loading

Logout succeed

Logout succeed. See you again!

ebook img

Hegel on the ethics of Antigone PDF

pages17 Pages
release year2015
file size0.08 MB
languageEnglish

Preview Hegel on the ethics of Antigone

Hegel on the ethics of Antigone Joshua Mendelsohn Characters in tragedy frequently find themselves in situations in which occupying all of the roles which they have occupied until that point becomes, or seems to become, impossible. Call such a situation an ethical bind. In this paper I will be interested in three general questions about ethical binds: (i) How, in general, does one come to be in an ethical bind? (ii) What, in general, does an ethical bind call upon one to do? and (iii) Why, in general, does being in an ethical bind have the capacitytocausesuchgreatsufferingforthosecaughtinthem? By“ingeneral”hereIdonotmean “for the most part” or “by and large”. Rather, I mean these as questions about the form of ethical binds: Questions about what an ethical bind looks like in any possible case. I will contrast two views of ethical binds, one which is implicit in Christine Korsgaard’s account of roles and duties in Self-Constitution, and one due to Hegel, as it shows up in his reading of Sophocles’ Antigone. If we think that Antigone depicts a situation that people could really find themselves in, then, I will argue, we have reason to prefer Hegel’s account of the nature of ethical binds over Korsgaard’s. 1 Korsgaard on role arbitration and self-constitution AccordingtoChristineKorsgaard,livingasarationalbeingrequiresconstitutingapracticalidentity by occupying a range of roles (Korsgaard, 2009, p. 21).1 Each role that we occupy gives us an associatedsetofduties,somemorehigh-flownandothersmoremundane. Asaparent,forexample, one has duties to nurture and protect, as someone’s friend, one ought to listen to their gripes from time to time, as a scientist, one has a duty to be impartial in one’s pursuit of the truth. All of our duties, on Korsgaard’s account, have their source in one such role (Korsgaard, 2009, p. 21). Since ourrolesaredrawnfromsourcesasheterogenousasbiologicalrelationships,politicalaffiliationsand professsional occupations, it is unsurprising that they will sometimes place conflicting demands on us. It is by occupying incompatible roles that we come to be in ethical binds (Korsgaard’s answer to (i)). 1I will use the term “role” broadly in this paper as a catch-all for any sort of social position or relationship which is associatedwithasomecharacteristicobligationorsetofobligations. 1 According to Korsgaard, we are generally free to step out of roles which cause a conflict among our duties (Korsgaard, 2009, p. 23). Remarkably, Korsgaard takes this freedom to extend not only to voluntarily adopted roles such as professional positions and membership in political organizaitons, but“evenafactuallygroundedidentitylikebeingacertainperson’schild”(Korsgaard,2009,p.23). If morality requires it, we can free ourselves of the duties we have in virtue being someones child simplybyceasingtoidentifywiththatrole(Korsgaard,2009,p.23). Theonlynon-contingentroles which we occupy, according to Korsgaard, are those entailed by being a human or a rational being (Korsgaard, 2009, p. 24). When our practical identity becomes discordant, Korsgaard claims, we can determine which of our roles we ought to take as giving us continuing to give us genuinely binding obligations, and which we ought to amputate from our practical identity, by means of the categorical and hypothetical imperatives(Korsgaard,2009,p.25). Thecategoricalimperative,whichintheformulaofuniversal law tells us what can be willed without contradiction, and the hypothetical imperative, which tells us how to obtain what we thereby will, provide the method and logic of practical reasoning (Korsgaard, 2013, p. 500). They therefore allow us to determine what roles we can adopt while remaining a unified agent. The freedom we have in adopting and renouncing our roles in line with the dictates of morality meansthatescapingethicalbindswillgenerallybepossible,evenifdifficult,onKorsgaard’saccount. For Korsgaard, the only circumstances under which navigating an ethical bind could be impossible would be one in which we find ourselves with conflicting commitments as a result of two roles that are constitutive of our being human or being rational. Otherwise, our freedom to renounce contingent roles, and thereby shed contingent duties, implies that we can always reconfigure our commitmentsinordertorestoretheunityofourpracticalidentitybycastingoffasmanydiscordant roles as morality dictates. On Korsgaard’s account, then, the appropriate response to an ethical bind is to employ the cat- egorical and hypothetical imperatives in order to determine a set of roles which will not place conflicting demands upon us. This is what we are called upon to do in an ethical bind (ii). This will generally be difficult because the roles which we occupy are constitutive of who we are. The navigation of ethical binds therefore requires a willingness to let go of any parts of ourselves which a universalizability test deems unfit to stay. Letting go of these roles is bound to be difficult (iii). The payoff for doing this, however, is that we will regain the integrity of our person, and be able to occupy those roles we retain with full dedication. 2 2 Antigone as a test case for Korsgaard’s account IfKorsgaard’saccountsucceedsingivingageneraldescriptionofethicalbinds,thenitshouldapply to the ethical binds faced by characters depicted in Greek tragedy, and in particular the bind of Creon and Antigone as depicted by Sophocles.2 Reflection on the form of ethical binds depicted in tragedy, however, raises some serious questions for Korsgaard’s account. We can begin by noting that Korsgaard’s account attenuates the sense in which the agents caught in an ethical bind are really bound by their situations. Instead, Korsgaard’s account locates failings in the limitations of the agents in such binds. A perfect Korsgaardian agent would be resistant or immune to tragic situations: She would shed her recalcitrant roles as soon as they disrupted her practical identity, and would not let such a practical contradiction destroy her dignity or disrupt her capacity to act. Conversely, any discord in the ethical situation of a character faced with an ethical bind ought, on Korsgaard’s account, to show up as a subjective difficulty in her attempt to construct a practical identity. This is hard to square with Antigone. Unlike Medea, whose tormented deliberation itself forms a large part of the tragic content of Euripides’ play, neither Antigone nor Creon seem internally conflicted at all. It is, in fact, hard to imagine two characters with a stauncher sense of who they are what their duty is. It seems obvious to Antigone that her duty is to Polynices rather than the city of Creon’s rule, and Creon likewise the reverse.3 Yet there is little denying that they are each in a state of ethical turmoil. Adopting their roles wholeheartedly, Creon and Antigone nonetheless end the play steeped in regret. Despite his certainty regarding who he is and where his duties lie, Creoncanstillwailattheendoftheplaythat“myplanningwasallunblest”(1262),whileAntigone comes to view her suffering as a sign that she has gone wrong (926).4 TheKorsgaardiancouldrespondthatAntigoneandCreondonot,infact,possessflawlesspractical identities despite their resoluteness in their goals and duties. What each of them takes to be their role is really a combination of roles which are in fact incompatible. Hence the coherence of their practicalidentitiesismerelyapparent,andtheyhaveinfactfailedtodowhattheyoughttoinorder 2Onemaydoubtwhetherthisisafairtestifonethinksthatthesituationsinancienttragedyarenotsituationswhich couldreallyarise. InthispaperIassumewithoutargumentthatAntigonedoespresentasituationwhichisreallypossible, butIwelcomediscussionofthisonFriday. 3AlthoughCreonrunshisdecisionpasttheeldersofThebes,theyrespondinthemannerofyes-men(“Thisresolution, Creon, isyourown, /inthematterofthetraitorandthetrue. /Foryoucanmakesuchrulingsasyouwill/aboutthe living and about the dead”, 211–214). Creon does not seem interested in discussing the matter, and dismisses suggestion thatheoughttoreconsiderhispriorities. 4Atleast, this is howHegel interpretsline 926 (παθόντεςἄν ξυγγνοῖμεν ἡμαρτηκότες), whichhe translates as “weil wir leiden,anerkennenwir,daßwirgefehlt”(PhG,p.348). Woodruff(2001,p.65)takesissuewiththistranslation,emphasizing thatthislineoccursastheconsequentofaconditionalbytranslating925–26as“Ifthegodsreallyagreewiththis[Creon’s judgement],/Thensufferingshouldteachmetorepentmysin,”andaddingthat“[n]othingintheplaysuggeststhatthe godsdoagreewithCreon’sjudgement,andnothingAntigonesaysimpliesthatshebelievessufferingimpliesguilt.” Whether or not Antigone is acknowledging wrongdoing at 926, however, it is hard to dispute that she ends the play in a state of ethicalturmoildespiteherstauchdevotiontoherroleasasister. ThisisallIrequireformyargument. 3 to reconstitute their identities. Even if we grant this, it is hard to take seriously the claim that Creon and Antigone could have avoided their difficulties by simply walking out on their identities. An Antigone who opted to say a silent prayer for her brother, or a Creon who threatened to give a stern talking to anyone who buried the body of Polynices, would scarcely be recognizable. There is a question whether these would, in any meaningful sense, be the same characters. Still, if the Korsgaardian will allow that one should walk out on a factually grounded role such as being someone’s child when the categorical imperative requires it, she will presumably insist that Antigone and Creon also ought to forget their cherished roles as a sister and as a king, even if this wouldrenderthemunrecognizable. Nevertheless,wemightstillviewitasacostoftheKorsgaardian viewthatshemustmakethisadmission. ItshowsthatherviewdoesshedmuchlightonhowCreon or Antigone as we know them could navigate their dilemma, since it recommends they in effect replace themselves with entirely new characters. This is a cost of Korsgaard’s view, but not a fatal objection. A more serious problem for Korsgaard’s view is brought to light by a close examination of what Antigone and Creon’s bind actually consists in. This will call into question Korsgaard’s account of how the navigation of any ethical bind ought to proceed. To this end, I will begin by giving a reading of Antigone based on a perceptive remark Hegel makes about the play. 2.1 A Hegelian reading of Antigone Sophocles’s tragedies, and Antigone in particular, occupied Hegel throughout his life. At sixteen, HegelhadalreadyproducedatranslationofAntigone(Avineri,1972,p.2). Inhisfirstmagnumopus, the Phenomenology of Spirit, Antigone punctuates the transition from the first, largely theoretical part of the book to Hegel’s engagement with culture, history and religion in the latter.5 Antigone appears again in his major political treatise, The Philosophy of Right, where it is used to explore gender roles.6 When late in life he came to formulate a theory of tragedy as part of his lectures on The Philosophy of Fine Art (VPK, p. 280), he employs Sophocles’s Theban plays as paradigms of the genre, and reserves his most ebullient praise for Antigone. Hegel draws our attention to the fact that that Antigone and Creon’s interests are intertwined in virtue of their mutual affiliation with the royal household of Thebes. Although Antigone is proud of her defiance of Creon’s decree in favour of the “unwritten laws” of family piety (456), and Creon delights in denouncing Antigone’s “wicked” preference for loved ones (φίλαι) over the city (182–183, 5Antigonefirstmakesanappearanceattheendofthethirdpartofthebookentitled“Reason”,whichcontainsHegel’s applicationofthe“experiences”ofconsciousnesstothehistoryofscienceandtheriseofindividualism(PhG,p.322). The dramaistakenupagaininhisdiscussionofSittlichkeit,or“ethicallife”(PhG,p.348),atthebeginningofthepartofthe bookentitledGeistor“spirit”–Hegel’swordfor,roughly,thesphereofhumancultureandvalues. 6See Hegel (EPR, 318ff., §166). For a critical discussion of Hegel’s use of Antigone in this passage, see Brauer (2005, pp.141–149). 4 650–654), their situation does not in fact display the independence from one another’s interests which each claims: Antigone, for example, lives under the political authority of Creon; she is herself the daughter of a king and the affianced of Haemon, so that her obedience to the royal prerogative is an obligation. But Creon also, who is on his part father and husband, is under an obligation to respect the sacred ties of relationship, and only by breach of this can give an order that is in conflict with such a sense. In consequence of this we find immanent in the life of both that which each respectively combats, and they are seized and broken by that very bond which is rooted in the compass of their own social existence. (HT, p. 73) In other words, the reality of Antigone and Creon’s ethical predicaments are not as simple as they each imagine them to be.7 It is important to Antigone that her burial of her brother be an act of public defiance. Rather than taking precautions to avoid getting caught, she chastises her sister for offering to keep her plan a secret (83–84). Thus, despite her constant contrast between her own devotion to the unwritten law of Zeus and the fleeting law of man, Antigone is under no illusions aboutherparticipationinthepublicsphere. Infact,alargepartofherconcernseemstobenotjust withherowndevotiontounwrittenlaws, butwiththecivicconsequencesofdisregardingsuchlaws (450–459). Itisfitting, therefore, thatAntigone’sfinalspeechisnotasomberfarewelltoIsmeneor Haemon, but a public address (“Men of my fathers’ land, you see me go…”, 810). Antigone seems keenly aware that her rejection of man-made law is itself a political statement. Antigone’s callous attitude toward her sister Ismene also complicates the presumption that she is acting in the name of familial love. In suggesting a joint suicidal undertaking, we would expect a loving sister to at least be patient with her sibling and be ready to explain why she thinks there is nootheroption. Instead,AntigoneconfrontsIsmenewithaself-righteoustiradeaboutnobilityand betrayal. When Ismene expresses reasonable hesitation at the plan, Antigone shuns her (69–70), and when Ismene offers to keep the plan a secret, Antigone retorts sharply: “I shall hate you more if silent, not proclaiming this to all” (86–87). This cruel condition forces Ismene to choose between her sister’s hatred and causing her sister’s arrest. When finally Ismene attempts to take a share of responsibilityforthecrime,Antigoneshowsnosignsofgratitudeorsympathy,anddeniesIsmene’s involvement before Creon. We might suppose that Antigone is here only feigning distance in order to spare Ismene from Creon’s wrath. O’Brien (1977), however, makes an argument that Antigone is punishing Ismene for not complying earlier by consigning her to worse fate than her own: 7ThiswayofelaboratingHegel’spoint,althoughnotthespecifictextualevidenceusedtodoso,owesadebttoNussbaum (2001),Ch. 3. 5 […]AntigonecannotforgiveIsmene’searlierparalysisandcoldly,evenharshly,consigns hertocontinuedexistencewithCreon(549). IsthisonlyapparentcoldnessonAntigone’s part, as some claim? […] Nothing in the text suggests such “charity.” In fact, given Antigone’sbeliefthatloveconstituteslife, andgivenIsmene’savowalsoflove, Antigone musthaveknownthatIsmene’sfatewasworsethanherown. Ismene, too, wouldprefer physical death to death in life. (O’Brien, 1977, p. 37) It is hard to resist the conclusion that Antigone is more preoccupied with her own honour (“What greater glory could I find than giving my own brother funeral”, 503) than her family’s welfare. It is notable in this respect how often Antigone refers to herself (“I shall never be found to be his traitor”, 46, “For me, the doer”, 72, “There I shall lie forever,” 77, “I shall suffer nothing as great as dying with lack of grace”, 96–97), and how seldom to any living members of her family. The fact that Antigone’s affections are directed almost entirely to dead members of her family, and the laws she fights for are “unwritten” (and hence provide no public standard to which she can be held) mean that she largely inhabits a world of her own construction. As a result, she shows signs of the tyrannical self-absorption that she despises in Creon. As she is walking to her tomb, the Chorus indicates that Antigone’s own desire for fame will at least be fulfilled. Although it is not clear whethertheChorusmeanstochideheratthispoint,itistellingthatAntigonedoesappeartotake it this way. She answers the chorus indignantly: “Laughter against me now. In the name of our fathers’ gods, could you not wait till I went?” (839–840) While Antigone addresses the masses, Creon stays confined to his palace, where he becomes in- creasingly preoccupied with his son’s obedience. The way that he informs Haemon of his intention to sentence Antigone to death calls into question Creon’s claim to be acting for the public good alone. If Creon’s motivation for sentencing Antigone were purely political, we would expect him to show at least a modicum of sensitivity in telling Haemon that he has decided to kill his future wife. Instead, Creon announces his decision proudly, and insists that he has his son’s best interests at heart, since he will be saved from a “wicked wife” (γυνὴ κακὴ, 651). He cites explicitly the need to maintain domestic order when he explains his decision: “If I allow disorder in my house,” he says, “I’d surely have to license it abroad” (658–659). That he sees Antigone as a threat to his own household shows that Creon does not hold her merely in political contempt. He sees her equally as a personal enemy, and is unable to maintain a distinction between political and personal reasons for sentencing her. He recognizes only one blanket category of bad action, “disobedience”, which both “ruins cities” and “tears down our homes” (673). In lecturing Haemon about the virtues of obedience, Creon not only destroys his son’s respect for him,healsoallowscivicordertodegenerateoutsidethepalace. Evidentlythecityisunhappywith Creon’s decision: Haemon relates that “the whole town is grieving for this girl [Antigone]” (693). We should keep in mind that Creon is related to Antigone through Oedipus, and so the town may 6 well view the affair as a family feud rather than a genuine matter of justice. If Creon were really still committed to maintaining civic order, he might drop the charges so as to placate the people. His personal vendetta against Antigone, however, trumps any such considerations. As Haemon points out, Creon’s willful attitude is childish (735) and has ceased to have any legitimate claim to be in the service of the civic good (737). Despite his lofty talk, Creon’s motivations at this point include little beyond personal spite and a desire to teach his son a lesson. Though he claims to act in service of the civic good alone, most of his effort seems to be directed towards “governing” his own family. Hegel’s remark is therefore perceptive. Neither Creon nor Antigone succeed in limiting their inter- eststothefamilyortothecity. Antigonefindsherselfisolatedandoccupiesthepublicstage,while Creon becomes embroiled in a petty family dispute. Although Antigone sees herself as fighting on thesideoftheunwrittenlawsoffamilialpietyagainstthecivictyrannyofCreon, herstruggleisat the same time an internal family dispute: Creon is, after all, her uncle. Likewise, although Creon sees himself as an upholder of civic order, quashing foolish upstarts in the name of the civic good, most of his effort is directed towards disciplining his own son and his niece. 2.2 Hegel on the political and familial spheres Hegel thinks that the Creon and Antigone’s inability to hold apart their private and public obliga- tions is not simply an artifact of their situation, but rather represents an actualisation of a deep tensionwhichexistsuniversallybetweenthefamilyandthepoliticalsphere. Hegelholdsthatfamil- ial and political duties inherently tend to pass over into one another and resist strict segregation. He makes the remarkable claim that all ethical conflicts are the particular expressions of this un- derlying instability in the separation of “the state, the general ethical life in the form of generality, and ethical life as subjectivity, as the family”.8 Hegel takes Antigone to be the most “complete” tragedy because it lays bare these “most pure forces” of ethical conflict (VPK, p. 280) To see why Hegel sees the ethical bind of Creon and Antigone to be an exemplar of a broad range of ethical conflicts, we need to examine Hegel’s theory of the family and the state. Hegel takes the defining characteristic of the family to be that family members belong to a single cohesive unit, held together in the first instance by loving relationships rather than legal duties (EPR, §158). The loving relationships that structure the family are not entered into by choice: Parents and children bond instinctively, and partners fall in love despite themselves. However, be- ing relationships between rational animals, these relationships cannot structure the lives of family 8His claim here seems to be about the source of all ethical conflict in tragedy, but the structure of the Philosophy of Right,whichsuggestshemightholdthisclaimtobegenerallytrue. NothinginmyargumenthangsonwhetherHegeltakes theclaimtobetruegenerally,orjusttrueofallconflictintragedy. 7 membersforlongbeforebeingbroughttoself-consciousawareness. Whenthishappens,lovingrela- tionships become formalized into legal contracts (EPR, §159). Partners get married, and children, when they become aware of themselves as members of a family, come to expect their parents to fulfil their duties of care. As this occurs, being a member of a family ceases to be a simple matter of being enveloped by familial love. Rather, the family comes to make a normative claim in its own right. In opposition to the rights that family members have as legal individuals, the right of the family consists in the right to refrain from entering into public life; as Hegel puts it “a right against externality and against stepping out of this unity [the family]” (EPR, addition to §159, translation modified). And yet, even for Hegel the family makes a kind of normative claim that is ultimately incoherent. By demandingthattheindividualswhomakeupthefamilyareallowedtoremainabsorbedinasingle loving unit, the family in effect demands that the individuals who make up the family be allowed not to be individuals at all. But family members, having become conscious of themselves as such, cannotsimplyrenouncetheirstatusasseparatebeings. Thisisnotonlyatheoreticalcontradiction, Hegel thinks, but one which plays itself out practically in the gradual dissolution of families (EPR, §173–§180). When children grow up, they leave the home, and as passions dampen, a marriage of lovemaybecomeoneofconvenience. Thebondsoffamiliallovebecomeeclipsedbythelegalrights that family members bear as individuals. Thisdoesnotmean,however,thatHegeltakesthedomainofcaring,altruisticrelationshipsextends only as far as the family. On the contrary, in Hegel claims that a society based purely on legal relationships is as incoherent as one based solely on the demands of love. He seems to have two principal reasons for this. Firstly, because we do not come into the worlds as fully self-conscious beings,weneedtobeinitiallyberearedbythefamilybeforewecanenterintopoliticalrelationships. Secondly, Hegel holds that relationships which treat subjects merely as abstract bearers of duties and rights (a condition he associated with the bourgeois society of his own day) fail to thereby treatrightsholdersassubjectsatall. Instead, Hegelthinksthatanylegalrelationshippresupposes that the interested parties recognize each other as members of a community with joint interests and mutual dignity, and that this recognition cannot itself be legally instituted. Ultimately, public institutionsmustaccommodateformsofnormativerelationshipswhichtreatsubjectsasmorethan just individuals, and include them in a way which resembles inclusion in the family.9 The upshot of this is that private and public life are, for Hegel, mutually interdependent and yet makeopposingdemandsuponindividuals. Thefamilypresupposesrelationshipsoflove,butmakes no room for the individuals between whom this love is supposed to exist, while the public sphere treats individuals as such, but does not provide for the preconditions of their recognition of one 9These claims stand in need of a more detailed argument, but see, e.g., Hegel’s discussion of the corporation in EPR §250–256forsomeexamplesofthesortsofclaimsIambasingthisreadingon. 8 another as individuals. The parental love which nourishes children in the family has its end in allowing children to grown into autonomous adults. But the more the family succeeds in rearing children who are independent individuals, the more it undermines its own existence as a principle of inclusion and absorption. Conversely, the legal institutions which allow subjects to retain their individual integrity only function in so far as individuals recognize one another as fellows in a community, and yet being an individual is a matter of recognizing oneself as essentially separate from others. This means that the both the separateness and the unity of family and state is inherently unstable. Thefamilyandthestatepresentthemselvesasopposingclaimsuponanindividual,andyetneither can exist without the other. This allows us to see why he might view the conflict of Antigone as exemplary of more pervasive form of conflict between the public and private spheres. To see in moredetailhowHegelmakestheconnection,weneedtoturntohisdiscussionoftragedyandsocial roles in the Phenomenology of Spirit. 2.3 Hegel on the ontology of social roles Hegel compares the ethical world depicted by tragedy to the “thing of many properties” (PhG, p. 328). Astheconsciousnessofabstract, sensualbeingpassesoverintoperception, soalsodoes the immediate certainty of real ethical [sittlichen] being; and just like simple being becomes a thing of many properties [Ding vieler Eigenschaften] for sense perception, so too in ethical perception does a given action become a reality [consisting] of multiple ethical relationships” (PhG 328, my emphasis; my translation). Hegel’s mention of the “thing of many properties” is a reference to the second chapter of the Phe- nomenology, “perception [Wahrnehmnung]”. There “consciousness” is engaged with understanding thenatureoftheobjectsofitsimmediateexperience. Atthispoint,consciousnesshasalreadyexpe- rienced the shortcomings of understanding its experience as a sequence of independent sensations, and now realizes that it must suppose the objects it perceives have persistent properties. It thus comes upon the empiricist idea that objects are collections of associated properties or ideas, which are separate and do not effect one another. Correspondingly, to perceive an object is to perceive all of the properties that constitute this one object: That to perceive a cube of salt, for instance, is just to perceive cubicity, sharpness of taste, whiteness, hereness, etc. “Thinghood as such,” on this view, simply becomes a matter of individually separate and distinct properties coexisting (ein einfaches Zusammen von vielen, PhG, p. 95). The view cannot explain 9 howthelistofpropertiesthatsupposedlyconstitutethissalt(white,sharptasting,cubicallyshaped, and …) is at once a single thing before me (ein einfaches Hier, PhG, p. 95). In other words, this view has no answer to the question “in virtue of what are these all properties of one single object?” This proves fatal to the view, since without this we lose our grip on what it means for properties to co-exist at all. If we have no account of what makes the colour, taste, shape and weight all properties of a single object, then there is no use in saying that a single object is a multiplicity of properties, since this gives us no grip on why one existing property any more a part of this object than another. What is wrong with this view, in other words, is that it fails to account for the fact that having access to these as an object of knowledge involves recognizing them to be properties of a single underlying thing. We experience various properties of a salt cube not just as a collection, but as relatedinvirtueoftheirinvolvementintheconstitutionofaunifiedobject: Theherenessperceived is the location of that which is white, which is the color of what tastes sharp, which is the taste of that which has a cubic shape, etc. Hence, to describe our knowledge of a salt cube as simply consisting in knowing a bundle of properties is to leave out the important sense in which these properties are expressions of an underlying unity. In transitioning to the Spirit chapter of the Phenomenology of Spirit, Hegel suggests that we are liable to commit a similar error in our attempt to grasp the nature of an “ethical world” (PhG, p.328). Whenwetrytograspasociety,wefirstnoticethemultiplicityofethicalrelationshipsthat it contains. But this multiplicity is parisitic on an underlying unity: Political life and the family can only be properly understood in terms of their relaitonship to one another. As regards Antigone, Hegel’s suggestion seems to be that Antigone and Creon treat their choice of roles as if one’s place in an ethical community were akin to an object conceived as a bundle of properties. Antigone’s certainty that she can cast off her civic duties for the sake of family piety, and Creon’s conviction that family virtues are totally subordinate to civic virtues, indicates that they imagine their choices of roles as: Antigone Creon Old role (incoherent) {Sister,Royal} {Uncle,King} New role (coherent) {Sister} {King} Yet Creon and Antigone’s roles are not well described by a simple list of royal offices and familial memberships. To do so would be to make the same error about their situation as we make when we try to think of a cube of salt as the collection of properties which characterizes it. The point of conflict is rather that they are in a single situation which places both familial and civic demands 10

See more

The list of books you might like