm Petri dish on two layers of wetted concentration increasing in lettuce upon wounding, and in filter paper, and after 2 weeks transplanted into soil-filled Fig.1 Coumaroyl-ester a metabolismaffectedby C3’H recombinantCYP98genes. NADPH+O Conversionofa 2 p-coumaroylquinateto 5-caffeoylquinicacid (chlorogenicacid),b p-coumaroylshikimateto caffeoylshikimate p-coumaroylquinic acid caffeoylquinic acid (chlorogenic acid) b C3’H NADPH+O 2 p-coumaroylshikimic acid caffeoylshikimic acid 123 PlantCellRep(2009)28:963–974 965 10 cm pots in a glasshouse held at 22–24(cid:2)C for 10 weeks. cDNA sequence. Fragments of the expected size were DNA was extracted from leaves, following Lanteri et al. extracted from an agarose gel, cloned into the p-GEMT- (2001). Total RNA was extracted from approximately easy vector and sequenced.TheCYPnumberoftheisolated 100 mg fresh leaf using the Trizol reagent (Invitrogen), genewasprovidedbyDrNelson(http://drnelson.utmem.edu/ following the manufacturer’s instructions. CytochromeP450.html).Multipleglobalsequencealignments were performed using ClustalW (http://www.ebi.ac.uk/ Cloning of the C30H gene and its promoter clustalw/),applyingdefaultparameters.Phylogeneticanaly- sis was performed using MEGA v3.0 (Kumar et al. 2004). Three sets of degenerate primers (COD C30H For, COD Protein sequences used for alignments were: CYP98A1 C30H Nested and COD C30H Rev, see Table 1) were (Sorghum bicolor, AAC39316), CYP98A2 (Glycine max, designedfortheamplificationofC30Hfromtheaminoacid AAB94587),CYP98A3(A.thaliana,NP_850337),CYP98A4 sequences of conserved regions of Arabidopsis thaliana (Oryzasativa,AAU44038),CYP98A6(Lithospermumeryth- (NP_850337), Nicotiana tabacum (ABC69384), Coffea rorhizon, AB017418), CYP98A8 (A. thaliana, NP_177594), canephora (ABB83677), Ocimum basilicum (AAL99200), CYP98A9 (A. thaliana, NP_177595), CYP98A10 (Triticum Medicago truncatula (ABC59086) and Sesamum indicum aestivum,CAE47489),CYP98A11(T.aestivum,CAE47490), (AAL47545) homologs. PCR was performed from 25 ng CYP98A12 (T. aestivum, CAE47491), CYP98A13v1 template of genomic DNA following the CODEHOP (O. basilicum, AAL99200), CYP98A13v2 (O. basilicum, strategy (Morant et al. 2002) which employs a 3 min AAL99201), CYP98A14 (Solenostemon scutellarioides, denaturation at 94(cid:2)C, followed by 20 touch-down cycles CAD20576), CYP98A19 (Pinus taeda, AAL47685), [(94(cid:2)C/1 min, 70(cid:2)C/2 min (reducing by 1(cid:2)C each cycle) CYP98A20 (S. indicum, AAL47545), CYP98A21 (Ammi and 72(cid:2)C/2 min], and 29 cycles of 94(cid:2)C/1 min, primer majus, AAT06912), CYP98A27 (Populus trichocarpa, annealing temperature/1 min and 72(cid:2)C/10 min, and fin- ACC63870), CYP98A28 (Camptotheca acuminata, ishing with a 10 min incubation at 72(cid:2)C. The PCR AAS57921), CYP98A29 (Zea mays, assembled from GSS fragment, A-tailed by the use of Taq DNA polymerase sequences), CYP98A33v1 (N. tabacum, ABC69384), (Promega), was extracted from the agarose gel and cloned CYP98A35(C.canephora,ABB83676),CYP98A36(C.cane- into the p-GEMTeasy vector (Promega, Madison, WI, phora,ABB83677),CYP98A37(M.truncatula,ABC59086), USA). Plasmids from two colonies were sequenced using CYP98A39v1 (T. aestivum, AJ585988), CYP98A39v2 ABI310 capillary sequencer (Applied Biosystem). To (T. aestivum, AJ585990), CYP98A39v3 (T. aestivum, assignaputativefunction,aBLASTsearchwasperformed AJ585991),CYP98A40(T.aestivum,AJ585989),CYP98A41 against Viridiplantae GenBank database. To obtain a (T. aestivum, AJ585987), CYP98A46 (Coptis japonica, complete cDNA sequence, the SMART RACE cDNA BAF98473). The Genome Walker Universal kit (Clontech) amplification kit (Clontech) was employed, following the was used to isolate the globe artichoke C30H promoter, fol- manufacturer’s instructions, except for the use of an lowingthemanufacturer’sprotocol.Fragmentswereisolated annealing temperature 5–10(cid:2)C less than was recom- after agarose gel separation, cloned into the p-GEMTeasy mended. Specific primers were designed for 30 and 50 vectorandsequenced.Thepromoter’sregulatorymotifswere amplification of the C30H transcript, based on the partial identifiedaccordingtoNarusakaetal.(2004). Table1 Primersequencesused CODC30HFor 50-GATGARGTYACHGCYATGGTTGA-30 inthisstudyforgeneisolation (COD),forheterologous CODC30HForNested 50-GAATGGGCNATGGCVGA-30 expression(Expr),forgenetic CODC30HRev 50-ATATCRTARCCHCCRAT-30 mapping(C30H447)andfor ExprC30HFor 50-ATGACCCTCCTACTCCTCCCC-30 RT-qPCR(RT) ExprC30HRev 50-TTACACATCCACGGCCACACG-30 C30H447OuterFor 50-AGTTGTTTTCTCCCAAGAGGCTTGAGGC-30 C30H447OuterRev 50-AGTAATGGATGGGTCACCTACCCAACCC-30 C30H447InnerFor 50-GAACGGAATGAGGATCAAACGTAGTTATCG-30 C30H447InnerRev 50-GAACGGAATGAGGATCAAACGTAGTTATCG-30 RTC30HFor 50-CTCTATCAGCGCCTCCGATT-30 RTC30HRev 50-ATATGATCGGGCCGTATTGC-30 RTActFor 50-TACTTTCTACAACGAGCTTC-30 RTActRev 50-ACATGATTTGAGTCATCTTC-30 123 966 PlantCellRep(2009)28:963–974 Heterologous expression of the C30H gene in brewers’ HPLC analyses yeast Enzymatic assays were analyzed by reverse-phase HPLC TheisolatedglobeartichokeC30Hgenewasamplifiedfrom with PDA detection, as described recently (Moglia et al. cDNA template with primers Expr C30H For and Expr 2008).Inshort,theHPLCsystemcomprisedaWaters 600 C30HRev(Table 1),modifiedtointroduceBglIIandEcoRI gradientcontroller,aWaters996PDAdetectorandacolumn cloning sites at the 50 and 30 ends. The amplicons were incubatorheldat40(cid:2)C.Forthechromatographicseparation cloned into p-GEMTeasy vector and sequenced using an analytical column Luna C18 (2) (2 mm 9 150 mm, ABI310 capillary sequencer. After BglII and EcoRI 100 A˚, particle size 3 lM) with a pre-coulmn (2 mm 9 digestion, the fragments were directionally cloned into the 4 mm) from Phenomenex was used. The mobile phase expression cassette of pYeDP60 (Pompon et al. 1996) consisted of degassed trifluoroacetic acid: ultrapure water digestedwithBamHIandEcoRI.Saccharomycescerevisiae (1:1,000 v/v,eluateA),andtrifluoroaceticacid:acetonitrile strain WAT11 is a derivative from strain W303-1B, in (1:1,000 v/v, eluate B), starting at 5% B, 95% A and which yeast CPR gene (coding for a NADPH-cytochrome increasinglinearlyto35%B,65%Aover45 min.Theflow P450 reductase) was replaced by the Arabidopsis ATR1 ratewas1 ml/min,theinjectionvolume10 ll,andtherange (Urban et al. 1997). WAT11 was transformed using the ofdetectionwavelengthwas240–600 nm.Peakareaswere lithium acetate/single stranded carrier DNA/polyethylene calculatedusingEmpowersoftware(Waters). glycol method (Gietz and Woods 2002). Transformants were selected on SGI plates (1 g/l bactocasaminoacids, UV-C treatment, and RT-qPCR assays 20 mg/l tryptophan, 6.7 g/l yeast nitrogen base, 20 g/l glucose, 20 g/l bactoagar) and successful transformation Three globe artichoke foliar discs were exposed to UV-C was confirmed by PCR analysis. treatment (16 W germicidal lamp during 20 min) as described by Moglia et al. (2008). They were then ground Enzymatic assay of the C30H activities separately to a fine powder in liquid nitrogen, and RNA extraction was performed from 100 mg of each powdered Yeast microsomes were isolated after 24 h of induction leaf, as described above. Primers (RT C30H For, RT C30H on 20 g/l galactose at 30(cid:2)C, according to Pompon et al. Rev, Table 1) were designed on C30H sequence using the (1996). The amount of total protein in microsomes was Primer3software(http://frodo.wi.mit.edu/cgi-bin/primer3/ determined according to Bradford protein assay. The sub- primer3_www.cgi). As a housekeeping gene, actin was strate specificity of microsomal fractions, extracted from chosen for its stability and level of expression, which is the recombinant yeast culture, was tested with p-coumaric comparable to the genes of interest and whose expression acid, p-coumaroylshikimate and p-coumaroylquinate remainedstableaftertheUV-Cstress.Theprimers(RTAct (kindly provided by Dr. Ullmann, Universite´ Louis For,RTActRev,Table 1)weredesignedontheglobearti- Pasteur, Strasbourg). The negative control was represented chokeactin(ACT,AM744951). by the microsomal fraction of yeast transformed with an For the real time quantitative PCR (RT-qPCR), cDNA empty plasmid, and the positive control from yeast was first prepared in a 20 ll RT reaction containing 59 expressing CYP98A3 (ortholog of C30H in A. thaliana, iScript Reaction Mix (Bio-Rad), 1 ll iScript Reverse obtained from Arabidopsis Biological Resource Center Transcriptase and 1 lg total RNA. PCR primers were Arabidopsis, Ohio State University). C30H enzymatic designed to detect globe artichoke C30H and actin activity was measured in 100 ll reaction tubes containing (Table 1). The cDNA was diluted to obtain a threshold 600 lM NADPH, a range of p-coumaroylshikimate con- cycle(CT)valuebetween25and35.The20 llRT-qPCRs, centrations (0, 2, 5, 8, 10, 15, 20, 40, 60, 80, 100 and performed in triplicate for each sample, contained 19 iQ 150 lM), 100 mM sodium phosphate buffer (pH 7.4) and Supermix, 19 SYBR-Green I (iQTM, SYBR(cid:3) GreenSu- 30 lg of total microsomal proteins. The same conditions permix), 10 lM primer and 3 ll diluted cDNA. PCR were applied with p-coumaroylquinate or p-coumaric acid reactions were carried out in 48-well optical plates using as substrate. After starting the reaction upon addition of the iCycler Real-time PCR Detection System (Bio-Rad the enzyme, the tubes were shaken in the dark at 30(cid:2)C Laboratories, USA). The PCR conditions comprised an for 30 min, and the reaction was stopped by adding initial incubation of 95(cid:2)C/5 min, followed by 35 cycles of 100 ll of trifluoroacetic acid:methanol (1:1,000 v/v). The 95(cid:2)C/15 s and 60(cid:2)C/60 s. In all experiments, appropriate reaction products were filtered through a 0.45 lM Anotop negativecontrolscontainingnotemplateweresubjectedto 10 filter (Whatman) and immediately analyzed by HPLC the same procedure to detect or exclude any possible with photodiode array (PDA) detection, as described contamination. Melting curve analysis was performed at below. the end of amplification. 123 PlantCellRep(2009)28:963–974 967 Standard curves were analyzed using iCycler iQ soft- fragment was obtained and showed (Blastx) high amino ware. Amplicons were analyzed by the comparative acid similarity ([90%) with members of the CYP98A threshold cycle method, in which DDCt is calculated as family. The original 800 bp genomic sequence included DCtI - DCtM, where DCtI is the Ct value for the any one 171 bp intron. target gene normalized to the endogenous housekeeping After RACE-PCR, the sequence was extended to gene and DCtM is the Ct value for the calibrator, which is 1,524 bp, representing a 508 residue protein (CYP98A49, also normalized to housekeeping gene. accession number FJ225121). The globe artichoke CYP98A49 gene contains four expected P450 conserved SNP detection and linkage analysis domains: the proline rich membrane hinge (PPGP), the I-helixinvolvedinoxygenbindingandactivation(A/G-G- Sequence variation in the C30H gene was sought by com- X-E/D-T-T/S), the clade signature (PERF) and the cys- paring the copy present in the non spiny globe artichoke teine-containing region (PFGXGRRXCX) (Fig. 2). variety ‘Romanesco C3’ with the spiny type ‘Spinoso di Aphylogenetictreewasconstructedusing30sequences Palermo’. Parental genomic DNAs were amplified with from CYP98 family (Fig. 3). Most of the accessions are Expr C30H For and Exp C30H Rev (Table 1), and the included in two main clusters with high bootstrap proba- amplicons were directly sequenced to facilitate SNP bility:onecomprisesgenesderivedfromMonocotsspecies mining. and the other one derived from Dicots and a Gymnosperm SNPs genotyping was carried out with the tetra-primers (P. taeda) species. This division into two main groups (as ARMS-PCR method (Ye et al. 2001) by using two sets of previously observed by Morant et al. 2007) indicates that outer and inner primers (Table 1), designed using the the encoding genes resulted from early duplication of software made available on-line (http://cedar.genetics. ancestral gene. As opposite CYP98A8 and CYP98A9, two soton.ac.uk/public_html/primer1.html). PCR products were otherCYP98AmembersfromA.thaliana,andCYP98A20 separatedby2%agarosegelelectrophoresis.Thesegregation are well separated from the main clusters.Globe artichoke dataobtainedinanestablishedmappingpopulation(Lanteri CYP98A49 grouped in a sub-cluster of five proteins, and et al. 2006) were combined with those associated with the seemed closer to CYP98A46 from Coptis, CYP98A27 markersusedtoconstructthemapandusedtolocatethemap from Populus, CYP98A37 from Medicago and CYP98A2 positionofC30Hgene. from Glycine. Segregation data of C30H-SNP marker were monitored In addition to the coding region, we searched the 2-kb and analyzed in the 94 individuals of F1 progeny together sequence upstream of the ORF (FJ225121). The withthoseof35AFLP,41S-SAP,38M-AFLPand51SSR CYP98A49 putative transcription start site was 24 bp markers previously applied for globe artichoke map con- upstream of the ATG start codon. Upstream of this tran- struction(Lanterietal.2006).Thegoodnessoffitbetween scriptionstartsiteareaputativeTATAbox(-32 bp)anda observedandexpectedsegregationdatawasassessedusing putativeCAATbox(-145 bp).Thepromotercontainsthe the Chi-square (v2) test. Independent linkage maps were following regulatory elements: recognition sites of MYB, constructed for each parent using the double pseudo-test- MYC, DRE-core, W-Box, TGA Box, P-Box, BoxIV and cross mapping strategy (Weeden 1994) by using JoinMap WRE1 (wound responsive element 1). All these elements, 2.0 software (Stam and Van Ooijen 1995). For both maps, exceptWRE1,werealsodetectedinthepromoterregionof linkage groups were accepted at a LOD threshold of 4.0. Arabidopsis CYP98A3 (Fig. 4). To determine marker order within a linkage group, the following JoinMap parameter settings were used: In vitro enzymatic activity Rec = 0.40, LOD = 1.0, Jump = 5. Map distances were converted to centiMorgans using the Kosambi mapping In order to test its enzymatic activity, the CYP98A49 function (Kosambi 1944). Linkage groups were drawn protein from globe artichoke was expressed in yeast. The using MapChart 2.1 software (Voorrips 2002). microsomal fraction was subsequently isolated and tested for enzymatic activity in vitro using several substrates at different concentrations. In the presence of p-coumaroyl- Results shikimate (Fig. 5a), the recombinant protein synthesized a compound that could be identified as caffeoylshikimate. Gene and promoter isolation The enzymatic reaction was completely dependent on the presence of NADPH. The same product was generated by To isolate globe artichoke C30H coding sequences, microsomes from yeast expressing A. thaliana CYP98A3 degenerated primers were used to amplify an 800 bp (Fig. 5b, positive control), but not by yeast expressing the fragment from leaf genomic DNA. Only one amplified empty vector (Fig. 5c, negative control). 123 968 PlantCellRep(2009)28:963–974 CCooffffeeaa MMAALLFFLLLLLLLLTTFFIIFFIILLPPPPYYYYLLYYQQKKLLRRFFKKLLPPPPGGPPRRPPLLPPVVVVGGNNLLYYDDIIKKPPVVRRFFRRCCFFAADDWWSSRRAAYYGGPP CCyynnaarraa MMTTLLLLLLLLPPLLSSFFTTLLIILLVVAAYYAALLYYQQRRLLRRFFKKLLPPPPGGPPRRPPWWPPIIVVGGNNLLYYDDVVKKPPIIRRFFRRCCYYAAEEWWAAQQQQYYGGPP AArraabbiiddooppssiiss MMSSWWFFLLIIAAVVAATTIIAAAAVVVVSSYYKKLLIIQQRRLLRRYYKKFFPPPPGGPPSSPPKKPPIIVVGGNNLLYYDDIIKKPPVVRRFFRRCCYYYYEEWWAAQQSSYYGGPP **:: ::**:: :::: :: ..** ** **::****::**::******** ** **::************::****::********:: ::**:::: ****** CCooffffeeaa IIIISSVVWWFFGGSSTTLLNNVVVVVVSSNNAAEELLAAKKEEVVLLKKEENNDDQQQQLLSSDDRRHHRRSSRRSSAAAAKKFFSSRREEGGQQDDLLIIWWAADDYYGGPPHHYYVV CCyynnaarraa IIIISSVVWWFFGGSSIILLNNVVVVVVSSNNSSEELLAAKKEEVVLLKKEEKKDDQQQQLLAADDRRHHRRSSRRSSAAAAKKFFSSRRDDGGQQDDLLIIWWAADDYYGGPPHHYYVV AArraabbiiddooppssiiss IIIISSVVWWIIGGSSIILLNNVVVVVVSSSSAAEELLAAKKEEVVLLKKEEHHDDQQKKLLAADDRRHHRRNNRRSSTTEEAAFFSSRRNNGGQQDDLLIIWWAADDYYGGPPHHYYVV **********::**** ************..::******************::****::**::********..****:: ******::**************************** CCooffffeeaa KKVVRRKKVVCCTTLLEELLFFSSPPKKRRLLEEAALLKKPPIIRREEDDEEVVTTAAMMVVEESSIIYYKKDDCCTTLLRREEGGSSGGQQSSLLLLVVKKKKYYLLGGTTVVAAFFNN CCyynnaarraa KKVVRRKKVVCCTTLLEELLFFSSPPKKRRLLEEAALLRRPPIIRREEDDEEVVSSAAMMVVEESSIIFFNNDDCCIIHHPPDDKKNNGGKKSSLLLLVVKKGGYYLLGGAAVVAAFFNN AArraabbiiddooppssiiss KKVVRRKKVVCCTTLLEELLFFTTPPKKRRLLEESSLLRRPPIIRREEDDEEVVTTAAMMVVEESSVVFFRRDDCCNNLLPPEENNRRAAKKGGLLQQLLRRKKYYLLGGAAVVAAFFNN **********************::**********::**::**************::**********::::..**** :: ..::..** :::: ******::******** CCooffffeeaa NNIITTRRLLAAFFGGKKRRFFVVNNSSEEGGVVMMDDEEQQGGKKEEFFKKEEIITTAANNGGLLKKLLGGAASSLLAAMMAAEEHHIIPPWWLLRRWWLLFFPPLLDDEEAAAAFFAA CCyynnaarraa NNIITTRRLLAAFFGGKKRRFFVVNNSSEEGGVVMMDDDDKKGGRR--VVKKAAIIVVAANNGGLLKKLLGGAASSLLAAMMAAEEHHIIPPWWIIRRWWFFFFPPLLEEEEEEAAFFAA AArraabbiiddooppssiiss NNIITTRRLLAAFFGGKKRRFFMMNNAAEEGGVVVVDDEEQQGGLLEEFFKKAAIIVVSSNNGGLLKKLLGGAASSLLSSIIAAEEHHIIPPWWLLRRWWMMFFPPAADDEEKKAAFFAA **********************::**::******::**::::** ..** **..::******************::::************::****::**** ::** ****** CCooffffeeaa KKHHGGAARRRRDDRRLLTTRRAAIIMMEEEEHHRRLLAARREEKKSSGGGGAAKKQQHHFFVVDDAALLLLTTLLKKDDKKYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG CCyynnaarraa KKHHGGAARRRRDDRRLLTTRRAAIIMMDDEEHHTTAAAARRQQKKTTGGGGTTKKQQHHFFVVDDAALLLLTTLLQQQQQQYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG AArraabbiiddooppssiiss EEHHGGAARRRRDDRRLLTTRRAAIIMMEEEEHHTTLLAARRQQKKSSSSGGAAKKQQHHFFVVDDAALLLLTTLLKKDDQQYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG ::**************************::**** ****::**::..**::**********************::::::************************************** CCooffffeeaa MMDDTTTTAAIISSVVEEWWAAMMAAEEVVIIKKNNPPRRVVQQQQKKVVQQEEEELLDDQQVVIIGGYYEERRVVMMIIEETTDDFFSSNNLLPPYYLLQQSSVVAAKKEESSLLRRLL CCyynnaarraa MMDDTTTTAAIISSVVEEWWAAMMAAEELLIIKKNNPPRRVVQQQQKKAAQQEEEELLDDRRVVIIGGYYEERRVVLLTTEEPPDDFFSSSSLLPPYYLLQQCCVVAAKKEEAALLRRLL AArraabbiiddooppssiiss MMDDTTTTAAIITTAAEEWWAAMMAAEEMMIIKKNNPPRRVVQQQQKKVVQQEEEEFFDDRRVVVVGGLLDDRRIILLTTEEAADDFFSSRRLLPPYYLLQQCCVVVVKKEESSFFRRLL ************::..************::******************..******::**::**::** ::**:::: **..****** **********..**..****::::**** CCooffffeeaa HHPPPPTTPPLLMMLLPPHHRRSSNNAASSVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAAVVWWRRNNPPLLEEFFRRPPEERRFFLLEEEEDDVVDD CCyynnaarraa HHPPPPTTPPLLMMLLPPHHKKAANNSSNNVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAATTWWKKNNPPLLEEFFRRPPEERRFFLLEEEEDDVVDD AArraabbiiddooppssiiss HHPPPPTTPPLLMMLLPPHHRRSSNNAADDVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAAVVWWKKNNPPFFEEFFRRPPEERRFFLLEEEEDDVVDD ********************::::**::..****************************************************..**::****::************************** CCooffffeeaa MMKKGGHHDDFFRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMLLGGHHLLLLHHHHFFNNWWAAPPPPHHGGLLSSPPDDEEIIDDMMGGEESSPPGGLL CCyynnaarraa MMKKGGHHDDYYRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMLLGGHHLLVVHHHHFFSSWWAAPPAADDGGLLSSPPEEEEIIDDMMSSEENNPPGGLL AArraabbiiddooppssiiss MMKKGGHHDDFFRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMMMSSHHLLLLHHHHFFVVWWTTPPPPQQGGTTKKPPEEEEIIDDMMSSEENNPPGGLL **********::**************************************************::..****::****** **::**....** ..**::********..**..****** CCooffffeeaa VVTTYYMMRRTTAALLRRAAVVPPTTPPRRLLPPSSHHLLYYEERRVVAAVVDDMM 550088 CCyynnaarraa VVTTYYMMRRTTPPLLQQAAIIPPTTPPRRLLPPAAMMLLYYKKRRVVAAVVDDVV 550077 AArraabbiiddooppssiiss VVTTYYMMRRTTPPVVQQAAVVAATTPPRRLLPPSSDDLLYYKKRRVVPPYYDDMM 550088 ************..::::**::..**********:: ****::****.. **:: Fig.2 Amino acid sequences of globe artichoke CYP98A49 (FJ225121), Arabidopsis CYP98A3 (NP850337) and coffee CYP98A36 (ABB83677).TheP450conserveddomainsaresurroundedinboxes Moreover,theenzymewasabletoconvertp-coumaroyl- by RT-qPCR, using actin to normalize the expression quinateinto5-O-caffeoylquinate(=chlorogenicacid)although levels.Standardcurvesforeachamplificationsystem(data the reaction was much less efficient and required a higher not shown) revealed a correlation coefficient r[0.99 and concentrationofsubstrate(100 lM)togenerateadetectable efficiency higher than 90%, as indicated by slope values. product. However, the low enzymatic activity hampered The level of CYP98A49 transcripts in UV-exposed leaves anyaccurateevaluationofenzymaticaffinity.Inthepresence was 4.2 ± 0.95 (n = 3) fold higher than that of the non- ofp-coumaricacid,noenzymaticconversionwasdetectedat irradiatedcontrolleaves,indicatingincreasedexpressionof all(datanotshown). this gene upon UV-C treatment. UV-induced response SNP detection and linkage analysis TherelativeexpressionoftheCYP98A49geneinresponse A comparison of the CYP98A49 genomic sequence of toUV-Cexposureofglobeartichokeleaveswasmeasured ‘Romanesco C3’ and ‘Spinoso di Palermo’ resulted in the 123 PlantCellRep(2009)28:963–974 969 Fig.3 Neighbor-joiningtree 5500 CCYYPP9988AA22 GGllyycciinnee phylogeneticanalysisofglobe artichokeCYP98A49.The 3355 CCYYPP9988AA3377MMeeddiiccaaggoo lengthofthelinesindicatesthe 1133 CCYYPP9988AA2277PPooppuulluuss relativedistancebetweennodes. Thelistofcytochromep450s CCYYPP9988AA4499CCyynnaarraa updatedbyDr.Nelsonat http://drnelson.utmem.edu/ 11443344 CCYYPP9988AA4466 CCooppttiiss CytochromeP450.htmlwasthe 3388 CCYYPP9988AA2211AAmmmmii startingpointfortheanalysis CCYYPP9988AA3366CCooffffeeaa 55881111 CCYYPP9988AA1144SSoolleennoosstteemmoonn CCYYPP9988AA1133vv11 OOcciimmuumm 5599 9922 110000 CCYYPP9988AA1133vv22 OOcciimmuumm CCYYPP9988AA33 AArraabbiiddooppssiiss 5555 CCYYPP9988AA1199 PPiinnuuss CCYYPP9988AA2288 CCaammppttootthheeccaa CCYYPP9988AA66 LLiitthhoossppeerrmmuumm 3377 7777 8855 CCYYPP9988AA3333vv11 NNiiccoottiiaannaa 7766 CCYYPP9988AA3355CCooffffeeaa CCYYPP9988AA1122 TTrriittiiccuumm 110000 CCYYPP9988AA11SSoorrgghhuumm 6677 CCYYPP9988AA2299ZZeeaa 110000 CCYYPP9988AA44OOrryyzzaa 110000 CCYYPP9988AA1100TTrriittiiccuumm 110000 CCYYPP9988AA1111TTrriittiiccuumm 9911 CCYYPP9988AA4400TTrriittiiccuumm CCYYPP9988AA4411PP TTrriittiiccuumm 110000 CCYYPP9988AA3399vv11 TTrriittiiccuumm 8800 CCYYPP9988AA3399vv22 TTrriittiiccuumm 110000 8800 CCYYPP9988AA3399vv33 TTrriittiiccuumm CCYYPP9988AA2200SSeessaammuumm CCYYPP9988AA88 AArraabbiiddooppssiiss 110000 CCYYPP9988AA99AArraabbiiddooppssiiss 00..0055 -2000 -1500 -1000 -500 0 MMcc MMcc MMcc MMbb MMbbMMcc IVIV MM bb M Mbb MMcc W W WWrrMMbb D D TT PP Cc DD MMcc MMbb TT MMcc MMccTT PP WW MMbb MMbbMMbb IIVV MMbb PP PP At Fig.4 Thelocalizationofcis-actingelementsinthepromoterregion (Mc), DRE-core (D), W-box (W), TGA box (T), P-Box (P), BoxIV ofCYP98A3ofArabidopsis(At)andofglobeartichokeCYP98A49 (IV),WRE-1(Wr) (Cc). In particular are shown recognition sites of MYB (Mb), MYC 123 970 PlantCellRep(2009)28:963–974 Fig.5 HPLC-PDAanalysisofreactionproductsofyeastmicrosomes plasmid(c).Chromatogramsarerecordedat312nm.PeakX1isthe containing globe artichoke CYP98A49 (a) or A. thaliana CYP98A3 substrate; while the other peaks close to it (X2, X3) represent other (b) using p-coumaroylshikimate as a substrate (50lM). Control isomers(3and4)ofp-coumaroylshikimate.Theinjectionvolumewas reactions were derived from yeast transformed with the empty 10ll SSpp xx RRoo FF11 Fig.6 Single nucleotide polymorphism segregation in a mapping population, as detected by tetra-primers ARMS-PCR on agarose gel. RomanescoC3(Ro)andSpinosodiPalermo(Sp) identification of one nucleotide difference at position 447 determined (Lanteri et al. 2006) are slightly changed, as (data not shown). The tetra primers ARMS-PCR assay two inversions and a small shift of a few centimorgans demonstrates that both parents are heterozygous at this were detected (Fig. 7). baseposition.TheC30Hsnp447locussegregatedina1:2:1 ratio (v2 = 2.80, P[0.1) in the mapping population (Fig. 6), and mapped to linkage group 10 in both maps, Discussion *2 cMfromthemicrosatellitelocusCELMS-39and8 cM from the AFLP locus p45/m47-07 (Fig. 7). Twenty-one TheP450proteinsformalargefamilyofenzymesinvolved markers were assigned to the female LG 10: four micro- inplantmetabolism,butthefunctionofabout80%ofthem satellites (CELMS-04, -20, -39 and CLIB-04), two S-SAP remains unknown. The A. thaliana genome includes 273 (cyre5 markers), 2 M-AFLP (polyGA markers) and 12 cytochromeP450genesdistributedin45familiesandsub- AFLP together with SNP-C30H, covering 84.4 cM and a families (http://drnelson.utmem.edu/Arablinks.html). mean inter-marker distance of 4.22 cM. The majority of Globe artichoke CYP98A49 sequence is highly homo- map interval (70%) was\5 cM and three gaps of 8 cM logous to some of the other CYP98 genes (up to 86% were present. The male LG 10 was composed of 18 of identity and 93% of similarity to CYP98A46 from markers: two microsatellite (CELMS-04 and -39) one C.japonica),andcontainstheconserveddomainsassociated S-SAP, 14 AFLP and the SNP-C30H, spanned 99.4 cM with P450 family members (Fig. 2). The 30-hydroxylation with a marker density of5.84 cM. Three large caps longer step is critical in the synthesis of phenolic compounds. than 12 cM were detected. Nine intercross markers (com- Most of the members of the CYP98 family, described to prising C30H gene) were shared between the parents, date, metabolize shikimate esters of p-coumaric acid more allowingthealignmentofthematernalandpaternalLG10 efficiently than quinate esters (Schoch et al. 2001, 2006; (Fig. 7).EstimationofmarkersorderanddistanceofLG10 Morant et al. 2007). On the other hand CYP98A35 from were improved with the integration of the co-dominant coffee is capable of metabolizing p-coumaroylquinate and SNP-C30H markers, increasing the number of bridge p-coumaroylshikimate with the same efficiency (Mahesh markers. The relative orders of some markers previously et al. 2007). CYP98A49 from globe artichoke appears to 123 PlantCellRep(2009)28:963–974 971 LG 10 male LG b male LG a p13/m61-08 0 0 p13/m61-08 FemaleLG a FemaleLG b e37/m50-03 0 0 e37/m50-03 e35/m48-02 15 15 e35/m48-02 p45/m47-01 8 8 p45/m47-01 e37/m47-10 27 27 e37/m47-10 CELMS-04 29 29 CELMS-04 pGA/p45-04 16 16 pGA/p45-04 p12/m47-01 33 33 p12/m47-01 e37/m48-01 35 35 e37/m48-01 CELMS-04 22 22 CELMS-04 pGA/m60-02 27 27 pGA/m60-02 CLIB-04 33 33 CLIB-04 e37/m50-02 47 47 e37/m50-02 CELMS-20 36 36 CELMS-20 38 e35/m47-05 e35/m47-05 40 e35/m48-12 54 54 e35/m48-12 42 p12/m47-08 43 e36/m59-02 p12/m47-08 45 e38/m50-11 60 60 e38/m50-11 47 cyre5/m49-04 p45/m47-07 50 49 p45/m47-07 cyre5/m49-04 56 e35/m47-05 69 69 e35/m47-05 e36/m59-02 57 57 snpC3H CELMS-39 58 58 CELMS-39 p45/m50-02 74 74 p45/m50-02 p13/m60-04 60 61 p13/m60-04 pp1425//mm5407--0015 6634 6673 pp1425//mm5407--0016 cyper43e565///mmm454799---000724 788901 8729 pcy4r5e/m5/m474-09-704 p45/m47-06 69 70 p45/m47-05 84 e36/m59-02 e38/m50-07* 74 74 e38/m50-07* snpC3H 89 89 CELMS-39 CELMS-39 92 92 p45/m47-05 e38/m50-08* 80 80 e38/m50-08* p45/m47-06 95 97 p45/m47-06 cyre5/m49-01** 84 84 cyre5/m49-01** p45/m47-05 99 Fig.7 Linkage group (LG) 10 of the globe artichoke varietal types previouslyreportedbyLanterietal.(2006)arepresentedtooneside, ‘RomanescoC3’(femaleparent,whiteLGsontheleft)and‘Spinoso and changed marker orders are indicated by dotted lines. Asterisks diPalermo’(maleparent,grayLGsontheright).Intercrossmarkers indicate markers showing significant levels of segregation distortion are shown in bold and are connected by a solid line. The LGs (singleasterisk0.1[PC0.05,doubleasterisk0.05[PC0.01) show a lower affinity for quinate esters than shikimate This compound is then converted by HCT (Hoffmann esters (Fig. 5), but the limited activity detected for shi- et al. 2003; Comino et al. 2007) to caffeoyl-CoA which is kimate esters hampered an accurate evaluation of conjugated to quinic acid by HQT (Niggeweg et al. 2004) enzymatic activity with quinate esters. activity,togive5-caffeoylquinicacid. Shikimate esters are transient intermediates in the for- It has been long debated whether the HQT enzyme mation of more oxygenated compounds such as lignin either directly acts on caffeoyl-CoA and quinic acid to precursorsandchlorogenicacid.Twodistinctpathwayshave produce chlorogenic acid, or whether it synthesizes been proposed for the synthesis of chlorogenic acid: (1) p-coumaroylquinate from p-coumaroyl-CoA and quinic pathway from p-coumaroyl-CoA, involving first a trans- acid,whichisconvertedtochlorogenicacidbyC30H.Strong esterification of this compound and quinic acid via supportforthefirstalternativehasbeenprovidedintomato,in hydroxycinnamoyl-CoA:quinate hydroxycinnamoyl trans- whichsilencingoftheHQTgeneresultedina98%reduction ferase (HQT) activity and then hydroxylation of p-cou- inthelevelofchlorogenicacid(Niggewegetal.2004). maroylquinateto5-caffeoylquinicacid,catalyzedbyC30H; ThegeneencodingHCTinglobeartichokehasrecently (2)pathwayinvolvingp-coumaroyl-CoAtrans-esterification been isolated (Comino et al. 2007). It is not clear, in this with shikimic acid by means of hydroxycinnamoyl-CoA: stage, if there are other C30H genes and for this reason is shikimate hydroxycinnamoyl transferase (HCT), then not yet possible to conclude what is the route involved in p-coumaroylshikimate hydroxylation to caffeoylshikimate. the synthesis of chlorogenic acid in globe artichoke. 123 972 PlantCellRep(2009)28:963–974 Some CYP98 genes are expressed constitutively, while mapped. In order tomove toa crossingstrategy for breed- others (particularly those involved in the stress response) ing,agreaterknowledgeofglobeartichokegenomewillbe are inducible. A. thaliana CYP98A3 is constitutively essential.Inparticularitwillbeadvantageoustoestablisha expressed and is upregulated by wounding (Schoch et al. framework of linkage relationships for reaching a better 2001). Phaseolus vulgaris CYP98A5 is inducible by knowledge of the genetic bases of the phenylpropanoid treatment with either 3,5-dichlorosalicylic acid or 2,6-di- pathway. The linkage relationships we established for the chloroisonicotinic acid (Basson and Dubery 2007), while globe artichoke CYP98A49 gene may thus represent an the activity of Daucus carota 5-O-(4-coumaroyl)-D-qui- initial step in this direction (Fig. 7). The precision of both nate/shikimate 30-hydroxylase could be greatly increased marker orderandinter-markerdistancesofLG10 hasbeen by irradiation with blue/UV light (Ku¨hnl et al. 1987). In improvedwiththe integration of CYP98A49gene. order to evaluate the changes of CYP98A49 expression Future effortsof ourresearch will go inthe direction of levels in response to UV-C induction, we performed RT- studyingtheroleoftheCYP98A49geneinglobeartichoke PCR experiments. We have shown in a previous work development, by means of forward genetic approaches, (Moglia et al. 2008) that in globe artichoke the production and in the identification of QTLs associated with the pro- ofdicaffeoylquinicacids,whicharepowerfulantioxidants, duction of phenolic compounds such as chlorogenic acid can be induced upon exposure to UV-C, which suggests a and dicaffeoylquinic acids. Indeed we are proceeding to role for these compounds in the protection of young leaf the construction of genetic maps based on F1 populations tissue from reactive oxygen species generated by excess involving combinations between ‘Romanesco clone C3’ light.TheexpressionlevelofCYP98A49genewasstrongly with either cultivated as wild cardoon accessions; these increased (greater than fourfold higher) in UV-C treated populations will allow comparative QTL mapping studies. leaves, as compared to non-treated control leaves, thus indicating not only activation in response to UV light, but Acknowledgments The authors kindly thank Harry Jonker (PRI) for his excellent technical assistance. The authors kindly thank Dr. likelyalsoaputativeroleofthisenzymeindicaffeoylquinic Ullmann (Universite´ Louis Pasteur, Strasbourg) for providing the acidaccumulation. substrates of the reaction, p-coumaroylquinate and p-coumaroyl- Transcription factors are important in the regulation of shikimate and for critical reading of the paper. The authors kindly plant responses to environmental stresses. Most of cyto- thank Dr Nelson for providing CYP number to the new gene. The authors kindly thank Prof G. Mauromicale and Dr R. Mauro for chrome P450 genes induced by abiotic and biotic stresses providingplantmaterial.AndreaMogliaacknowledgesMIUR,forits containtherecognitionsitesofMYB,MYC,TGA-boxand financial support.JulesBeekwilder wasfinancially supportedbythe W-box for WRKY factors in their promoters (Narusaka EU 6th Frame FLORA project (2005-FOOD-CT-01730). Ric C. H. et al. 2004). The sequence analysis of the upstream region DeVosacknowledgesinitialsupportfromtheCentreforBioSystems Genomics, an initiative under the auspices of the Netherlands of globe artichoke CYP98A49 gene revealed the presence GenomicsInitiative(NGI/NWO). of most of these regulatory regions (Fig. 4). Moreover, the same kind of motifs was found in the promoter of ArabidopsisCYP98A3(nottestedforUVresponse),which References ishomologoustotheglobeartichokeCYP98A49gene.Ina previous work (Narusaka et al. 2004) the distribution AbdulrazzakN,PolletB,EhltingJ,LarsenK,AsnaghiC,RonseauS, of cis-acting elements in the regulatory region of P450 Proux C, Erhardt M, Seltzer V, Renou J, Ullman P, Pauly M, ArabidopsisgenesactivatedinresponsetoUV-Cradiation, Lapierre C, Werck-Reichhart D (2006) A coumaroyl-ester- 3-hydroxylase insertion mutant reveals the existence of non was analyzed. Interestingly, all the UV-induced P450s in redundant meta-hydroxylation pathways and essential roles for Arabidopsis share with the globe artichoke CYP98A49 phenolic precursors in cell expansion and plant growth. Plant promoter the recognition sites of MYB, MYC and the Physiol140:30–48.doi:10.1104/pp.105.069690 binding site of WRKY factors (W-box). Therefore, it is AdzetT,CamarassaJ,LagunaCJ(1987)Hepatoprotectiveactivityof polyphenolic compounds from Cynara scolymus against CCl4 possible that the cis-acting elements recognized by MYB, toxicityinisolatedrathepatocytes.JNatProd50:612–617 MYC and WRKY transcription factors may regulate the Basson A, Dubery I (2007) Identification of a cytochrome P450 expression of genes induced upon UV-C. cDNA (CYP98A5) from Phaseolus vulgaris, inducible by 3, 5- The identification of the genetic basis of metabolite dichlorosalicylicacidand2,6-dichloroisonicotinicacid.JPlant Physiol164:421–428.doi:10.1016/j.jplph.2006.02.006 variation in A. thaliana has been pioneered by Keurentjes BoudetA(2007)Evolutionandcurrentstatusofresearchinphenolic et al. (2006), by applying quantitative trait loci (QTL) compounds. Phytochemistry 68:2722–2735. doi:10.1016/j. analysesonalargemetabolomicsdataset.Thisapproach,if phytochem.2007.06.012 applied to crop species, may lead to the development of Brown J, Rice-Evans C (1998) Luteolin-rich artichoke extract protects low density lipoprotein from oxidation in vitro. Free informative genetic markers that could be exploited in RadicRes29:247–255.doi:10.1080/10715769800300281 breedingprogramsaimedatincreasingthelevelofspecific CantosE,EspinJ,Tomas-BarberanF(2001)Effectofwoundingon phytochemicals.TheC.cardunculusgenomeisstillpoorly phenolic enzymes in six minimally processed lettuce cultivars 123

See more

The list of books you might like