Logout succeed
Logout succeed. See you again!

GEOMETRIC DYNAMICS OF OPTIMIZATION∗ 1. Introduction With the advent of new devices ... PDF
Preview GEOMETRIC DYNAMICS OF OPTIMIZATION∗ 1. Introduction With the advent of new devices ...
COMMUN.MATH.SCI. (cid:13)c 2013InternationalPress Vol.11,No.1,pp.163–231 GEOMETRIC DYNAMICS OF OPTIMIZATION∗ FRANC¸OIS GAY-BALMAZ†, DARRYL D. HOLM‡, AND TUDOR S. RATIU§ Abstract. Thispaperinvestigatesafamilyofdynamicalsystemsarisingfromanevolutionary re-interpretation of certain optimal control and optimization problems. We focus particularly on the application in image registration of the theory of metamorphosis. Metamorphosis is a means of tracking the optimal changes of shape that are necessary for registration of images with various types of data structures, without requiring that the transformations of shape be diffeomorphisms, but penalizing them if they are not. The possibilities of this approach are just beginning to be developed. Inparticular,metamorphosisanditsrelatedvariantsinthegeometricapproachtocontrol andoptimizationcanbeexpectedtoproducemanyexcitingopportunitiesfornewapplicationsand analysisingeometricdynamics. Key words. Optimalcontrol,optimization,geometricmechanics,symmetry. AMS subject classifications. 34H05,49J20,49J27. 1. Introduction With the advent of new devices capable of seeing objects and structures not pre- viouslyimagined,therealmofscienceandmedicinehasbeenextendedinamultitude of different ways. The impact of this technology has been to generate new challenges associated with the problems of formation, acquisition, compression, transmission, and analysis of images. These challenges cut across the disciplines of mathematics, physics, computational science, engineering, biology, medicine, and statistics. For example, in computational anatomy (CA) biomedical images are compared quantitatively by calculating the “distance” between them, along a path that is opti- mal in transforming one such image to another. The optimal path is traversed along a curve of deformations in the group of smooth invertible maps with smooth inverses (i.e., the diffeomorphisms) and it is governed by a partial differential equation (PDE) called the EPDiff equation, which takes its simplest form as [42, 43, 72, 64] d δℓ δℓ =∓ad∗ . (1.1) dtδξ ξδξ The term EPDiff is an abbreviation for ‘the Euler-Poincar´e equation on the group of diffeomorphisms’. EPDiff arises from Hamilton’s principle δS=0 for S= ℓ(ξ)dt for a Lagrangian ℓ(ξ):X→R defined on the Lie algebra of vector fields X with Lie bracket−[ξ,η]=ad η:X×X→X. Thedualoperationisad∗µ:X×X∗→X∗. TRhesign ξ ξ in equation (1.1) is + (resp. −) for left (resp. right) invariant vector fields. TheEPDiffequation(1.1)governsgeodesicflowonthegroupofdiffeomorphisms, with respect to any prescribed metric. This flow from one shape to another also has an evolutionary interpretation that invites ideas from the analysis of evolutionary equations. In particular, the momentum map for EPDiff, identified first in [17] and ∗Received: June 20, 2011; accepted (in revised form): May 4, 2012. Communicated by Andrea Bertozzi. †ControlandDynamicalSystems,CaliforniaInstituteofTechnology107-81,Pasadena,CA91125, USAandLaboratoiredeM´et´eorologieDynamique,E´coleNormaleSup´erieure/CNRS,Paris,France ([email protected]). ‡Department of Mathematics, Imperial College London, London, SW7 2AZ, United Kingdom ([email protected]). §Section de Math´ematiques, E´cole Polytechnique F´ed´erale de Lausanne, EPFL, Station 8, CH- 1015Lausanne,Switzerland(Tudor.Ratiu@epfl.ch). 163 164 GEOMETRICDYNAMICSOFOPTIMIZATION explained more completely in [40], yields the canonical Hamiltonian formulation of the dynamics of the singular evolutionary solutions of EPDiff. Moreover, in an opti- mization sense, this momentum map also provides a complete representation of the landmarks and contours (outlines) of images to be matched, in terms of the canon- ical positions and momenta associated with the evolutionary interpretation [44]. In addition, itprovidesanaturalstrategyforfindingtheoptimalpathbetweentwocon- figurationsofeitherlandmarksorcontours[72]. Thus,themomentummap(aconcept from Hamiltonian systems) is crucial in the construction of an isomorphism between the data structures used in the optimal matching of images and the evolutionary sin- gular solutions of the EPDiff equation. This isomorphism has already suggested new dynamical paradigms for CA, as well as new strategies for assimilation of data in other image representations, for example, as gray-scale densities [47, 72]. The con- versebenefitmayalsodevelop, inwhichmethodsofoptimalcontrolandoptimization of data assimilation used in image matching for CA may suggest new strategies for investigatingdynamicalsystemsofevolutionaryPDE.Inshort,thevariationalformu- lations, Lie symmetries and associated momentum maps encountered in applications ofEPDiffhaveledtoaconvergenceintheanalysisofbothitsevolutionaryproperties and its optimization equations. ThispaperfocusesontheevolutionaryaspectsofthePDEthataresummonedby adoptingadynamicalinterpretationoftheoptimalcontrolandoptimizationmethods used in the registration of various types of images. The paper does not perform any applications of optimization methods to image registration, nor does it develop any numerical algorithms for making such applications. Instead, the paper re-interprets theendeavorofimageregistrationfromadynamicalsystemsviewpoint. Inparticular, asweshallexplain, arecentdevelopmentinLargeDeformationDiffeomorphicMetric Mapping(LDM),inanapproachforimageregistrationcalledmetamorphosis1 [61,68, 47], introduces a new type of evolutionary equation that may be called optimization dynamics. In following this line of reasoning, the geometric mechanics approach for evolutionary PDE provides a framework that we hope will inform both optimization and dynamics.The primary example in the line of reasoning leading to optimization dynamics is the EPDiff equation [42, 43, 72]. A brief history of the EPDiff equation. The EPDiff equation (1.1) stems from the recognition by Arnold in [1] that incompressible fluid dynamics could be characterized as geodesic flow in the group of volume preserving diffeomorphisms, with respect to the kinetic energy metric (L2 norm of the fluid velocity). A few years later, the one-dimensional compressible version of EPDiff reappeared as the dispersionless limit of the Camassa-Holm (CH) equation [17]. The CH equation is a completely integrable evolution equation for shallow water waves, whose soliton so- lutions develop sharp peaks in the dispersionless limit. Its peaked soliton solutions (peakons) correspond to concentrations of momentum into delta-function singulari- ties and are solutions of EPDiff in one dimension with the H1 kinetic energy metric. Slightly later, the incompressible version of EPDiff with the H1 kinetic energy met- ric was generalized to higher dimensions in [42, 43] by using its symmetry-reduced variational principle, and was interpreted as Euler’s fluid equations, averaged follow- ing Lagrangian particle trajectories. This interpretation soon led to the introduction of viscosity and some interesting applications of the resulting viscous equations as a 1Although the term “metamorphosis” has a precise mathematical definition that will be given below, it also satisfies its proper dictionary definition, as “a change of physical form, structure, or substance”. Thispaperinterpretsthechangeasatypeofevolution. F.GAY-BALMAZ,D.D.HOLM,ANDT.S.RATIU 165 turbulence model by Chen et al. [20, 21]. Around thesame time, EPDiff aroseindependently in acompletely different con- text. Namely,itaroseasthegoverningequationintheoptimizationproblemforLarge DeformationDiffeomorphicMetricMapping(LDM)inimageregistration[66,67,70]. The recognition that EPDiff was arising in these two different contexts provided a fruitful opportunity for dual interpretations of the solutions of the same equation. In particular, the “peakons” of the CH equation in the water wave context were soon recognized to be the “landmarks” in images in the LDM context [44]. Since then, the two types of problems have continued their optimization-dynamics interplay and have been found to inform each other, while also showing intriguing differences and similaritiesthatariseintheirdualformulationsasinitialvalueproblemsononehand and boundary value problems on the other. In particular, the concept of symme- try reduction and momentum maps from geometric mechanics, that had previously been applied so effectively in fluid dynamics [1] and shallow water soliton theory [17], has recently been recognized also as a unifying approach for developing multi-mode LDM methods for images whose data structure may comprise arbitrary tensors, or tensor densities [16]. This is a rich and rapidly developing area of science, for which a complete literature review would be beyond our scope here. The convergence of these two independent endeavors has led to dual interpreta- tions of the same equation and the same key ideas in different but complementary contexts. This convergence is fascinating, and we continue our investigation of it here. In the present paper, we emphasize the dynamical interpretations of the equa- tions and approaches that are applied in optimal image matching. This is not to say thatwesolveoptimalmatchingproblemsforimagesatallinthispaper. Rather,being cognizant of the ideas and variational formulations underlying the optimal matching approach, weshallapply theseformulations tostudycertainclassesofequations that arise in the problem of image registration, not from the viewpoint of optimization, but rather from the evolutionary viewpoint of geometric mechanics [45, 54]. The geometric mechanics approach emphasizes Lie group actions on manifolds, momentum maps, and reduction by symmetry. This approach leads in the present paper to an understanding of certain classes of control and optimization problems as systems of evolutionary equations. In particular, the Lie symmetry ideas underlying the process of optimal image assimilation known as metamorphosis [61, 68, 47] in combinationwiththeevolutionarygeometricmechanicsviewpointleadsthefamilyof EPDiff equations into the realm of optimization dynamics. Optimization dynamics extends the previous association of image matching ideas with soliton theory [44] to producenewresults,suchasthederivationandre-interpretationofthetwo-component CH system (CH2) as an equation for the dynamics of metamorphosis of gray-scale images [47]. The CH2 system is a completely integrable evolutionary system of equa- tions that was recently discovered using isospectral methods for solitons [22]. Its inverse scattering transform is discussed in [38]. Recognizing that some systems of equationsarisinginoptimizationdynamicsforimageanalysismaybeassociatedwith soliton theory raises many questions about the mathematical properties of these sys- tems and their solutions, particularly when the equations are nonlocal. For example, theinitialvalueproblemsforsomeofthenonlocalequationsobtainedinoptimization dynamics investigated here allow emergent singular solutions, in which the evolution of a smooth, spatially confined, initial condition becomes singular by concentrating itselfintodeltafunctiondistributions. Inparticular, EPDiffhasthatpropertyandso does the corresponding system of equations for the optimization dynamics of meta- 166 GEOMETRICDYNAMICSOFOPTIMIZATION morphosis. See[42,43,45]and[71,72], respectively, forfurtherdiscussionsofEPDiff from the different but complementary viewpoints of geometric mechanics and image matching. 1.1. LDM approach, EPDiff, and momentum maps. The LDM ap- proach is based on minimizing the sum of a time-integrated kinetic energy metric whose value defines the length of an optimal deformation path, plus a penalty norm thatensuresanacceptabletoleranceinimagemismatch. Themainreasonwhymatch- ing cannot be exact is that the sets of level curves of two generic images are rarely topologically equivalent, thus the images cannot be matched exactly. LDM approaches were introduced and systematically developed in Trouv´e [66, 67], Dupuis et al. [25], Joshi and Miller [48], Miller et al. [61, 60], Beg [5], and Beg et al. [6]. The LDM approaches of those papers are based on Grenander’s deformable template paradigm for image registration [32]. Grenander’s paradigm, in turn, is a development of a biometric strategy introduced by D’Arcy Thompson [65] of comparing a template image I to a target image I by finding a smooth invertible 0 1 transformationofcoordinatesthatmapsoneimagetotheother. Thistransformation is assumed to belong to a Lie group G of diffeomorphisms that acts on the set of templatescontainingI andI . Theeffectofthetransformationonthedatastructure 0 1 that is encoded in the set of templates is called the action of the Lie group G on the set of images. As discussed below, the optimal path in the transformation group is the one that costs the least in time-integrated ‘kinetic energy’ for a given tolerance. This concept of optimization summons a control theory approach into the analysis and registration of images. For a comprehensive presentation of the mathematical foundations of the LDM approach, see [71]. In applications of the LDM approach, the optimal transformation path is of- ten sought by using a variational optimization method such as the one developed in [25, 66, 67]. Using this method, the optimal path for the matching transformation in this problem is obtained from a gradient-descent algorithm based on the Euler- Lagrange equation arising from stationary balance between kinetic energy and tol- erance. This gradient-descent approach does indeed determine an optimal matching path. However, from the viewpoint of dynamical systems theory, it misses the follow- ing potentially interesting question: What information and perspective may be obtained by interpreting the Euler-Lagrange equations associated to the LDM approach from a dy- namical systems viewpoint? The answer to this question may be sought by interpreting the variational opti- mizationmethodintheLDMapproachasaformofHamilton’sprinciple. Hamilton’s principleforthevariationalconstructionofoptimalpathswithminimalkineticenergy for a given tolerance in image mismatch yields an associated set of Euler-Lagrange equations that may then be given an evolutionary interpretation. The optimal so- lutions of these equations have been investigated as evolutionary motion on the Lie group of diffeomorphisms in the absence of additional penalty terms by Arnold [1, 2], Holm et al. [42, 43], Marsden and Ratiu [54], and for the particular application to template matching in Miller et al. [60]. As mentioned earlier, the optimal paths in these cases are geodesics with respect to the metric provided by the kinetic energy. The kinetic energy for LDM is invariant under right translations on the diffeomor- phism group. Reducing Hamilton’s principle with respect to this symmetry and then invoking the Euler-Poincar´e theory applied to diffeomorphisms produces the EPDiff F.GAY-BALMAZ,D.D.HOLM,ANDT.S.RATIU 167 equation (1.1) [42, 43]. The solution of the EPDiff equation yields the spatial representation of the geodesic velocity, i.e., the tangent vector to the optimal path of deformations along which the minimal distance from one image to another is measured. The geodesics themselves may be obtained from the solutions of EPDiff for the velocity by a recon- struction process that inverts the previous reduction by symmetry after the solution to the EPDiff equation for velocity has been obtained. This is analogous to the re- construction process in classical mechanics that recovers the symmetry coordinate conjugate to a conserved momentum as the final step in the solution, after the other degrees of freedom have been determined in the reduced space. Composing the evolutionary solutions of EPDiff with the reconstruction process provides an important representation of diffeomorphisms that relates the endpoint of a geodesic to the initial value for momentum in the EPDiff equation. This relation is the momentum representation of the deformation. The long-time existence of this representation is based on conservation by EPDiff of the kinetic energy norm, which may be chosen so that its boundedness affords enough smoothness on the velocities to ensure the long-time existence of solutions of EPDiff. In this case, EPDiff admits emergent weak momentum solutions; for example, delta-function distributions of mo- mentum that emerge from smooth, spatially confined initial conditions [17, 40]. This singularbehavioriswellunderstoodanalyticallyonlyincertainone-dimensionalcases. Inparticular,itisunderstoodforthecompletelyintegrablecaseoftheCamassa-Holm equation; see, e.g., [52, 62] and references therein. The EPDiff equation is of central importance in computational anatomy [72]. This is because the optimal paths sought by LDM on the image template space de- fined on a manifold M are inherited from the geodesics on Diff(M), the Lie group of diffeomorphisms acting on the manifold M. These, in turn, are governed by EPDiff. Consequently, any solution of the LDM problem for optimal geodesics must involve EPDiff [72]. Conversely, solving the LDM problem directly produces the momentum representation of the optimal diffeomorphism. The momentum representation arising from this evolutionary interpretation is then available for analyzing anatomical data sets. In any case, despite the disparate forms that the geodesic equations may take forthevariousdatastructuresinthevarioustypesofimages,allofthemareinstances of EPDiff with the corresponding representation for momentum. The specific repre- sentationformomentumintermsoftheimagedatastructureinagivencaseiscalled the momentum map. The momentum map for images is another dynamical systems concept that emerges as a central feature in this paper. The EPDiff equation and its associated momentum map for various image data structures are discussed in Section 8.4. AninterestingexampleofthemomentummaprelatingsolutionsofLDMtosolu- tionsofEPDiffarisesforthecaseoflandmark datastructure,inwhichthemomentum is singularly concentrated at points. The relation between these singular geodesic so- lutions and evolutionary soliton solutions, called peakons for a shallow water wave equation introduced in Camassa and Holm [17], has been examined in the context of computational anatomy in Holm et al. [44]. A numerical analysis of the stability of these equations is also given in McLachlan and Marsland [57]. See also Micheli [58] for other recent developments involving the curvature of the space of landmark shapes. Holm and Marsden [40] explain that two independent momentum maps for EPDiffareavailableinthecasethattheimagedatastructurecomprisesthemanifold Emb(S1,R2) of embedded closed curves (embedded images of S1) in the plane R2. 168 GEOMETRICDYNAMICSOFOPTIMIZATION The left action of the group of diffeomorphisms Diff(R2) of the plane deforms the curve by a smooth invertible transformation of the coordinate system in which it is embedded,whileleavingtheparameterizationofthecurveinvariant. Therightaction ofthegroupofdiffeomorphismsDiff(S1)ofthecirclecorrespondstosmoothinvertible reparameterizations of the domain S1 of the coordinates of the curve. In this case, one momentum map corresponds to action from the left by the diffeomorphisms on R2, theothertotheiractionfromtherightontheembeddedcurves. Optimalcontrol and reparameterization methods for matching closed curves in the plane using these two momentum maps for the space of closed curves in the plane have recently been developed in Cotter and Holm [24]. In summary, LDM image analysis is based on optimization methods that are formulated as boundary value problems. However, the re-interpretation of their gov- erning equations as evolutionary systems by using symmetry reduction of the corre- spondingHamilton’sprincipleallowsvariousconceptsfromdynamicalsystemstheory tobeprofitablyappliedinthesolutionandinterpretationofimageanalysisproblems. Thus, the transfer of concepts and ideas between these two fields in the context of image registration has the potential to enrich them both. 1.2. Distributed optimization dynamics, or evolutionary metamorpho- sis. As we have been discussing, the paper focuses on the geometric dynamics interpretationoftheoptimizationproblemsdesignedforimageregistration. However, rather than concentrating on the development of solutions of optimization problems, thetreatmentherefocusesonthedynamics thatareproducedinapplyingthemethod of reduction by Lie group symmetry to families of optimization problems posed in a geometric setting. This is a new arena for geometric dynamics and several new de- partures are being taken. Among these new departures is the investigation of the evolutionarydynamicsthatariseswhendistributedornonlocalpenalties areimposed in Hamilton’s principle, rather than local constraints. For lack of a better name, we call this sort of problem distributed optimization dynamics. It is the evolutionary counterpart of the metamorphosis approach in imaging science [61, 68, 47], which, in turn, is a modification and development of LDM that allows the evolution n(t) of the image template to deviate from pure deformation. That is, metamorphosis only penalizes thespatialaverageofthedeviationawayfromtheinfinitesimalactionofthe vector fields on an image manifold, rather than enforcing it as a local pointwise con- straint. This approach, in turn, modifies the EPDiff equation and thereby introduces a wealth of new structure and new examples that we shall investigate in this paper. An explicit comparison for the case that the image templates are gray-scale den- sity distributions may help to understand the difference between the LDM approach and the metamorphosis approach. LDM approach: Given the source and target templates for the images character- ized as scalar densities n and n at the initial time t=0 and the final time t=T, 0 T respectively, minimize the quantity T 1 ℓ(u(t))dt+ kn ◦η−1−n k2 (1.2) 2σ2 0 T T L2 Z0 over the time dependent vector field u(t), where η is the flow of u(t) evaluated at T time t=T, and the formula n˙(t)+div n(t)u(t) =0 (cid:0) (cid:1) F.GAY-BALMAZ,D.D.HOLM,ANDT.S.RATIU 169 Fig. 1.1. These gray-scale images show optimal metamorphoses between two density distri- butions with equal total mass from [47]. The optimization approach would compute the distance along the optimal path between between the first and last density in each row. In the evolutionary approach, the optimal trajectories for n(t) are computed. The images between the endpoints show snapshots along the optimal path n(t) in each row at intermediate points in time. In particular, the second row shows that metamorphosis allows a change in topology along its optimal path. Our interest focuses on the evolutionary equations for the process of metamorphosis. The dynamical system of metamorphosis equations obtained in registering such gray-scale image densities is given in Section 8 as one of the examples of the general approach. In one dimension, the metamorphosis equations for this class of images comprises a completely integrable Hamiltonian system [47]. isitsinfinitesimalactiononasmoothdensityn(t)=n ◦η−1definedovertime0≤t≤T 0 t on the domain of flow. Metamorphosis approach: Given n and n , minimize 0 T T 1 ℓ(u(t))+ kn˙(t)+div n(t)u(t) k2 dt (1.3) 2σ2 L2 Z0 (cid:18) (cid:19) (cid:0) (cid:1) overtimedependentvectorfieldu(t)andscalardensitiesn(t). Asoneseesinfigure1.1 forthemetamorphosisofshapescharacterizedasdensities,theterm“metamorphosis” introduced in [68] for this process can be understood in practice by its ordinary meaning, as “change of shape”, such as the gradual and continuous metamorphosis of a tadpole into a frog. The paper begins by contrasting optimal control problems with distributed op- timization problems in a geometric setting. In particular, we discuss the geometric properties of Lie algebra controls acting on state space manifolds. The latter optimal control approach parallels the familiar Clebsch variational formulation of dynamical equations continuum mechanics (e.g., [39]). In fact, continuum mechanics was one of the early paradigms for image registration [70]. The Clebsch variational formulation of continuum mechanics has recently been developed and applied in the study of the dynamical aspects of optimal control problems in a geometric setting (see [29, 37]). Conversely, our concern here is to continue this parallel development by studying the implications for dynamics of the geometric approach to distributed optimization problems. 1.3. Main content of the paper. Context. In [29] a general formulation for a large class of optimal control prob- lems was given. These problems, called Clebsch optimal control problems, are asso- ciated to an action Φ:G×Q→Q of a Lie group G on a manifold Q and to a cost 170 GEOMETRICDYNAMICSOFOPTIMIZATION function ℓ:g×Q→R, where g denotes the Lie algebra of G. The Clebsch optimal control problem for the curves ξ(t)∈g and n(t)∈Q is, by definition, T min ℓ(ξ(t),n(t))dt, (1.4) ξ(t)Z0 subject to the following conditions: (A) Either n˙(t)=ξ(t) (n(t)), or (A)′ n˙(t)=−ξ(t) (n(t)); Q Q (B) Both n(0)=n and n(T)=n , 0 T where ξ denotes the infinitesimal generator of the G-action, that is, Q d ξ (n):= Φ (n). Q dt exp(tξ) (cid:12)t=0 (cid:12) (cid:12) Theseoptimalcontrolproblemscomprise(cid:12)abstractformulationsofmanysystemssuch as the symmetric representation of the rigid body and Euler fluid equations [9, 37], the double bracket equations on symmetric spaces [8], the singular solutions of the Camassa-Holm equation [17], control problems on Stiefel manifolds [13], and others [7, 12]. Optimal control problems on Lie groups have a long history; see [7], [49], and references therein. Some of the earliest papers dealing with such problems are [14] and [33]. Goals of the paper. The first goal of the present paper is to replace the con- straints in the Clebsch optimal control problem (1.4) with a penalty function added tothecostfunctionandtoobtaininthiswayaclassical(unconstrained)optimization problem. The fundamental idea is to use the constraints to form a quadratic penalty function in order to get the Lagrangian T 1 ℓ(u,n)+ kn˙∓u (n)k2 dt. (1.5) 2σ2 Q Z0 (cid:18) (cid:19) Wefirstdeterminenecessaryandsufficientconditionscharacterizingthecriticalpoints of this Lagrangian. Taking the time derivative of one of the conditions and using the others leads directly to certain equations of motion. We then show that these equa- tionsarenaturallyobtainedbyLagrangianreductionandthattheyaretheLagrange- Poincar´eequationsofaLagrangianfunctioninthematerialrepresentationthatisthe sumoftheoriginalLagrangianplusthesquareofthenormonthevelocityvector. This approachlinksdirectlytotheapproachusedin[47]inthestudyofthemetamorphosis of shapes. From a variational point of view, one replaces the Hamilton-Pontryagin variational principle in the Clebsch framework T δ (ℓ(u,n)+hα,n˙∓u (n)i)dt=0 Q Z0 by the principle T 1 δ ℓ(u,n)+ kn˙∓u (n)k2 dt=0, 2σ2 Q Z0 (cid:18) (cid:19) which is the basis of Clebsch distributed optimization. F.GAY-BALMAZ,D.D.HOLM,ANDT.S.RATIU 171 Thispapertraceshowthedynamicalequationschangeonmovingfromconstraints (optimal control) to optimization via imposition of a cost, and then on to metamor- phosis. Passing from optimal control to optimization preserves the momentum map, but this passage modifies the reconstruction relation. The evolution is no longer only for the momentum map of the reduced Lagrangian. Instead, the momentum canoni- cally conjugate to the velocity on the configuration manifold becomes coupled to the momentum map equations (which are the Euler-Poincar´e equations), with coupling constant σ2. Anotherfeatureofthepaper,directlyrelatedtothedynamicsofouroptimization problem, is the description of the equations of motion by Lagrangian and Hamilto- nian reduction. In particular, we carry out a certain type of Lagrangian reduction adapted to the problem, that we naturally call metamorphosis reduction, since it was directly inspired by the example of the metamorphosis approach to image dynamics [47]. This Lagrangian reduction leads to the expression of the associated variational principles and Hamiltonian structures. In metamorphosis, the optimization problem involvesRiemannianstructuresinducedbyLiegroupactionsonthemselvesandonLie subgroups by group homomorphisms. This is a rich field whose possibilities are still being developed. In particular, metamorphosis and related variants of the geometric approach to control and optimization can be expected to produce opportunities for new applications and analysis in geometric dynamics. 1.4. Plan of the paper. In the remainder of the paper, we compare the dynamicalequationsthatarisefromoptimalcontrolproblemswiththosearisingfrom distributed optimization. This comparison provides several examples of how the two approaches differ and, in particular, how their dynamical equations differ when their variational problem is regarded as Hamilton’s principle for the dynamics. Their com- parison also identifies the aspects of these approaches that are fundamentally the same. • Section 2 begins by explaining the dynamical set up for standard optimal control problems treated by the Pontryagin Maximum Principle. Section 2.2 provides several examples illustrating the consequences of applying Lie group controls acting on state manifolds by using the Clebsch framework for optimal control. These examples introduce the momentum map for the cotangent-lifted action of the Lie group controls on the state manifold. The cotangent-lift momentummapisafundamentalconceptintheapplicationof geometric mechanics methods in the Clebsch framework for optimal control. Itturnsoutthatthesamemomentummapisalsotheorganizingprinciplefor the distributed optimization dynamics introduced in Section 2.3. After es- tablishingthisbackgroundforourcomparisonofoptimizationanddynamical systems methods, Section 1.3 provides an overview of the rest of the paper. • Section 3 begins by reviewing the Clebsch framework for optimal control problems introduced and studied in [29]. A new class of optimization prob- lems is then introduced, which is the subject of study of this paper. The stationarity conditions are obtained and the associated equations of motion are determined. • Inspired by the extremum problems presented earlier, Section 4 presents two Lagrangian reduction procedures for Lagrangian functions defined on T(G× Q), where G is a Lie group acting on the manifold Q. • These reduction methods are used in Section 5 to rederive the equations of 172 GEOMETRICDYNAMICSOFOPTIMIZATION motion that were found in Section 3. • Hamiltonian reduction is carried out in Section 6. As before, there are two reduction methods and, in the case of a representation, one of them leads to Lie-Poisson equations with a symplectic cocycle on the dual of a larger semidirect product Lie algebra. • In Section 7 we apply these Hamiltonian reduction methods to the optimiza- tion problems introduced earlier. • Section8,byfarthelongestofthepaper,presentsapanoramaofexamplesfor the purpose of illustrating the breadth of the applications of the general the- ory. WebeginbystudyingexampleswhereGisrepresentedonavectorspace. The concrete examples treated are the heavy top and a class of problems us- ing the adjoint representation. For example, we find a modification of the pair of double bracket equations studied in [8], [9]. Next, we study optimiza- tion problems associated toaffine actions. Actions by groupmultiplication is the next topic. The concrete examples include Euler’s equations for an ideal incompressible homogeneous and for a barotropic fluid. The N-dimensional Camassa-Holm equation is presented from this optimization point of view, inspired by the construction of singular solutions. Finally, the optimization problem is used to obtain the equations of metamorphosis dynamics for use in computational anatomy. • Section 9 briefly summarizes the paper and gives an outlook for future work. 2. Review of optimal control problems 2.1. Definitions. We begin by recalling the definition of optimal control problems. Definition2.1(Optimalcontrolproblems). Astandardoptimalcontrolproblem comprises: • a differentiable manifold Q on which state variables n∈Q evolve in time t during an interval I=[0,T] along a curve n:I→Q from n(0)=n to n(T)= 0 n , with specified values n ,n ∈Q; T 0 T • a vector space U of control variables u∈U whose time dependence u:I→U is at our disposal to affect the evolution n(t) of the state variables; • a smooth map F:Q×U→TQ such that F(·,u):Q→TQ is a vector field on Q for any u∈U whose associated evolution equation2 n˙ =F(n,u) (2.1) relates the unknown state and control variables (n(t),u(t)):I→Q×U; • a cost functional depending on the state and control variables T S:= ℓ(u(t),n(t))dt, (2.2) Z0 2The over-dot notation in n˙ means time derivative. Several forms of time derivative appear in applicationsandthemeaningshouldbeclearfromtheusage. Besidestheover-dotnotation,weshall use the equivalent notation d/dt to mean either partial or ordinary time derivative in the abstract formulas, as needed in the context. For fluids, we shall also use ∂t for the Eulerian time derivative at fixed spatial location. Finally, the covariant time derivation on a Riemannian manifold will be denotedasD/Dt.