Logout succeed
Logout succeed. See you again!

Grammatical Acquisition: Coevolution of Language and the Language Acquisition Device PDF
Preview Grammatical Acquisition: Coevolution of Language and the Language Acquisition Device
Grammatical Acquisition: Coevolution of Language and the Language Acquisition Device Ted Briscoe [email protected] http://www.cl.cam.ac.uk/users/ejb Computer Laboratory University of Cambridge Pembroke Street Cambridge CB2 3QG, UK March 5, 1999 Abstract Anaccountofgrammaticalacquisitionisdevelopedwithintheparameter- setting framework applied to a generalized categorial grammar (GCG). The GCG is embeddedina default inheritance network yielding a naturalpartial ordering(re(cid:13)ectinggenerality)ofparameterswhichdeterminesapartialorder forparametersetting. Computationalsimulationshowsthatseveralresulting acquisition procedures are e(cid:11)ective on a grammar / language set expressing majortypologicaldistinctionsbasedonconstituentorder,andde(cid:12)ning70dis- tinctfulllanguages andover200subsetlanguages. Thee(cid:11)ectsonacquisition of maturational working memorylimitations, trigger presentation sequences, parameterupdatecriteria, anddi(cid:11)eringinitial settings areexploredviacom- putational simulation. Computationalsimulationsof populationsof language learners /usersin- stantiatingthemodelshow: 1)thatvariantacquisitionprocedureswithdi(cid:11)er- ing constraints and biases exert di(cid:11)ering selective pressures on the evolution of language; 2) acquisition procedures will evolve towards moree(cid:14)cient vari- ants in the environment of adaptation. The reciprocal evolution of language acquisitionproceduresandoflanguagecreatesagenuinelycoevolutionarydy- namic, despite the relative speed of linguistic selection for language variants 1 comparedtonatural selection for variantlanguage acquisition procedures. 1I would like to thank seminar audiences at the Universities of Edinburgh, Sussex and Cam- bridge, and Oregon Graduate Institute, as wellasthe organizersand participants ofthe 1st and 2nd International Conferences. on Language and Evolution, University of Edinburgh, 1996, and University of East London, 1998, for helpful feedback on aspects of the work described in this paper. In particular, Bob Berwick, MiriamEckert and Jim Hurfordmade suggestions which in- (cid:13)uencedthesubsequentdevelopmentandpresentationofthiswork. Inaddition,AnnCopestake, GeraldGazdar,HansvanHalteren,SimonKirby,DavidLightfoot,DavidMilward,Geo(cid:11)Pullum andtwoanonymousreviewersforLanguagekindlygavecommentsonearlierdraftswhichhelped considerablyimprovethepresentone. 1 1 Theoretical Background It is widely accepted that language acquisition is guided by an innate language acquisition procedure and a partial innate speci(cid:12)cation of the form of language. Language acquisition by children is a near-universal feat, where (partial) failure appears to correlate more with genetic de(cid:12)cits (e.g. Gopnik, 1994) or with an al- mostcompletelackoflinguisticinputduringthecriticalperiod(e.g. Curtiss,1988), than with measures of general intelligence (e.g. Smith and Tsimpli, 1991) or the quality or informativeness of the learning environment (e.g. Bickerton, 1981; Kegl 2 andIwata,1989;OchsandShei(cid:11)elin,1995). Thereisconsiderablepsycholinguistic evidence that childrenhavestrongbiasesin languageacquisitionwhichshape their linguistic development, the nature of their errors, and the kind of languages they are predisposed to learn. Often these biases are partially incorrect as generaliza- tions about the nature of human languages. For example, Wanner and Gleitman (1982:12f)arguethatchildrenarepredisposedtolearnlexicalcompositionalsystems in which atomic elements of meaning are mapped to individual words. This leads to errors where languages, for example, mark negation morphologically. Similarly, Clark(1993)arguesforaprincipleofcontrastinlexicalacquisition,suggestingthat childrenhypothesizenovelmeaningsfornovelwords,ignoring,atleastinitially, the hypothesis that a new wordmay be synonymouswith a known one. How do some- times inaccurate biases of this kind arise and how pervasive are they in language acquisition? 1.1 Grammatical Acquisition Grammatical acquisition proceeds on the basis of a partial genotypic speci(cid:12)cation of (universal) grammar (UG) complemented with a learning procedure enabling the child to complete this speci(cid:12)cation appropriately on exposure to (cid:12)nite positive samples from a given language. The parameter setting framework of Chomsky (1981) claims that learning involves (cid:12)xing the values of a (cid:12)nite set of (cid:12)nite-valued parametersto select asingle fully-speci(cid:12)ed grammarfrom within the space de(cid:12)ned bythegenotypicspeci(cid:12)cationofUG.Formalmodelsofparametersettinghavebeen developed for small fragments, but even the search spaces de(cid:12)ned by these models contain local maxima and subset-superset relations which may cause a learner to converge to an incorrect grammar (Clark, 1992; Gibson and Wexler, 1994; Niyogi and Berwick, 1996; Wexler and Manzini, 1987). Gibson and Wexler (1994) formalize the concept of a trigger (e.g. Lightfoot, 1992:13f)asasimple(unembedded ordegree-0)sentenceofprimarylinguisticdata which signals the value of some parameter and can serve to guide the learner to the target grammar. The notion of a trigger is a re(cid:12)nement of that of primary linguistic data, which, through context of use, unambiguously signals a particular surface form (SF) to logical form (LF) pairing (e.g. Wexler and Culicover, 1980). Thus the task of the learnerfaced with a trigger,or SF-LF pairing, not expressible given the current grammar, is to update a parameter such that the trigger can be parsed appropriately. Frank and Kapur (1996) demonstrate that the existence of locking sequences of such triggers, guaranteeing convergence to a target grammar, dependsonthenatureoftheparameters,onthespeci(cid:12)cacquisitionprocedure,and on the starting point for learning. Chomsky (1981:7f) argued that at least some parametersprobably have an ini- tiallyunmarkedordefaultvaluewhichwillberetainedbythelearnerunlessincom- patible with input. That is, that the learner is biased towards certain settings of some parameters. Unmarked, default values have been proposed as a mechanism 2See, e.g., Pinker (1994) or Aitchison (1996) for recent positive summariesand discussion of thisevidence. SeeSampson(1989) foradissentingview. 2 for avoiding premature acquisition of a superset grammar (Hyams, 1986; Wexler and Manzini, 1987; Lightfoot, 1992). However, formal work on parameter setting has tended to assume arbitrary initial con(cid:12)gurations of parameters in evaluating learnability, perhaps because initial unmarked settings have only been proposed andjusti(cid:12)edforafewputativeparameters. Inaddition,therehavebeennopropos- als concerning the grammatical representation and formalization of the distinction between initially unset and initially default parameters. Chomsky (1981:8) also proposedthat the same mechanism might well be responsiblefor acquisition of the periphery of marked idiosyncratic constructions for which positive evidence was provided by a given language community. However, there has been little attempt toprovideaformalmodelofgrammaticalrepresentationandacquisitioncapableof incorporating these insights. Pullum (1983) criticizes the parameter setting framework because it predicts that the space of possible grammars, and thus languages, is vast, though (cid:12)nite 20 (20 independent binary parameters yields 2 or 1048,576 grammars, whilst 30 such parameters yields 1,073,741,824 distinct grammars), and because few if any psychologicallyfeasible,asopposedtomerelycomputationallytractable,acquisition procedures have been proposed within this framework. For example, brute force searchthroughthespaceofdistinctgrammarswillrequiretimeproportionaltotheir number (e.g. Clark, 1992), whilst the number of positive samples of the language and hence amount of time required for convergence to a target grammar can be arbitrarilylong depending on the distribution of triggertypes in the language(e.g. Niyogi and Berwick, 1996). Themodelpresentedinsection2addressestheseissuesviaamodi(cid:12)edparameter settingprocedure,whichcanlearnmorecomplexgrammarsthanthoseinvestigated byGibsonandWexler,andwhichismoredirectedandthereforelesspsychologically implausiblethantheMarkovian`memoryless'proceduresofthetypeinvestigatedby NiyogiandBerwick(e.g. Brent,1996). Themodi(cid:12)edprocedureisbasedonapartial ordering on the updating of parameter settings, de(cid:12)ning the category set and rule schemataavailableinacategorialgrammar. Thepartialorderingisobtainedbyuse of a default inheritance network as the grammatical representation language. The generalized categorial grammar (GCG) framework supports a more articulated ac- countof UG than istypicallydeployedin recentformalworkonparametersetting, enabling a wider space of grammars to be explored, and a richer notion of param- eter updating to emerge. Parameters are set in (partial) order of their generality inde(cid:12)ningthespaceofpossiblegrammaticalcategories,ensuringthatgrammatical hypotheses remain maximally speci(cid:12)c, though further modi(cid:12)able due to the defea- sibility of their consequences. The grammaticalrepresentationlanguageprovidesa formal means for distinguishing unset, default and absolute speci(cid:12)cation, and thus fordistinguishingunsetor(un)markedparametersfromprinciples. Variantsofthis acquisition procedure can be de(cid:12)ned based on the criterion adopted for retaining a new parameter setting, on the number of new parameter settings per trigger, on the existence of (maturational) workingmemorylimits during learning,and on the initial con(cid:12)guration of the parameter set. For Gibson and Wexler (1994), following Wexler and Culicover (1980), the cri- terion for retaining a new parameter setting is successful recovery of a complete and contextually-appropriate LF for the input; for Dresher and Kaye (1990), it is recognition of an unambiguous structural cue for that new setting. The cue-based approach to parameter setting of Dresher and Kaye results in a more incremental acquisition procedure which can be less sensitive to trigger presentation order. On the other hand, allowing more than one parameter per trigger sentence to be up- dated may counteract this sensitivity without changing fundamental properties of the acquisition procedure (Bertolo, 1995). In addition, as the relationship between parameters and a speci(cid:12)c account of UG becomes more articulated, the complete 3 independence of parameters becomes increasingly questionable (e.g. Dresher and Kaye,1990)andconsequentlyitisdi(cid:14)culttomaintainbothrecoveryofafullLFas the successcriterionand the restrictionto updating asingleparameterper trigger. Some of the consequencesof such variantswithin the parametersetting framework are explored experimentally in section 4. Elman (1993) argues, following Newport (1990), that language learning `starts small',restrictedbyworkingmemorylimitationswhichblockthelearnerfromseeing complextriggeringdatauntillaterinthelearningprocess. Itisknownthatworking memorycapacityincreasesthroughchildhood(e.g. Baddeley, 1976,1992)and that this correlates with language comprehension ability (e.g. King and Just, 1991; GathercoleandBaddeley,1993). Amaturingworkingmemorymayserveasa(cid:12)lter on trigger input and `internally' impose an order on the complexity of triggering data and thus on parameter setting. The language acquisition device (LAD) must incorporateaUG, aparametersetting procedure,and aparsercapableof applying the current grammar to primary linguistic data (e.g. Berwick, 1985). The parser will require a working memory to store (sub)analyses and the amount of memory required will vary for di(cid:11)erent constructions (and grammars). Restrictions on the working memory resources available to the parser can be used to distinguish parse failureduetoanincorrectgrammarfromparsefailureduetooverloadingofworking memory. The empirical consequences of internal (cid:12)ltering for a class of parameter setting learners is explored experimentally in sections 4.1 and 6. The starting point for a parameter setting procedure is de(cid:12)ned by the initial unset state or default setting of each parameter. The framework developed here is capable of expressing any such start state within the grammatical space explored. Thelearnabilityofeachgrammarmaybea(cid:11)ectedbythisstartingpoint(e.g. Gibson andWexler,1994),but linguistshaveoftenarguedfordefaultinitialvaluesforspe- ci(cid:12)c parameters. Bickerton (1984), in particular, argues that the abrupt transition frompidgintocreolesuggeststhatchildrenareendowedgeneticallywithinitialpa- rametersettingsspecifyingthestereotypicalcorecreolegrammar. Theconsequences of severalstarting points for the acquisition procedureare explored experimentally in sections 4.1 and 7, and it is argued on evolutionary grounds that the LAD is probablyequippedwithahighly-informativeandlargelyaccuratestartingpointfor acquisition with respect to the languagessampled during the period of adaptation. That is, many parameterswill havedefault, unmarkedvaluesappropriateto(some of) these ancestral languages. 1.2 Linguistic Evolution 3 The use of evolutionary terms and ideas in linguistic theory is not new but, ad- vances in the understanding of dynamic systems and the availability of compu- tational simulation techniques now make it possible to move beyond loose use of terminology, primarily as a metaphor, and study language directly from an evolu- tionaryperspective. Therearetwowaysinwhichevolutionarytheorymightbearon language. Firstly, it is possible, indeed highly probable, that the LAD is adaptive and has been selected for via biological evolution in the hominid line (e.g. Pinker and Bloom, 1990; Newmeyer, 1991, 1992). But secondly, language itself can be viewedasadynamicsystemwhichadaptstoitsniche{ofhumanlanguagelearners andusers(e.g. Cziko,1995;Hurford,1987;1998;Keller,1994). Inthissecondview, 3Mu(cid:127)ller,Schleicherandother19thcenturylinguistsspeculatedthatlanguagesevolvedaccord- ingtoDarwiniantheory,andDarwin(1871)endorsedtheidea,quotingwithapprovalfromMu(cid:127)ller: `Astruggleforlifeisconstantly goingonamongstthe wordsandgrammaticalformsineachlan- guage. Thebetter,theshorter,theeasierformsareconstantly gainingtheupperhand,andthey owetheirsuccesstotheirowninherentvirtue.' SeeHarrisandTaylor(1997:ch14) andMcMahon (1994:ch12) formorediscussionofthe relationshipbetween Darwinianand linguistictheory, and Keller(1994:46f)foracriticaldiscussionofMu(cid:127)llerandSchleicher'stheoriesoflanguage. 4 it islanguagewhich isevolvingonahistoricaltimescale,and the primarysourceof linguistic selection is the language acquisition `bottleneck' through which success- ful grammatical forms must pass repeatedly with each generation of new language learners. Under this second view, the concepts of linguistic evolution and selection are being used in their technical `universal Darwinist' sense of (random) variation, adaptive selection and di(cid:11)erential inheritance applied to any dynamic system (e.g. Dawkins, 1983; Cziko, 1995). To study linguistic evolution, it is necessary to move from the study of individual (idealized) language learnersand users, endowed with a LAD and acquiring an idiolect, to the study of populations of such generative languagelearnersand users,parsing,learningand generatinga set of idiolects con- stituting the language of a community. Once this step is taken, then the dynamic nature of languageemergesmore orlessinevitably. Occasionalmisconvergenceson the part of language users can introduce variation into a previously homogeneous linguistic environment, (cid:13)uctuations in the proportion of learners to adults in the populationcanskewthedistributionofprimarylinguisticdatasigni(cid:12)cantlyenough to a(cid:11)ect grammatical acquisition, and so forth. Once such variation is introduced, then properties of the acquisition procedure become critical in determining which grammaticalformswillbedi(cid:11)erentiallyselectedforandmaintainedinthelanguage, with language acquisition across the generations of users as the the primary form of linguistic inheritance. Severalresearchershaverecentlyproposedthatlanguagecanbetreatedasady- namicor(complex)adaptivesysteminordertoformallymodelaspectsoflanguage change (e.g. Niyogi and Berwick, 1997a,b) or account for typological, statistical and implicational universals (e.g. Kirby, 1996, 1997, 1998). In generative work on diachronic syntax, language change is primarily located in parameter resetting (reanalysis) during language acquisition (e.g. Lightfoot, 1979, 1992, 1997; Clark and Roberts, 1993; Kroch and Taylor, 1997). Di(cid:11)erential learnability of gram- matical systems, on the basis of learners' exposure to triggering data from varying grammatical sources, causes change. This can be modelled as an evolutionarypro- cess in which variant source grammars provide competing constructions which are di(cid:11)erentially-selectedbythenextgenerationofspeakersasaconsequenceofproper- tiesoftheLAD.Modellinglanguageasanadaptivesystemwhichistheproductofa changingpopulationoflanguagelearnersandusersmayshedlightontheconditions under which parameters will be reset. AsNiyogiandBerwick(1997a,b)argue,thebehaviourofallbutthesimplestdy- namicsystemsisoftenunintuitive;whilstanalyticproofsofthebehaviourofclasses of such systems areonly possible when the number of variablesinvolvedis severely limited. Forthesereasons,acomputationalsimulationmethodologyisutilizedhere, which allows more complex models to be studied experimentally. It is important that simulations strike the right balance between idealization and ecological va- lidity, ignoring irrelevant complexities, but modelling potentially relevant factors, and making critical assumptions explicit. A simulation of linguistic evolution, at a minimum, needs to provide a source of linguistic variants on which selection can workandarealisticmodeloflanguageacquisitionwhichwillformthebasisofboth the inheritance and selection amongst those variants. But before, developing such a model we need to consider the relationship between linguistic evolution and the biological evolution of the LAD. 1.3 Coevolution and Genetic Assimilation PinkerandBloom(1990)argueforanadaptationistaccountoftheevolutionofthe language acquisition device (LAD) suggesting that the domain-speci(cid:12)c linguistic (grammatical)knowledgerequiredtosupportreliablelanguagelearningwasgeneti- 5 callyassimilatedvianaturalselectionformoresuccessfullanguagelearnerssincethe 4 emergence of structured language. Genetic assimilation is a neo-Darwinian (and not Lamarckian) mechanism supporting apparent `inheritance of acquired charac- teristics' (e.g. Waddington, 1942, 1975). The fundamental insights are that: 1) plasticityintherelationshipbetweenphenotypeandgenotypeisundergeneticcon- trol, 2) novel environments create selection pressures which favour organisms with theplasticitytoallowwithin-lifetimedevelopmentaladaptationstothenewenviron- ment,3)naturalselectionwillfunctionto`canalize'thesedevelopmentaladaptations by favouring genotypic variants in which the appropriate trait develops reliably on the basis of minimal environmental stimulus, providing that the environment, and 5 consequent selection pressure, remains constant over enough generations. Asanexampleofgeneticassimilation,Durham(1991)discussesindetailthecase of widespread, though by no means universal, lactose tolerance in adult humans. Many of us, uniquely amongst mammals, continue to be able to easily digest milk after weaning. In manyparts of the worldthe growthof animal husbandrycreated anewandreliablesourceofnutrition{milk. Thus,individualsmoreabletoexploit thisresourceforlongerperiodsoftheirlifetimewereselectedfor. Lactosetolerance hasbeengeneticallyassimilatedbythegreatmajorityinpopulationswheremilkhas been reliably available overmany generations. Although it is not possible to relate lactosetolerancedirectlytospeci(cid:12)cgeneticdi(cid:11)erences(yet),Durhamdemonstrates convincingly that the incidence of intolerance correlates, in a manner compatible with a genetic explanation, with a fairly recent introduction of diary products and 6 with warm climates, where lack of Vitamin D is less potentially problematic. Waddington, himself, suggested that genetic assimilation provided a possible mechanismforthe gradualevolutionof aLAD: `If there wereselectionfor the abil- itytouselanguage,thentherewouldbeselectionforthecapacitytoacquiretheuse of language,in an interactionwith a language-usingenvironment;and the result of selection for epigenetic responses can be, as we have seen, a gradual accumulation of so many genes with e(cid:11)ects tending in this direction that the charactergradually becomes genetically assimilated.' (1975:305f). Pinker and Bloom (1990) brie(cid:13)y make the same suggestion, citing Hinton and Nowlan's (1987) computational sim- ulation showing genetic assimilation of initial node settings facilitating learning in a population of neural networks. One complication for this account of the evolution of the LAD is that it does 4This aspect of their argument, at least, is distinct from the question of whether the LAD originatedviaabiologicalsaltationorgradually. Berwick(1997)arguesthattheMergeoperation of the Minimalist Program (e.g. Chomsky, 1991) might have been exapted via genetic drift. Thisspeci(cid:12)c proposalisquite compatiblewith the frameworkpresented here,inwhich function- argument application plays a similarly central role to Merge. Indeed, as Steedman (1996:14f) notes,thedeterministicmappingviacategorialrulesofapplication,composition,andsoforthfrom surfaceformtopredicate-argumentstructurestrengthensthecaseforanevolutionarypathwayin termsofthe development of such rulesof `realization'forpre-existing conceptual structures (see e.g. Bickerton,1998;Worden,1998). However,thequestionoftheoriginoftheLAD,asopposed toitssubsequentevolutionandmaintenance,isnotaddressedfurtherinthispaper. 5Waddington'sworkongeneticassimilationisaneo-Darwinianre(cid:12)nementofanideaindepen- dently discovered by Baldwin, Lloyd Morgan and Osborne in 1896, and often referred to as the BaldwinE(cid:11)ect(seeRichards,1987foradetailedhistory). Waddingtonre(cid:12)nedtheideabyempha- sizing the role of canalization and the importance of genetic control of ontogenetic development { his `epigenetic theory of evolution'. He also undertook experiments with Drosphila subobscura which directly demonstrated modi(cid:12)cation of genomes via arti(cid:12)cial environmental changes (see JablonkaandLamb,1995:31fforadetailedandaccessibledescriptionoftheseexperiments). 6Evolutionary biologists accept the possibility of genetic assimilation (e.g. Maynard Smith, 1987, 1993:319f; Rose, 1997:217f), however, some (e.g. Dawkins, 1982:284) regard it as a `hypo- thetical' mechanism because, though it has been demonstrated experimentally, it has not been conclusively shown to occur naturally. It is extremely di(cid:14)cult to prove a case of natural, adap- tive genetic assimilation. Nevertheless, the developmental view of evolution, which Waddington pioneered, is gaining ground as more is understood about the relationship between genes and environmentinmorphogenesis(e.g. JablonkaandLamb,1995). 6 not explain why genetic assimilation should not have continued until the point where a fully-speci(cid:12)ed grammar had been assimilated, and grammatical learning becameredundant. Waddington(1975:307)remarks: `Evolutionis quitecapableof performingsuchafeat... Butinthecaseoflanguage,thereiscertainlylittle reason to see why it would have been advantageous to press the matter further. If a child which had never met a language-user developed the ability to talk, who after all would it talk to?' Nevertheless, the propensity to use a fully-speci(cid:12)ed grammar, given minimal triggering input, would simplify the language acquisition problem to one of vocabulary acquisition. Pinker and Bloom (1990), following Hinton and Nowlan (1987), argue that selection pressure to set the remaining initial nodes in Hinton and Nowlan's neural networks is weak once networks have evolved to learn reliably. However,Harvey(1993)demonstratesthatthisisanartifactofHintonand Nowlan'ssimulationdesign{latermoree(cid:11)ectivenetworksalmostinvariablyevolve, without mutation, from a single ancestor, causing `premature' (and artifactual) (cid:12)xation of some unset nodes, and thus preventing the population from evolving further. As long as there is selection pressure for a fully-developed capacity, we would expect no learning, and thus no delay in acquisition of the trait, to be the 7 optimal solution. Deacon (1997:102f,327f) rejects any account of the evolution of a LAD via ge- netic assimilation, on the basis that genetic assimilation requires an unchanging environment to create the sustained selection pressure over the many generations required for genotypic adaptation. Pinker and Bloom (1990) simply assume that linguistic universals are evidence of enough constancy in the environment to al- low genetic assimilation. However, once we view language itself as an adaptive system, this assumption, that universals are unambiguous evidence of genetic as- similationoflinguisticknowledgeintoaLAD,isnolongernecessarilyvalid. Deacon (1997:116f)insteadarguesforthecontrarypositionthatalllinguistic`universal[s]... emerged spontaneously and independently in each evolving language, in response to universal biasesin the selection processesa(cid:11)ecting languagetransmission. They are convergent features of language evolution in the same ways as dorsal (cid:12)ns of sharks, ichthyosaurs, and dolphins are independent convergent adaptations of ac- quatic species.' He suggests,in particular,that languageshaveevolvedto be easily learnable by an acquisition procedure which `starts small', following Elman (1993) discussed in section 1.1, with a limited working memory only capable of `seeing' local grammatical dependencies. Furthermore, Deacon (1997:328f) argues that the surface grammatical organization of languages changes with such speed relative to genetic evolution that there could not have been consistent enough selection pres- sure for genetic assimilation. Deacon's position can be criticized on three levels. Firstly, it is unclear that he recognizes the import of linguistic learnability arguments and the relevance of abstract universals (without clear `surface' e(cid:11)ects). For example, the language ac- quisitionprocedurepresentedbelowcanparseandlearngrammaticalconstructions involving cross-serial grammatical dependencies, such as those exempli(cid:12)ed in the n n n formal language a b c (where n (cid:21) 1), Swiss German syntax and Bambara mor- phology (e.g. Shieber, 1985; Gazdar 1988), but not constructions involving the MIX or Bach language variant in which any ordering of equal numbers of the as, bsandcsisgrammatical,creatingarbitrarilyintersectingdependencies. Whethera language exhibits cross-serial or arbitrarily intersecting dependencies is an appar- ently rather abstract feature which does not (cid:12)t well into traditional more `surfacy' characterizationsoflanguagesas,say,in(cid:13)ecting,agglutinatingorisolating,orhead- 7AckleyandLittman(1991)andCecconietal.(1996)describeunrelatedsimulationswhich,un- likeHintonandNowlan,distinguishphenotypeandgenotype,donotmakeuseofa(cid:12)xedexternally- de(cid:12)ned (cid:12)tness function, and do modellearning cost { in these simulationslearning iseventually entirelydisplaced,givenaconstantenvironment,asexpected. 7 initial / (cid:12)nal, and so forth. Nevertheless, this has profound consequences for the kind of rule system capable of expressing the mapping from SF to LF. Not least, that a formal proof of learnability has been found for grammatical frameworks ca- pable of expressing cross-serialdependencies (Joshi et al., 1991), but not for those able to express arbitrarily intersecting dependencies. The genetic assimilation of a language-speci(cid:12)c rule system (the UG component of the LAD) remains a theoret- ical possibility, even if the emergence of such abstract universals can be traced to non-domain-speci(cid:12)c factors, such as working memory limitations (see also Kirby, 1998). Secondly, Deacon relies heavily on the `starting small' hypothesis and Elman's (1993)experimentstrainingrecurrentneuralnetworks(RNN)toapproximaterecog- nition of context-free languages. Whilst these experiments demonstrate a clear requirement for initially training on short sequences containing local grammatical dependencies, it is unclear what consequences this has for grammatical acquisition by human learners. Elman's RNN models do not have the expressive power to en- code SF-LF mappings and, therefore, to underpin a model of language generation andinterpretation. Itisnot,aprioriobviousthatwhenwemovetoconsidermodels with this capacity,andtheirassociatedacquisitionprocedures,that asimilare(cid:11)ect will be observed. In fact, though the experiments reported in sections 4.1and 7 do show that the assumption of maturationalmemory limitations during languageac- quisitiondoesa(cid:11)ectpredictionsconcerningthedi(cid:11)erentiallearnabilityoflanguages in theframeworkdevelopedhere, theydonot showanye(cid:11)ectonthe learnabilityof languages per se. Thirdly, in recent years, the increased use of mathematical tools and compu- tational simulation has demonstrated the probability of extensive coevolutionary interactions acrossspecies, such as predator-preyinteractions, competitive and be- nign host-parasite interactions, plant-insect interactions, and so forth (e.g. Fu- tuyma and Slatkin, 1983; Kau(cid:11)man, 1993:242f; Maynard Smith, 1998:285f). Most oftheseinteractionsinvolvespeciesevolvingatdi(cid:11)erentrates,asthelifespanofthe parasite is usually far shorter than that of the host. Though Waddington's neo- Darwinian mechanism of genetic assimilation remains the basis for (co)evolution in response to environmental change, this work suggests that relative speed alone cannot conclusively be used to reject the possibility of genetic assimilation in re- sponse to pressure from an evolving linguistic environment. Interestingly, though Deacon (1997:112-13)draws the analogy between language and symbiotic bacteria (for example, those found in the human gut which aid digestion) and subtitles his book `co-evolutionof language and brain', he does not explicitly discuss the recent literature on coevolution, or whether this might warrant reconsideration of how environmental changes a(cid:11)ect genetic assimilation. The speed at which linguistic changes can di(cid:11)use through a population will be far faster than that at which ge- neticchangecandoso. However,thereisclearlyaspeedlimittothischangewithin a successfully communicating population, and that speed limit means that only a small part of the space of possible grammars may be sampled over the period required for biological evolution. The experiments reported in section 7 suggest this can lead to a constant enough selection pressure capable of supporting genetic assimilation of a LAD. However, the fact of linguistic change provides a natural barrier to total genetic assimilation of a fully-speci(cid:12)ed grammar. The simulation models both natural selection for variant language acquisition procedures and linguistic selection for languages. Therefore, it is possible to both explore what kind of acquisition procedure might evolve and what e(cid:11)ects di(cid:11)erent acquisition proceduresmight haveon the grammaticalsystems which evolve,given varyingassumptionsabouttheroleofmemorylimitationsinlearning,theadaptive advantageoflanguagetolanguageusers,andsoforth(Briscoe,1997,1998a,b). The simulation can be set up to model either a neutral, random relationship or benign, 8 symbiotic relationshipbetween languagesand their potential users. That is, one in whichtheabilitytocommunicatevialanguageeitherconfersnoselectiveadvantage (ordisadvantage)oronewhichconferssome(unspeci(cid:12)ed)selectiveadvantagetoits users. Additionally, in some experiments, the ability to communicate using a more learnable, expressive or interpretable variant language can confer greater relative advantage. Roughgarden(1983)arguesthatmutualisticcoevolutionbetween`host' (languageusers)and`guest'(languageidiolects)organismswillonlyoccurwhenthe host bene(cid:12)ts (and the experiments reported in section 6 bear out this prediction). Ontheassumptionthatlanguageconfersselectiveadvantage,linguisticvariants will compete for language users on the basis of their relative learnability, and, possiblytheirinterpretabilityand/orexpressiveness. Languageuserswillalsoevolve languagefacultieswhichimprovetheircapacitytoacquireanduselanguage. Given this scenario, a language can be viewed as a parasitic coevolving species. Under the alternative assumption that language confers no selective advantage, linguistic variantswillcompeteforlanguageuserssolelyonthebasisoftheirlearnabilitywith respect to whatever acquisition procedure is in place. However, there will be no pressure for this acquisition procedure to evolve to favour any particular linguistic variants. Thus, a language can still be seen as a dynamic system adapting to the requirements of learnability, but language will have no in(cid:13)uence on biological evolution. Nevertheless, giventhe implausibility of assuming that languageconfers no selective advantage, whatever form this might take, the coevolutionaryscenario seems more likely. There are several ways in which linguistic evolution and biological evolution might be argued to be qualitatively di(cid:11)erent, in addition to such quantitative dif- ferences as relative speed of change. Linguistic variants may compete for language users, but it might be argued they do not have a (cid:12)tness, in the technical sense of expectednumberorproportionofo(cid:11)spring(e.g. MaynardSmith,1998:36f). Rather theprimarymechanismoflinguisticinheritanceisthroughachildlanguagelearner actively learning their idiolect, rather than the gene replicating via the medium of DNA (e.g. Keller, 1994). The degree to which this distinction can be upheld de- pendsontheextenttowhichageneisde(cid:12)nedasabiochemicalobject,asopposedto 8 aunitofinformation. Inthesimulationmodel,languageusersmayhave(relative) (cid:12)tnessasaconsequence,primarily,oftheircommunicativesuccess,whilstlanguages have(relative)costtousersdepending, primarily,ontheir(cid:12)t withtheiracquisition procedures. A di(cid:11)erent but related question concerns the units of linguistic selec- tion, andwhether therecanbe acorrespondingdistinctionbetween phenotypeand genotype in linguistic evolution. Linguistic variation is de(cid:12)ned in terms of com- peting constructions which form part of the linguistic environment (or phenotype). Such variants compete by virtue of being in parametric variation or, perhaps more generally,becausetheyarevariantmeansofexpressingthesamemeaning. Interms of the model of the LAD developed in section 2 and simulation model of section 3, the principles and parameters which de(cid:12)ne UG and speci(cid:12)c grammars form the ultimate units of linguistic selection. 2 The Language Acquisition Device AmodeloftheLADincorporatesaUGwithassociatedparameters,aparser,andan algorithmforupdatinginitialparametersettingsonparsefailureduringacquisition (e.g. Clark, 1992). The following sections present such a model, which builds on and extends previous work reviewed in section 1.1. 8Dawkins (1982:109f) and Dennett (1991:341f) make similarpoints discussing the di(cid:11)erences between genes andmemes(minimalideational unitsofculturalinheritance putatively subjectto culturalselection). 9 ForwardApplication: X/Y Y ) X (cid:21) y [X(y)] (y) ) X(y) BackwardApplication: Y XnY ) X (cid:21) y [X(y)] (y) ) X(y) Forward Composition: X/Y Y/Z ) X/Z (cid:21) y [X(y)] (cid:21) z [Y(z)] ) (cid:21) z [X(Y(z))] Backward Composition: YnZ XnY ) XnZ (cid:21) z [Y(z)] (cid:21) y [X(y)] ) (cid:21) z [X(Y(z))] (Generalized Weak) Permutation: (XjY1):::jYn ) (XjYn)jY1::: (cid:21) yn:::,y1 [X(y1:::,yn)] ) (cid:21)::: y1,yn [X(y1:::,yn)] Figure 1: GCG Rule Schemata 2.1 The Grammar (set) Classical (AB) categorial grammar uses one rule of application which combines a functor category(containing a slash) with an argument categoryto form a derived category (with one less slashed argument category). Grammatical constraints of order and agreement are captured by only allowing directed application to adja- cent matching categories. Generalized categorial grammars (GCGs) extend the 9 AB system with further rule schemata. The rules of forward application (FA), backward application (BA), generalized weak permutation (P) and forward and backward composition (FC, BC) are given in Figure 1 (where X, Y and Z are cat- egory variables, j is a variable over slash and backslash, and ::: denotes zero or more further functor arguments). Generalized weak permutation enables cyclical permutation of argument categories, but not modi(cid:12)cation of their directionality. Eachrule has an associatedsemantic operation representedhere in terms of (cid:17) con- version in the (typed) Lambda Calculus. Once permutation is included, several semanticallyequivalentderivationsforKim loves Sandy becomeavailable,Figure2 10 shows the non-conventional left-branching one. Composition also makes alterna- tivenon-conventionalsemantically-equivalent(left-branching)derivationsavailable, as Figure 3 illustrates. Steedman (1988, 1996) presents the arguments for the lin- guistic utility of composition. GCGaspresentedisinadequateasanaccountofUGorofanyindividualgram- mar. Inparticular,the de(cid:12)nition ofatomic categoriesneeds extending todeal with featural variation, further unary/lexical rules will be needed (e.g. Bouma and van Noord, 1994), and the rule schemata, especially C and P, must be restricted in various parametric ways so that overgeneration is prevented for speci(cid:12)c languages (e.g. Morrill, 1994). Nevertheless, GCG does represent a plausible kernel of UG; 9Wood (1993) is a general introduction to categorial grammarand possible extensions to the basictheory. ThemostcloselyrelatedtheoriestothatpresentedherearethoseofSteedman(e.g. 1988,1996)andespeciallyHo(cid:11)man(1995,1996). 10Generalized weak permutation (P) is more powerful than the rule sometimes called associa- tivity(e.g. Wood,1993:37f)whichlicenses(X/Y)nZ)(XnZ)/Ybutnot(X/Y)/Z)(X/Z)/Y, sincethelatterisalsolicensedbyP.However,Pislesspowerfulthanpermutationintheextended Lambek calculus LP (e.g. Wood 1993:64f; Moortgat, 1988:45f) in which directional constraints arenolongermaintained{seeBriscoe,1998bforamoredetailedexplorationandjusti(cid:12)cationof theconsequences ofP. 10