loading

Logout succeed

Logout succeed. See you again!

ebook img

Genetics and Biotechnology of Bacilli PDF

pages382 Pages
release year1988
file size12.244 MB
languageEnglish

Preview Genetics and Biotechnology of Bacilli

Academic Press Rapid Manuscript Reproduction Proceedings of the Fourth International Conference on Bacilli Held at San Diego, California June 21-24,1987 Genetics and Biotechnology of Bacilli Volume 2 Edited by A. T. GANESAN Department of Genetics Stanford University School of Medicine Stanford, California JAMES A. HOCH Division of Cellular Biology Research Institute of Scripps Clinic La Jolla, California ACADEMIC PRESS, INC. Harcourt Brace Jovanovich, Publishers San Diego New York Berkeley Boston London Sydney Tokyo Toronto COPYRIGHT © 1988 BY ACADEMIC PRESS, INC. ALL RIGHTS RESERVED. NO PART OF THIS PUBLICATION MAY BE REPRODUCED OR TRANSMITTED IN ANY FORM OR BY ANY MEANS, ELECTRONIC OR MECHANICAL, INCLUDING PHOTOCOPY, RECORDING, OR ANY INFORMATION STORAGE AND RETRIEVAL SYSTEM, WITHOUT PERMISSION IN WRITING FROM THE PUBLISHER. ACADEMIC PRESS, INC. 1250 Sixth Avenue San Diego, California 92101 United Kingdom Edition published by ACADEMIC PRESS INC. (LONDON) LTD. 24-28 Oval Road, London NW1 7DX Library of Congress Cataloging-in-Publication Data Genetics and biotechnology of bacilli, volume 2. Proceedings of the Fourth International Conference on Bacilli, San Diego, Calif., June 21-24, 1987. Includes index. 1. Bacillus (Bacteria)—Genetics—Congresses. 2. Bacillus (Bacteria)—Biotechnology—Congresses. 3. Bacillus subtilis—Genetics—Congresses. 4. Bacillus subtilis—Biotechnology—Congresses. I. Ganesan, Α. T. II. Hoch, James A. III. International Conference on Bacilli (4th : 1987 : San Diego, Calif.) QR82.B3G46 1988 589.9'5 88-16728 ISBN 0-12-274161-7 (alk. paper) PRINTED IN THE UNITED STATES OF AMERICA 88 89 90 91 9 8 7 6 5 4 3 21 Preface The Fourth International Conference on Bacilli was held at the Bahia Hotel, San Diego, California, June 21-24, 1987. More than 300 scientists from a variety of countries discussed progress made in this field during the preceding two years. The conference was organized by Drs. J. A. Hoch and A. T. Ganesan. The topics discussed included gene expression sporulation, bacterial toxins, nucleic acid uptake modifica­ tion and genetics, secretion, antibiotic resistance genes, sigma factors, DNA replica­ tion, extracellular enzymes, and new genetic systems. The sessions were chaired by Drs. A. T. Ganesan, John Spizizen, Helen Whiteley, Tom Trautner, Costa Anag- nostopoulos, Raymond Dedonder, Jan Pero, Alessandro Galizzi, Jesse Rabinowitz, Hiroshi Yoshikawa, and J. O. Lampen. In addition to the oral sessions, more than 90 posters were presented. The contents of this volume reflect the remarkable progress achieved in this field during the past two years. This conference was made possible by the generous financial support of the Syntro Corporation of San Diego, California. The articles in this volume were organized and prepared for publication by Ms. Betty Goddard, who also was responsible for many aspects of Conference organization. xiii UPSTREAM ACTIVATING SEQUENCES IN BACILLUS SUBTILIS D.J. Henner1, E. Ferrari2, M. Perego3 and J.A. Hoch3 ^Department of Cell Genetics, Genentech, Inc., South San Francisco, CA, 94080; zGenencor, Inc., South San Francisco, CA, 94080; sScripps Clinic and Research Foundation, La Jolla, CA, 92037 I. INTRODUCTION In the last several years there has been a deluge of results on the cloning and characterization of genes for secreted enzymes and genes that control the expression of secreted enzymes. The purpose of this paper is to place these findings in perspective with each other and with other procaryotic regulatory systems, and to attempt to define the larger questions that still remain to be addressed. This paper will focus on the pleiotropic regulatory systems that seem to be present for secreted genes, rather than the controls that are specific to an individual gene. II. THE KNOWN TARGETS A glance at Table I shows that the target genes for the pleiotropic regulatory systems include at least one non-secreted gene, that for the intracellular serine protease (isp). The obvious common factor for these Table I. Target Genes8 Stimulation EEnnzzyymmee ((ggeennee)) hpr sacU(Hy) sacQ(Hv) prtR Levansucrase (sacB) _ + + + Neutral protease (nprE) + + + + Alkaline protease (aprE) + + + + α-amyläse (amyE) - + + (-)a Xylanase nt nt + nt Intracellular serine protease (isp) ? + + nt /S-glucanase(s) nt + + nt aThis data is compiled from Aymerich et al.. 1986; Higerd et a I.. 1972; Lepesant et al., 1976; Nagami and Tanaka, 1986; and unpublished data from D. Henner and M. Ruppen. GENETICS AND BIOTECHNOLOGY Copyright © 1988 by Academic Press, Inc. OF BACILLI, VOL. 2 3 All rights of reproduction in any form reserved. 4 HENNER ETAL. targets is that all the enzymes degrade polymeric substrates that could be used as carbon or nitrogen sources. This table might be biased, since the level of secreted genes is usually easy to determine by plate assays, and since other secreted genes are the obvious things to screen in looking for more targets of these regulatory systems. A look at the expression levels of other enzymes, such as intracellular assimilatory enzymes, might be fruitful in further delimiting the boundaries of these systems. Another conclusion that seems apparent from Table I is that the hpr stimulation seems to be differentiated from the sacU, sacQ, and prtR stimulation by the sacB response. However, all the panels not tested (nt) need to be filled in to make this more conclusive. The isp stimulation by hpr is labelled with a question mark, as the stimulation is only two-fold (Ruppen et al., submitted for publication). I would group the prtR stimulation with the sacQ and sacU on the basis of the sacB response. Although the α-amylase response seems to differentiate the prtR stimulation from sacU and sacQ, the α-amylase response is only seen in minimal media and the prtR stimulation was not tested under comparable conditions (Amory et al., 1987; Nagami and Tanaka, 1986). III. THE KNOWN PLAYERS The sacU mutations are the most pleiotropic of those described. Besides the effect listed above, sacU(Hy) mutations cause glucose resistant sporulation, are non-motile, and are nontransformable (Kunst et al., 1974). Besides the sacU(Hy) mutations, mutations have been isolated which are designated sacU' (Lepesant et al., 1976). These mutations cause a SacB'ISP' phenotype, but do not significantly inhibit the expression of aprE (Lepesant et al., 1976; D. Henner, unpublished). There is no clear evidence that the sacU(Hy) and sacU~ mutations are allelic, however they are at least located very close to one another (Lepesant et al., 1976). There is no evidence as to the nature of the sacU gene. The sacQ gene encodes a 46 amino acid polypeptide. There have been three sacQ genes isolated, from B. subtilis, B. amyloliquefaciens, and B. licheniformis (Amory et al., 1987; Yang et al., 1986; Tomioka et al., 1985). The report of Amory et al. (1987), clearly demonstrated that increased levels of the sacQ gene product are responsible for the phenotype. They placed the sacQ coding region behind an inducible promoter and showed that induction of the gene increased the expression of the sacQ gene. Deletion of the gene has no obvious phenotype (Yang et al., 1986). The prtR gene encodes a 60 amino acid polypeptide. There have been no chromosomal mutations reported at the prtR locus which cause a hyperproduction phenotype. The gene was isolated as a DNA fragment which caused hyperproduction of levansucrase and proteases (Nagami and Tanaka, 1986). Subcloning studies indicate that, like sacQ, the increased expression of the prtR gene product causes the hyperproduction phenotype (Nagami and Tanaka, 1986). Overexpression of the gene on a high copy plasmid causes delayed sporulation and filamentous growth UPSTREAM ACTIVATING SEQUENCES IN B. SUBTILIS 5 SacQ MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDGLDKYNYAMKIS ** * * ^ * ^ * * ^ * * * * Sinl MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF Figure 1. Comparison of the sacQ and sinl protein. Identical residues are indicated by "*", conservative substitutions are indicated by (Nagami and Tanaka, 1986). Deletion of the gene has no obvious phenotype (Yang et al. 1987). 9 The hpr locus encodes a 203 amino acid protein. Four mutant alleles have been characterized. Two are missense mutations, one a nonsense mutation, and one a deletion. This data suggests that loss of the hpr gene product is most likely the cause of the Hpr phenotype. Placing the hpr gene on a high copy plasmid gives a Spo" phenotype and the Plasmid is very unstable (personal communication, M. Perego and J. Hoch). The sin gene(s) were isolated as a B. subtilis DNA fragment which inhibits sporulation when placed on a high copy plasmid (Gaur et al., 1986). The production of proteases was also inhibited. Deletion of the gene(s) causes an increase in protease and α-amylase production, poor transformation, and filamentous growth. There are two open reading frames, encoding 57 and 111 amino acids. The inhibition of aprE expression by the sin gene(s) on a high copy plasmid appears to have an upstream target site (I. Smith, personal communication). As discussed below, this raises the possibility that this gene is involved in one of the pleiotropic regulatory systems. There is also some similarity between the sacQ protein and the first open reading frame in the sin region as shown in Figure 1. IV. THE MECHANISM A number of recent reports have shown that the sacU(Hy) and sacQ(Hy) mutations increase the level of sacB mRNA (Aymerich et al. 9 1986; Shimotsu and Henner, 1986a). Two other reports in this volume show that the hpr and sacU(Hy) mutations increase the level of aprE mRNA (Ferrari et al. this volume) and that the prtR gene increases the 9 level of aprE mRNA (Tanaka, this volume). The report by Tanaka also shows that the aprE mRNA has the same half-life in a strain carrying the prtR plasmid, indicating that the increased level is due to an increase in transcription initiation. There has also been a report that the sacB mRNA has the same half-life in sacU+ and sacU(Hy) strains (Chambert and Petit-Glatron, 1984). In all these cases, the transcription start points appear to be identical. Thus in every case examined, these pleiotropic mutations appear to increase the transcription initiation of their target genes. 6 HENNER ETAL. Table II. Deletion analysis of sacB'-'lacZ fusions3 /9-galactosidase Promoter End point wt sacQ(Hy) sacU(Hy) 4.2 117 1.0 10 (100) 400 5.2 -96 0.6 3 (30) 30 6.5 -42 0.5 1.2 (7) 6 trp8.3 -4 9 20 350 trp8.2 +5 15 17 35 trp8.3 (sacR) -4 120 200 400 aThe sacB'-'lacZ fusions and the construction of isogenic strains carrying the fusions and the sacQ(Hy) and sacU(Hy) mutations have been previously described (Henner et al.. 1987). 0-galactosidase units are as defined by Miller (1972). All the determinations were done at an 0D00 °f 0-5 in a minimal medium containing o sucrose, as described, with the exception of the sacQ(Hy) values given in parenthesis, which were collected at the onset of stationary phase. The sacR derivative has a single base charge at +102. V. EVIDENCE FOR UPSTREAM ACTIVATION We have studied both the sacB and aprE promoters by deletion analysis to determine the site(s) at which these pleiotropic mutations stimulate the transcription of these genes (Henner et al., 1987; Henner and Hoch, unpublished). Our findings indicate that regions of the promoter rather distant upstream of the transcription start point are necessary for at least full stimulation by these pleiotropic mutations. The data shown in Table II above shows that deletions well upstream of the presumed RNA polymerase recognition site at -35 and -10 decrease the expression of the sacB'-'lacZ, especially in the sacQ(Hy) and sacU(Hy) mutants. The sacQ(Hy) effect is more apparent at later time points, presumably reflecting the late expression of the sacQ gene (Yang et al., 1986). Analysis of these and other deletions is complicated by two factors. There is an additional stimulation that is mediated downstream of the promoter which seems to be associated with the sucrose induction machinery. A fusion of the trp promoter region to -4 of the sacB promoter shows significant stimulation (Table II) and these fusions are sucrose inducible (Henner et al., 1987). A similar fusion to +5 of the sacB promoter shows almost no stimulation and these fusions are not sucrose inducible. The introduction of a sacR mutation in the trp8.3 derivative, which eliminates the need for sucrose induction, also shows very little stimulation by sacU(Hy) and sacQ(Hy). The other difficulty is the low level of expression of the sacB'-'lacZ fusion in the wt background. The ratio of expression of the mutant strains to the wt strains is very sensitive to changes in these small numbers from the wt strains. Such variation makes it difficult to be sure whether there is an abrupt transition in the level of the sacU(Hy) and sacQ(Hy) mutations. Table III shows a similar deletion analysis for the aprE promoter. There appear to be at least two separate stimulatory sites for this UPSTREAM ACTIVATING SEQUENCES IN B. SUBTILIS 7 TABLE III. Deletion analysis of aprE'-'lacZ fusions8 0-galactosidase accumulation rate Promoter End Point wt sacU(Hy) sacQ(Hy) hpr SG35.18 -400 750 nt nt 6800 SG35.8 -200 800 6450 7250 440 SG35.8d25 -164 575 8400 9950 500 SG35.8d21 -141 610 1900 2200 300 aEach aprE'-'lacZ fusion is integrated in the B. subtilis chromosome by a method previously described (Shimotsu and Henner, 1986bTI The aprE'-'lacZ fusion has been previously described (Ferrari et al.. 1986). Deletion of the upstream regions was accomplished by subcloning appropriate restriction fragments or Bal31 exonuclear. 0-galactosidase assays and growth conditions were as previously described (Ferrari et a I.. 1986). The values are expressed as the rate of 0-galactosidase accumulation from t to t2- 0 promoter. The hpr stimulation is lost somewhere between -400 and -200. The majority of the sacU(Hy) and sacQ(Hy) stimulation is lost somewhere between -164 and -141, although some stimulation remains. In both the aprE'-'lacZ and sacB'-'lacZ fusions, the sacU(Hy) and sacQ(Hy) stimulation patterns appear to roughly parallel one another, suggesting that they have the same or closely overlapping target site(s). The hpr stimulation site(s) appear to be clearly differentiated from that of sacU(Hy) and sacQ(Hy). VI. OTHER PROCARYOTIC SYSTEMS WITH UPSTREAM ACTIVATION There are relatively few examples in procaryotes of sequences upstream of about -100 which can stimulate transcription initiation. The two best examples are found in the nitrogen fixation genes (for a review, see Gussin et al., 1986). The ntrC gene product, under conditions of ammonia limitation, can activate the transcription of a number of genes. The E. coli glnAp2 promoter has five ntrC binding sites upstream of the transcription start point, as demonstrated by footprinting experiments (Gussin et al., 1986). Deletion of the two farthest upstream sites, which are the strongest binding sites, between -150 and -100 results in a severe reduction in activation by the ntrC gene product (Reitze and Magasanik, 1986). The two sites could be moved more than 1000 bp upstream and still function to activate glnAp2 transcription (Reitze and Magasanik, 1986). A similar result has been found for activation of nif promoters by the nif A gene product. A conserved sequence has been identified in 19 nif promoters from a variety of species (Buck et al. 1986). This 9 sequence is normally found between -103 and -153 and is apparently a binding site necessary for nif A activation of these promoters. Deletions of this sequence can reduce NifA-dependent promoter activation about 30 fold (Buck et al. 1986). Some stimulation can be seen when the 9 consensus is placed as far as 1200 bp upstream (Buck et al. 1986). In 9 8 HENNER ETAL. both the cases detailed above, there is evidence that some promoters can have residual activation even when the upstream regions are deleted (Gussin et al., 1986). This is reminiscent of the residual stimulation of the deleted aprE and sacB promoters seen in the Table II and III above. There have been quite a few other procaryotic systems described in which proteins have been shown to bind upstream of the RNA polymerase recognition site and stimulate transcription. The best studied is the lambda cl repressor which appears to activate transcription by binding to DNA and interacting with RNA polymerase (for a review, see Ptashne, 1986a). There is also evidence that CAP protein, which usually binds to target promoters in the -50 to -70 region, can interact directly with RNA polymerase and possibly influences transcription by this direct interaction (de Crombrugghe et al., 1984). Whether there is any mechanistic difference between stimulation at nearby regions, where one can easily envision interactions with RNA polymerase, and stimulation at regions farther upstream, where such interactions seem less likely, remains to be determined. A recent review by Ptashne (1986b) puts forth the idea that all these interactions take place by the same mechanism, a direct interaction with RNA polymerase. He proposes that DNA looping allows such interactions to take place and review the compelling evidence that such looping can happen. Whether such looping will in fact turn out to be a universal mechanism, or whether there are cases of twisting, sliding or oozing (Ptashne, 1986b), remains to be determined. VII. LOOMING QUESTIONS Although rapid progress has been made in the understanding of these pleiotropic mutations, there remain many unanswered questions. A. Do these genes play any role in the physiology of wt cells? A striking finding is that the deletion of the apparent target sites for these mutations results in little or no effect of the expression of the target gene in a wild-type cells. This suggests that under the culture conditions used, these regulatory systems play little or no role. One could speculate that either we have not discovered the culture conditions under which these systems come into play, or that in B. subtilis these systems, in fact, have no function and can only be unmasked by mutations. Similar speculations arise from the fact that deletions of the prtR and sacQ genes have almost no effect on the expression of either aprE'-'lacZ or sacB'-'lacZ fusions. B. What are the precise target sites on the promoters? We felt that the deletion analyses should narrow down the potential region for the target sites and make similarities more obvious. There are no obvious DNA binding motifs in these regions. A comparison of the aprE and sacB promoters in the apparent target region for sacU and sacQ shows the similarity detailed in Figure 2. The significance of this similarity is uncertain. A comparison of these regions with the known promoter sequences of other targets of

See more

The list of books you might like