Logout succeed
Logout succeed. See you again!

HER2/neu-specific antibodies and methods of using same PDF
Preview HER2/neu-specific antibodies and methods of using same
US008802093B2 United States Patent (12) (10) Patent N0.: US 8,802,093 B2 Johnson et al. (45) Date of Patent: Aug. 12, 2014 (54) HER2/NEU-SPECIFIC ANTIBODIES AND 5,932,433 A 8/1999 Schatz METHODS OF USING SAME 5,945,115 A 8/1999 Dunn et a1. 5,985,599 A 11/1999 MckenZie et al. 6,019,968 A 2/2000 PlatZ et a1. (75) Inventors: Leslie S. Johnson, Damestown, MD 6,025,485 A 2/2000 Kamb et a1. (US); Ling Huang, Bethesda, MD (U S); 6,114,147 A 9/2000 Frenken et al. Nadine Tuaillon, Gettysburg, PA (US); 6,132,764 A 10/2000 Li et a1. Ezio Bonvini, Rockville, MD (US) 6,132,992 A 10/2000 Ledbetter et al. 6,165,745 A 12/2000 Ward et a1. (73) Assignee: MacroGenics, Inc., Rockville, MD (US) 6,180,370 B1 1/2001 Queen et al. 6,194,551 B1 2/2001 Idusogie et al. 6,218,149 B1 4/2001 Morrison et al. (*) Notice: Subject to any disclaimer, the term of this 6,242,195 B1 6/2001 Idusogie et al. patent is extended or adjusted under 35 6,277,375 B1 8/2001 Ward U.S.C. 154(b) by 642 days. 6,300,065 B1 10/2001 Kieke et a1. 6,339,069 B1 1/2002 Meers et a1. 6,420,149 B1 7/2002 Fukuda et a1. (21) Appl. No.: 12/933,885 6,423,538 B1 7/2002 Wittrup et a1. 6,455,263 B2 9/2002 Payan (22) PCT Filed: Mar. 25, 2009 6,472,511 B1 10/2002 Leung et a1. 6,528,624 B1 3/2003 Idusogie et al. (86) PCT No.: PCT/US2009/038201 6,538,124 B1 3/2003 Idusogie et al. 6,548,640 B1 4/2003 Winter 6,696,550 B2 2/2004 Larosa et al. (2), (4) Date: Jan. 11, 2011 6,737,056 B1 5/2004 Presta 6,800,738 B1 10/2004 Carter et a1. (87) PCT Pub. No.: WO2009/123894 6,821,505 B2 11/2004 Ward 6,982,321 B2 1/2006 Winter PCT Pub. Date: Oct. 8, 2009 7,315,786 B2 1/2008 Dahiyat et a1. (Continued) (65) Prior Publication Data FOREIGN PATENT DOCUMENTS US 2011/0097323 A1 Apr. 28, 2011 EP 0 327 378 8/1989 Related US. Application Data EP 0 332 865 9/1989 (60) Provisional application No. 61/041,649, ?led on Apr. (Continued) 2, 2008. OTHER PUBLICATIONS Stavenhagen et al (Cancer Research, 2007, 67:8882-8890).* (51) Int. Cl. Carter et al. (PNAS 89:4285-4289 (1992)).* A61K 39/395 (2006.01) NCBI protein sequence report (GenBank entry 1 FVEiA “Chain A, A61P 35/04 (2006.01) X-Ray Structures of the Antigen-Binding Domains From Three Vari C07K 16/28 (2006.01) ants of Humanized Anti-P185-Her2 Antibody 4d5 and Comparison (52) US. Cl. With Molecular Modeling” (Oct. 1, 2007)).* USPC ................. .. 424/133.1; 530/3871; 530/3873 US 6,331,391, 12/2001, Wittrup et al. (Withdrawn). (58) Field of Classi?cation Search Abra et al. The next generation of liposome delivery systems: recent experience with tumor-targeted, sterically- stabilized USPC ....................... .. 424/133, 1; 530/3871, 387.3 immunoliposomes and active-loading gradients. J Liposome Res. See application ?le for complete search history. Feb-May 2002;12(1-2):1-3. Alt et al., “Novel Tetravalent and Bispeci?c IgG-Like Antibody M01 (56) References Cited ecules Combining Single-Chain Diabodies With the Immunoglobin Gamma 1 F0 or CH3 Region,” FEBS Letters 454: 90-94, 1999. U.S. PATENT DOCUMENTS Altman et al., “Phenotypic Analysis ofAntigen-Speci?c T Lympho cytes”, Science 274:94-96, 1996. 4,179,337 A 12/1979 Davis et a1. 4,752,601 A 6/1988 Hahn (Continued) 5,024,835 A 6/1991 Rao et al. 5,225,539 A 7/1993 Winter Primary Examiner * Lynn Bristol 5,348,876 A 9/1994 Michaelsen et al. (74) Attorney, Agent, orFirm * William C. Schrot; Jeffrey I. 5,576,184 A 11/1996 Better et al. Auerbach; AuerbachSchrot LLC 5,585,089 A 12/1996 Queen et a1. 5,624,821 A 4/1997 Winter et al. (57) ABSTRACT 5,648,260 A 7/1997 Winter et al. This invention relates to antibodies that speci?cally bind 5,693,761 A 12/1997 Queen et a1. 5,693,762 A 12/1997 Queen et a1. HER2/neu, and particularly chimeric 4D5 antibodies to 5,698,449 A 12/1997 Baumann et al. HER2/neu, Which have reduced glycosylation as compared to 5,711,944 A 1/1998 Gilbert et al. known 4D5 antibodies. The invention also relates to methods 5,723,584 A 3/1998 Schatz of using the 4D5 antibodies and compositions comprising 5,736,135 A 4/1998 Goeddeletal. 5,736,137 A 4/1998 Anderson et al. them in the diagnosis, prognosis and therapy of diseases such 5,837,243 A 11/1998 Deo et al. as cancer, autoimmune diseases, in?ammatory disorders, and 5,874,239 A 2/1999 Schatz infectious disease. 5,877,396 A 3/1999 Ravetch et a1. 5,888,533 A 3/1999 Dunn 15 Claims, 11 Drawing Sheets US 8,802,093 B2 Page 2 (56) References Cited W0 WO 99/43713 9/1999 wo wo 99/51642 10/1999 U.S. PATENT DOCUMENTS W0 WO 99/58572 11/ 1999 wo wo 00/09560 2/2000 7,317,091 B2 1/2008 Lazar etal. W0 WO 00/42072 7/2000 7,355,008 B2 4/2008 Stavenhagen et a1. W0 WO 01/79299 10/2001 7,425,619 B2 9/2008 Koenig et a1. W0 WO 02/02781 1/2002 7,425,620 B2 9/2008 Koenig et a1. W0 W0 02/060919 8/2002 7,632,497 B2 12/2009 Stavenhagen W0 W0 02/086070 10/2002 7,655,229 B2 2/2010 Chan et al. W0 W0 03/035835 5/2003 7,662,925 B2 2/2010 Lazar etal. W0 W0 03/066095 8/2003 7,662,926 B2 2/2010 Chan et al. W0 W0 03/074679 9/2003 7,960,512 B2 6/2011 Stavenhagen et a1. W0 WO 2004/016750 2/2004 8,187,593 B2 5/2012 Koenig et a1. W0 WO 2004/029207 4/2004 8,193,318 B2 6/2012 Koenig et a1. W0 WO 2004/063351 7/2004 2001/0036459 A1 11/2001 Ravetch W0 WO 2004/065423 8/2004 2002/0004587 A1 1/2002 Miller et al. W0 WO 2004/074455 9/2004 2002/0028486 A1 3/2002 Morrison et a1. W0 WO 2004/099249 11/2004 2003/0077282 A1 4/2003 Bigler et al. W0 W0 Zoos/009545 1/2005 2003/0115614 A1 6/2003 Kanda et a1. W0 WO 2005/018669 3/2005 2003/0158389 A1 8/2003 Idusogie etal. W0 WO 2005/063815 7/2005 2003/0190319 A1 10/2003 Adolf et al. W0 WO 2005/070963 8/2005 2003/0207346 A1 11/2003 Arathoon etal. W0 WO 2005010474 11/2005 2004/0002587 A1 1/2004 Watkins et al. W0 W0 2005/1 15452 12/2005 2004/0110226 A1 6/2004 Lazar etal. W0 WO 2006/020114 2/2006 2004/0132101 A1 7/2004 Lazar etal. W0 WO 2006/028956 3/2006 2004/0185045 A1 9/2004 Koenig et a1. W0 WO 2006/066078 6/2006 2004/0191244 A1 9/2004 Presta W0 WO 2006/088494 8/2006 2004/0220388 A1 11/2004 Mertens et al. W0 W0 2006/1 13665 10/2006 2004/0235065 A1 11/2004 Hansen etal. W0 WO 2007/021841 2/2007 2004/0236078 A1 11/2004 Carter et al. W0 WO 2007/024249 3/2007 2005/0025764 A1 2/2005 Watkins et al. W0 W0 2007/ 106707 9/2007 2005/0037000 A1 2/2005 Stavenhagen et a1. W0 W0 Zoos/002933 V2008 2005/0054832 A1 3/2005 Lazar etal. W0 W0 Zoos/019199 2/2008 2005/0064514 A1 3/2005 Stavenhagen et a1. W0 W0 Zoos/105886 9/2008 2005/0090648 A1 4/2005 Tsurushita etal. W0 W0 Zoos/157379 12/2008 2005/0215767 A1 9/2005 Koenig et a1. W0 WO 2009083009 7/2009 2005/0260213 A1 11/2005 Koenig et a1. W0 WO 2009/151717 9/2009 2006/0013810 A1 1/2006 Johnson et al. W0 WO 2010/033279 3/2010 2006/0018899 A1 * 1/2006 Kao et al. ................. .. 424/133.1 2006/0024298 A1 2/2006 Lazar et al. . OTHER PUBLICATIONS . . 2006/0073142 A1 4/2006 Chan et al‘ Am1t et al. (1986) Three-dimensional structure of an antigen-anti 2006/0134709 A1 6/2006 Stavenhagen et 31‘ body complex at 2.8 A resolution; Science 233:747-753. 2006/0177439 A1 8/2006 Koenig et 31‘ Angal et al., “A single amino acid substitution abolishes the hetero 2007/0004909 A1 1/2007 Johnson et 31, geneity of chimeric mouse/human (IgG4) antibody,” Mol Immunol 2007/0036799 A1 2/2007 Stavenhagen et a1. 30 :105-108, 1993. 2007/0253948 A1 11/2007 Chan et al. Armour et al., “Differential binding to human chammaRIIa and zoos/0044417 A1 2/2008 1011115011 et al~ chammaRIIb receptors by human IgG Wildtype and mutant anti 2008/0050373 A1 2/2008 Cohen et 91- bodies,” Mol Immunol 40 :585-593, 2003. Zoos/0051563 Al 2/2008 Lazar et 31' Armour et al., “Recombinant human IgG molecules lacking Zoos/0131435 Al 6/2008 Stavenhagen et 31' chamma receptor I binding and monocyte triggering activities,” Eur 2008/0138344 A1 6/2008 Stavenhagen et a1. Jlmun012912613a624, 1999‘ 2008/0138349 A1 * 6/2008 Stavenhagen et a1. 424/144.1 Armour et al., “The contrasting IgG-binding interactions of human 2008/0286819 A1 11/2008 Ravetch et a1. and herpes simplex virus Fc receptors,” Biochemical Society Trans 2009/0053218 A1 2/2009 Koenig et a1. actions 30:495-500, 2002. Armstrong, S. et al. “Heterogeneity of IgG1 monoclonal anti-Rh(D): FOREIGN PATENT DOCUMENTS an investigation using ADCC and macrophage binding assays,” Brit. J. Haematol. 66:257-262 (1987). EP 0 629 703 12/1994 Bachmann et al. (2005) “Recall Proliferation of Memory CD8+ T EP 0 359 096 11/1997 Cells and Antiviral Protection,” J. Immunol. 17514677-4685. EP 0 953 639 11/1999 Baggiolini M, Dewald B. “Cellular models for the detection and EP 1 006 183 6/2000 EP 0 343 950 10/2000 evaluation of drugs that modulate human phagocyte activity,” W0 WO 88/07089 9/1988 Experientia. Oct. 15,44(10):84l-848, 1988. W0 WO 89/07142 8/1989 Bendas G, Immunoliposomes: a promising approach to targeting W0 WO 92/16562 10/1992 cancer therapy. BioDrugs. 2001; 15(4):215-24. W0 WO 93/22332 11/1993 Bernard et al. (1986) “A unique epitope on the CD2 molecule de?ned W0 WO 94/18330 8/1994 by the monoclonal antibody 9-1: epitope-speci?c modulation of the W0 WO 94/29351 12/1994 E-rosette receptor and effects on T-cell functions,” Hum. Immunol. W0 WO 95/05468 2/1995 l7(4):388-405. W0 WO 97/28267 8/1997 Bewarder et al., 1996, “In vivo and in vitro speci?city of protein W0 WO 97/34631 9/1997 tyrosine kinases for immunoglobulin G receptor (chammaRII) W0 WO 97/44362 11/1997 phosphorylation,” Mol. Cell. Biol. 16 (9)14735-43. W0 WO 98/05787 2/1998 W0 WO 98/23289 6/1998 Billadeau et al., ITAMs versus ITIMs: striking a balance during cell W0 WO 98/52975 11/1998 regulation, J Clin Invest. Jan 2002;109(2): 161-8. W0 WO 99/19362 4/1999 Boder and Wittrup, “Optimal screening of surface-displayed W0 WO 99/41285 8/1999 polypeptide libraries,” Biotechnol Prog 14:55-62, 1998. US 8,802,093 B2 Page 3 (56) References Cited Campbell et al. (2003) “Monoclonal antibody therapy for lymphoma,” Blood Rev. 17(3): 143-152. OTHER PUBLICATIONS Can?eld and Morrison, “The binding af?nity of human IgG for its high af?nity Fc receptor is determined by multiple amino acids in the Boder and Wittrup, “Yeast surface display for directed evolution of CH2 domain and is modulated by the hinge region,” J Exp Med protein expression, af?nity, and stability,” Methods in Enzymology 173:1483-1491, 1991. 328:430-444, 2000. Caron et al., “Engineered humanized dimeric forms of IgG are more Boder and Wittrup, 1997, “Yeast surface display for screening effective antibodies,” J Exp Med 176 :1191-5, 1992. combinatorial polypeptide libraries”, Nature Biotechnology 15:553 Carter et al., “Humanization of an anti-p185HER2 antibody for human 557. cancer therapy,” Proc. Natl. Acad. Sci. USA 89:4285-4289, 1992. Boder et al., “Directed evolution of antibody fragments with Cartron et al., “Therapeutic activity of humanized anti-CD20 monovalent femtomolar antigen-binding af?nity,” Proc. Natl. Acad. monoclonal antibody and polymorphism in IgG Fc receptor cham Sci. USA 97: 10701-10705, 2000. maRIIIa gene,” Blood 99 :754-758, 2002. Bolland and Ravetch., Inhibitory pathways triggered by ITIM-con Cassard et al., Modulation of tumor growth by inhibitory Fc.gamma. taining receptors. Adv Immunol. 1999;72:149-177. receptor expressed by human melanoma cells. The J Clin Invest. Nov. Bolland et al., Genetic modi?ers of systemic lupus erythematosus in 2002;110(10):1549-1557. Fc.gamma.RIIB(—/—) mice. J Exp Med. May 6, 2002;195(9):1167 Casset et al. (2003) A peptide mimetic of an anti-CD4 monoclonal 74. antibody by rational design, Biochem. Biophs. Res. Commun. Boruchov et al., “Expression and Modulation of the Inhibitory Fcy 307:198-205. Receptor, FcyRIIB (CD32B), on Human Dendritic Cells (DCs),” Cavacini et al. (1995) “In?uence of heavy chain constant regions on Blood 102(11):Abstract #1908, 2003. antigen binding and HIV-1 neutralization by a human monoclonal Boruchov et al., Activating and inhibitory IgG Fc receptors on human antibody,” J Immunol. 155(7):3638-3644. DCs mediate opposing functions. The Journal of Clinical Investiga Chappel et al., “Identi?cation of a secondary Fc gamma RI binding tion 115; 10:2914-2923, (Oct. 2005). site within a genetically engineered human IgG antibody,” J Biol. Boyer et al. (1999) “Relative cytotoxic activity of immunotoxins Chem 268:25124-25131, 1993. reactive with different epitopes on the extracellular domain of the Chappel et al., “Identi?cation of the Fc gamma receptor class I c-erbB-2 (HER-2/neu) gene product p185,” Int. J. Cancer. 82(4):525 binding site in human IgG through the use of recombinant IgGl/ IgG2 hybrid and point-mutated antibodies,” Proc. Natl. Acad. Sci USA 531 . Brauweiler et al., Partially distinct molecular mechanisms mediate 88:9036-9040, 1991. inhibitory Fc.gamma.RIIB signaling in resting and activated B cells. Chattergee et al. (1994) “Idiotypic Antibody Immunotherapy of Can J Immunol. 2001;167:204-211. cer,” Cancer Immuno. Immunother. 38:75-82. Bredius et al., “Role of neutrophil Fc gamma RIIa (CD32) and Fc Chen, et al. (1999) “Selection and Analysis of an Optimized Anti gamma RIIIb (CD16) polymorphic forms in phagocytosis of human VEGF Antibody: Crystal Structure of an Af?nity-Matured Fab in IgG1- and IgG3-opsonized bacteria and erythrocytes,” Immunology Complex with Antigen,” J. Molec. Biol. 293:865-881. 83:624-630, 1994. Ciccimarra et al., “Localization of the IgG effector site for monocyte Brekke et al., “Human IgG isotype-speci?c amino acid residues receptors,” Proc. Natl. Acad. Sci. USA. 72 :2081-2083, 1975. affecting complement-mediated cell lysis and phagocytosis,” Eur J Clynes and Ravetch, “Cytotoxic antibodies trigger in?ammation Immunol 24:2542-2547, 1994. through Fc receptors,” Immunity 3:21-26, 1995. Brown (2001) “Factors Modifying the Migration of Lymphocytes Clynes et al., “Fc receptors are required in passive and active immu Across the Blood-Brain Barrier,” Int Immunopharmacol. Nov. nity to melanoma,” Proc. Natl. Acad. Sci USA 95:652-656, 1998. 2001;1(12):2043-62. Clynes et al., “Inhibitory Fc receptors modulate in vivo cytoxicity Brown EJ., “In Vitro Assays of Phagocytic Function of Human against tumor targets,” Nature Medicine 6 :443 -446, 2000. Peripheral Blood Leukocytes: Receptor Modulation and Signal Clynes et al., “Modulation of immune complex-induced in?amma Transduction,” vol. 45 (Microbes as Tools for Cell Biology) in Meth tion in vivo by the coordinate expression of activation and inhibitory ods in Cell Biololgy, Russell ed. Academic Press Inc. pp. 147-164, Fc receptors,” J Exp Med 189:179-185, 1999. 1994. Clynes et al., “Uncoupling of immune complex formation and kidney Budde et al., Speci?city of CD32 mAB for Fc.gamma.RIIa, Fc.gam damage in autoimmune glomerulonephritis,” Science 279: 1052 ma.RIIb1, and Fc.gamma.RIIb2 expressed in transfected mouse B 1054, 1998. cells and BHK-21 cells. Leukocyte Typing V: White cell differentia Colman, PM. (1994) “Effects of amino acid sequence changes on tion antigens. 1995;828-832 (Schlossman, Boumsell, Gilks, Harlan, antibody-antigen interactions,” Res. Immunol. 145:33-36. Kishomoto, eds.). Daeron et al., The Same Tyrosine Based Inhibition Motif, in the Burgess et al. (1990) “Possible dissociation of the heparin-binding Intracytoplasmic Domain of Fc.gamma.RIIB, regulates negatively and mitogenic activities of the heparin-binding (acidic ?broblast) BCR, TCR- and FcR dependent cell activation. Immunity Nov. growth factor-1 from its receptor binding activities by site directed 1995;3: 635-646. mutagenesis ofa single lysine residue,” J. Cell Biol. 111:2129-2138. Daeron (1997) “Fc Receptor Biologoy” Annu. Rev. Immunol. Burmeister et al., “Crystal structure of the complex of rat neonatal Fc 15 :203-34. receptor with Fc,” Nature 372:379-3 83, 1994. Damle et al., B-cell chronic lymphocytic leukemia cells express a Burton and Woof, “Human antibody effector function,” Advances in surface membrane phenotype of activated, antigen-experienced B Immunology 51:1-84, 1992. lymphocytes. Blood Jun. 1, 2002;99(11):4087-4093. Burton et al., “Molecular recognition of antibody (IgG) by cellular Fc Davies et al. (1995)AntibodyVH domains as small recognition units, receptor (FcRI),” Mol Immunol 25:1175-1181, 1988. Bio/Technology 13:475-479. Burton, “Immunoglobulin G: functional sites,” Mol Immunol Davies et al., Expression of GnTIII in arecombinant anti-CD20 CHO 22: 161-206, 1985. production cell line: Expression of antibodies with altered Callanan et al., The IgG Fc Receptor, Fc.gamma.RIIB is a target for glycoforms leads to an increase in ADCC through higher af?nity for deregulation by chromosomal translocation in malignant lymphoma. Fc.sub..gamma. RIII. Biotechnol Bioeng. Aug. 20, 2001;74(4):288 PNAS. Jan. 2000;97(1):309-314. 94. Cameron et al., Differentiation of the human monocyte cell line, de Haas, Wien Kin “IgG-Fc receptors and the clinical relevance of U937, with dibutyryl cyclicAMP induces the expression of the their polymorphisms,” Wien Klin Wochenscha 113:825-831, 2001. inhibitory Fc receptor, Fc.gamma.RIIb. Immunol Lett. Oct. 1, De Santes et al. (1992) “Radiolabeled Antibody Targeting of the 2002;83(3):171-9. Her-2/neu Oncoprotein,” Cancer Res. 52:1916-1923. Camilleri-Broet et al., Fc.gamma.RIIB is differentially expressed Ding et al., Inhibition of the function of the Fc.gamma.RIIB by a during B cell maturation and in B-cell lymphomas. Br J Haematol. monoclonal antibody to thymic shared antigen-1, a Ly-6 family anti 2004;124(1):55-62. gen. Immunology. Sep. 2001;104(1):28-36. US 8,802,093 B2 Page 4 (56) References Cited Herzenberg et al., “The history and future of the ?uorescence acti vated cell sorter and ?ow cytometry: a view from Stanford,” Clinical OTHER PUBLICATIONS Chem. 2002;48:1819-1827, 2002. Heyman, “Regulation of antibody responses via antibodies, comple Dumoulin et al. (2002) Single-domain antibody fragments with high ment, and Fc receptors,” Annu Rev Immunol 18:709-737, 2000. conformational stability, Protein Science 11:500-512. Hogarth et al., “Characterization of FcR Ig-binding sites and epitope Duncan and Winter, “Localization of the binding site for the human mapping,” Immunomethods 4 :17-24, 1994. high-af?nity Fc receptor on IgG,” Nature 332:563-564, 1988. Holler et al., “In vitro evolution of a T cell receptor with high af?nity Duncan and Winter, “The binding site for Clq on IgG,” Nature 332 for peptide/MHC,” Proc. Natl. Acad. Sci. USA. 97 :5387-92, 2000. :738-740, 1988. Holliger, P. (1993) “Diabodies: Small bivalent and bispeci?c anti Edberg et al., “Modulation of chamma and Complement Receptor body fragments,” Proc. Natl. Acad. Sci. (USA) 90(14):6444-6448. Function by the Glycosyl-Phosphatidylinositol-Anchored Form of Holm et al, (2007) “Functional Mapping and Single Chain Construc chammaRIII,” Journal of Immunology 152: 5826-5835, 1994. tion of the Anti-Cytokeratin 8 Monoclonal Antibody TS 1 ,” Molecu Efferson et al. (2005) “Stimulation of Human T Cells by an In?uenza lar Immunology 44:1075-1084. A Vector Expressing a CTL Epitope from the HER-2/neu Holmes et al., Alleles of the Ly-17 alloantigen de?ne polymorphisms Protooncogene Results in Higher Numbers of Antigen Speci?c of the murine IgG Fc receptor. Proc Natl Acad Sci USA. Nov. TCRhi Cells than Stimulation with Peptide,” Anticancer Research 1985;82(22):7706-10. 25 : 7 1 5-724. Holt, L.J. (2003) “Domain Antibodies: Proteins for Therapy,” Eigenbrot et al. (1993) “X-ray Structures of the Antigen-binding TRENDS in Biochemistry 21(11)484-490. Domains from Three Variants of Humanized anti-p185HER2 Antibody Hulett et al., “Chimeric Fc receptors identify functional domains of 4D5 and Comparison with Molecular Modeling,” J. Mol. Biol. the murine high af?nity receptor for IgG,” J Immunol 147 :1863 229(4):969-995. 1 868, 199 1 . Ellman, J. et al. “Biosynthetic Method for Introducing Unnatural Hulett et al., “Identi?cation of the IgG binding site of the human low Amino Acids Site-Speci?cally into Proteins,” Methods Enzyrnol. af?nity receptor for IgG Fc gamma RII. Enhancement and ablation of 202:301-336, 1991. binding by site-directed mutagenesis,” J. Biol. Chem. 269:15287 Eppstein et al., Biological activity of liposome-encapsulated murine 15293, 1994. interferon .gamma. is mediated by a cell membrane receptor. Proc Hulett et al., “Multiple regions of human Fc gamma RII (CD32) Natl Acad Sci U S A. Jan. 1985;82(11):3688-9. contribute to the binding of IgG,” J. Biol. Chem. 270:21188-21194, Fanger et al., Production and use of anti-FcR bispeci?c antibodies. 1995. Immunomethods. Feb. 1994;4(1):72-81. Hwang et al., Hepatic uptake and degradation of unilamellar Farag, et al., Fc.gamma.RIIIa and Fc.gamma.RIIIa polymorphisms sphingomyelin/cholesterol liposomes: a kinetic study. Proc Natl do not predict response to Rituximab in B-cell chronic lymphocytic Acad Sci U S A. Jul. 1980;77(7):4030-4. leukemia. Blood. Oct. 16, 2003 (15 pp.). Ibragimova et al. (1999) “Stability of the beta-sheet of the WW Fidler, I. J ., Macrophages and metastasisia biological approach to domain: A molecular dynamics simulation study,” Biophys. J. cancer therapy. Cancer Res. Oct. 1985;45(10):4714-26. 77(4):2191-2198. Fleit et al., 1995 “Cross-linking of mAb to Fc.gamma.RII results in Idusogie et al., “Engineered antibodies with increased activity to tyrosine phosphorylation of multiple polypeptides including recruit complement,” J Immunol 166 :2571-2575, 2001. FC.gamma.RII itself.” Leukocyte Typing V: White cell differentia Idusogie et al., “Mapping of the Clq binding site on rituxan, a tion antigens 826-827 (Schlossman, Boumsell, Gilks, Harlan, chimeric antibody with a human IgG1 Fc,” J Immunol 164: 4178 Kishomoto, eds.). 4184, 2000. Flesch and Neppert, “Functions of the Fc receptors for Isaacs et al., “A therapeutic human IgG4 monoclonal antibody that immunoglobulin G,” J Clin Lab Anal 14: 141-156, 2000. depletes target cells in humans,” Clin Exp Immunol 106 :427-433, Gamberale et al., 2003, “To the Editor: Expression of Fc.gamma. 1996. receptors type II (Fc.gamma.RII) in chronic lymphocytic leukemia B Isaacs et al., “Therapy with monoclonal antibodies. An in vivo model cells.” Blood (Correspondence) 102(7):2698-2699. for the assessment of therapeutic potential,” J Immunol 148 :3062 Gerber et al., Stimulatory and inhibitory signals originating from the 3071, 1992. macrophage Fc.gamma. receptors. Microbes Infect. Feb. Isaacs et al., “Therapy with monoclonal antibodies. II. The contribu 2001;3(2):131-9. tion of Fc gamma receptor binding and the in?uence of C(H)1 and Gergeley et al., “Fc receptors on lymphocytes and K cells,” Bio C(H)3 domains on in vivo effector function,” J Immunol 161 :3862 chemical Society Transactions 12:739-743, 1984. 3869, 1998. Gergely and Sarmay, “The two binding-site models of human IgG Jain et al. “Barriers to Drug Delivery in Solid Tumors,” Scienti?c binding Fc gamma receptors,” FASEB J 4:3275-3283, 1990. American Jul. 1994:58-65. Greenwood and Clark, Effector functions of matched sets of recom Jassal et al., “Remodeling glycans on IgG by genetic re-engineering,” binant human IgG subclass antibodies. (?nal version edited Feb. 11, Biochem Soc Trans 26 :S113, 1998. 1993). Jefferis and Lund, “Interaction sites on human IgG-Fc for cham Greenwood et al., “Engineering multiple-domain forms of the thera maR: current models,” Immunology Letters 82 :57-65, 2002. peutic antibody CAMPATH-lH: effects on complement lysis,” Jefferis et al., “IgG-Fc-mediated effector functions: molecular de? Therapeutic Immunology 1:247-255, 1994. nition of interaction sites for effector ligands and the role of Greenwood et al., “Structural motifs involved in human IgG antibody glycosylation,” Immunol Rev 163:59-76, 1998. effector functions,” Eur J Immunol 23: 1098-1 104, 1993. J efferis et a1 ., “Molecular de?nition of interaction sites on human IgG Gura (1997) “Systems for Identifying New Drugs Are Often Faulty,” for Fc receptors (hch gamma R),” Mol Immunol 27 :1237-1240, Science 278:1041-1042. 1990. Hadley et al., “The functional activity of Fc gamma RII and Fc Jefferis et al., “Recognition sites on human IgG for Fc gamma recep gamma RIII on subsets of human lymphocytes,” Immunology tors: the role of glycosylation,” Immunol Lett 44 :111-7, 1995. 76:446-451, 1992. Jendeberg et al., “Engineering of Fc(1) and Fc(3) from human Hatta et al., “Association of Fc gamma receptor IIIB, but not of Fc immunoglobulin G to analyse subclass speci?city for staphylococcal gamma receptor IIA and IIIA polymorphisms with systemic lupus protein A,” J Immunological Methods 201 :25-34, 1997. erythematosus in Japanese,” Genes and Immunity 1:53-60, 1999. Jiang et al. (Epub Nov. 9, 2004) “A novel peptide isolated from a Hayes, Fc Engineering to Enhance Monoclonal Antibody Effector phage display peptide library with trastuzumab can mimic antigen Functions. (Presentation) Xecor, CA, 2003. epitope of HER-2,” J Biol Chem. 280(6):4656-4662. Henry et al. (2004) “A prostate-speci?c membrane antigen-targeted Kadar et al., “Modulatory effect of synthetic human IgG Fc peptides monoclonal antibody-chemotherapeutic conjugate designed for the on the in vitro immune response of murine spleen cells,” Int J treatment ofprostate cancer,” Cancer Res. 64(21):7995-8001. Immunpharmacol 13 :1147-55, 1991. US 8,802,093 B2 Page 5 (56) References Cited Li et al. (2007) Regeneration of nigrostriatal dopaminergic axons by degradation of chondroitin sulfate is accompanied by elimination of OTHER PUBLICATIONS the ?brotic scar and glia limitans in the lesion site. J. Neurosci. Res. 85:636-547. Kadar et al., “Synthetic peptides comprising de?ned sequences of Li et al., “Reconstitution of human Fc gamma RIII cell type speci CH-2 and CH-3 domains of human IgGl induce prostaglandin E2 ?city in transgenic mice,” J Exp Med 183 11259-1263, 1996. production from human peripheral blood mononuclear cells,” Lifely et al., Glycosylation and biological activity of CAMPATH-lH Immunol Left 32:59-63, 1992. expressed in different cell lines and grown under different culture Kagari et al., Essential Role of Fc.gamma. Receptors in anti-type II conditions. Glycobiology. Dec. l995;5(8):813-22. collagen antibody induced arthritis. J. Immunol. Apr. Lin et al., Colony-stimulating factor I promotes progression of mam 2003;170:4318-24. mary tumors to malignancy. J Exp Med. 2001;193(6):727-739. Kang, C.Y. et al. (1988) “Inhibition of Self-Binding Antibodies Lin et al., The macrophage growth factor CSF-l in mammary gland (Autobodies) by a VH-Derived Peptide,” Science 240(4855)11034 development and tumor progression. J Mammary Gland Biol 1036. Neoplasia. 2002;7(2): 147-62. Kato et al., “Structural basis of the interaction between IgG and Fcy receptors,” J Mol Biol 295:213-224, 2000. Liu et al., “Production of a mouse-human chimeric monoclonal anti Keler et al., “Differential effect of cytokine treatment on Fc alpha body to CD20 with potent Fc-dependent biologic activity,” J. receptor 1- and Fc gamma receptor I-mediated tumor cytotoxicity by Immunol 13913521-3526, 1987. monocyte-derived macrophages,” J. of Immunol. 16415746-52, Looney et al., 1986, “Human Monocytes and U(#& Cells Bear Two 2000. Distinct Fc Receptors for IgG.” J. Immunol. l36(5):l64l-l647. Kepley et al. “Co-aggregation of chammaRII with FcepsilonRI on Lu, D. et al. (2003) “Di-Diabody: A Novel Tetravalent Bispeci?c human mast cells inhibits antigeninduced secretion and involves Antibody Molecule by Design.” J. Immunol. Meth. 279: 219-232. SHIP-Grb2-Dok complexes” J. Biol. Chem. 279(34) 35139-35149, Lu et al. (2004) “The effect of variable domain orientation and (Aug. 20, 2004). arrangement on the antigen-binding activity of a recombinant human Kieke et al., “Selection of functional T cell receptor mutants from a bispeci?c diabody,” doi: l’0.lOl6/j./bbre.2004.04.060. yeast surface-display library,” Proc. Natl. Acad. Sci. USA. 96 15651 Lund et al., “Expression and characterization of truncated forms of 56, 1999. humanized L243 IgGl . Architectural features can in?uence synthesis Kim et al. (2002) “Both the epitope speci?city and isotype are impor of its oligosaccharide chains and affect superoxide production trig tant in the antitumor effect of monoclonal antibodies against Her-2/ gered through human chamma receptor I,” Eur J Biochem 267 neu antigen,” Int. J. Cancer. 102(4):428-434. :7246-57, 2000. Kim et al., “Analysis of FcyRIII and IgG Fc polymorphism reveals Lund et al., “Human Fc gamma RI and Fc gamma RII interact with functional and evolutionary implications of protein-protein interac distinct but overlapping sites on human IgG,” J Immunol 147 12657 tion,” J Mol Evol 5311-9, 2001. 62, 1991. Kimura et al. (1981) “A new mouse cell-surface antigen (Ly-m20) Lund et al., “Multiple binding sites on the CH2 domain of IgG for controlled by a gene linked to Mls locus and de?ned by monoclonal mouse Fc gamma RII,” Molecular Immunology 29:53-59, 1992. antibodies,” Immunogenetics. l4(l-2):3-l4. Lund et al., “Multiple interactions of IgG with its core oligosac Kipps et al. (1985) “Importance of Immunoglobin Isotype in Human charide can modulate recognition by complement and human Fc Antibody-Dependent, Cell-Mediated Cytotoxicity Directed by gamma receptor I and in?uence the synthesis of its oligosaccharide Murine Monoclonal Antbodies,” J. Exper. Med. l6l:l-l7. chains,” J Immunol 157 :4963-4969, 1996. Klein et al., “Expression of biological effector functions by Lund et al., “Oligosaccharide-protein interactions in IgG can modu immunoglobulin G molecules lacking the hinge region,” Proc. Natl. late recognition by Fc gamma receptors,” FASEB J 9 1115-1 19, 1995. Acad. Sci. USA. 78 1524-528, 1981. Lyden et al., The Fc receptor for IgG expressed in the villus Koene et al., “Fc gammaRIIIa-158V/F polymorphism in?uences the endothelium of human placenta is Fc.gamma. RIIb2. J Immunol. binding of IgG by natural killer cell Fc gammaRIIIa, independently Mar. 15, 2001;166(6):3882-9. of the Fc gammaRIIIa-48L/IUH phenotype,” Blood 90 11109-1 l 14, MacCallum et al. (1996) “Antibody-Antigen Interactions: Contact 1997. Analysis and Binding Site Topography,” J. Molec. Biol. 2621732 Kranz et al., “Mechanisms of ligand binding by monoclonal anti 745. ?uorescyl antibodies,” J. Biol. Chem. 257:6987-6995, 1982. Maenaka et al., “The human low af?nity chamma receptors 11a, 11b, Kumar et al. (1991) “Regulation of phosphorylation of the c-erbB and III bind IgG with fast kinetics and distinct thermodynamic prop 2/HER2 gene product by a monoclonal antibody and serum growth erties,” J Biol Chem 48 :44898-904, 2001. factor(s) in human mammary carcinoma cells,” Mol. Cell. Biol. Malbec et al., ch receptor I-associated lyn-dependent phosphoryla ll(2):979-986. tion of Fc.gamma. receptor IIB during negative regulation of mast Kumpel, B.M. Brit. “Human monoclonal anti-D antibodies,” J. cell activation. J Immunol. Feb. 15, l998;l60(4):l647-58. Haematol. 71:415-420 (1989). Maresco et al.., 1999, “The SH2-Containing 5‘-Inositol Phosphatase Kurlander et al., 1986, “Comparison of intravenous gamma globulin (SHIP) Is Tyrosine Phosphorylated after Fc.gamma. Receptor Clus and a monoclonal anti-Fc receptor antibody as inhibitors of immune tering in Monocytes.” J. Immunol. 16216458-6465. clearance in vivo in mice.” J. Clin. Invest. 77(6):2010-2018. Maruyama K, In vivo targeting by liposomes. Biol Pharm Bull. Jul. Lazar et al. (1988) Transforming growth factor a: mutation of aspartic 2000;23(7):79l-9. acid 47 and leucine48 results in different biological activities, Molec. Masui et al. (1986) “Mechanism of antitumor activity in mice for Cell. Biol. 811247-1252. anti-epidermal growth factor receptor monoclonal antibodies with Le Gall, F. et al. (Epub May 4, 2004) “Effect of Linker Sequences different isotypes.,” Canc. Res. 46:5592-5598. Between the Antibody Variable Domains on the Formation, Stability McDevitt et al. “An alpha-particle emitting antibody ([213Bi]J59l) and Biological Activity of a Bispeci?c Tandem Diabody,” Protein for radioimmunotherapy of prostate cancer. ,” Cancer Res. Eng Des Sel. l7(4):357-366. 60(21):6095-6100, (Nov. 1,2000). Lehmann et al., “Phagocytosis: measurement by ?ow cytometry,” J Melero et al. (1998) The frequent expansion of a subpopulation of B Immunol Methods. 243(1-2):229-42, 2000. cells that express RF-associated cross-reactive idiotypes: evidence Lehrnbecher et al., “Variant genotypes of the low-af?nity chamma from analysis of a panel autoreactive monoclonal antibodies; Scand. receptors in two control populations and a review of low-af?nity J. Immunol. 48:152-158 1998. chamma receptor polymorphisms in control and disease popula Metcalfe, Mast Cells, Physiol Rev. Oct. l997;77(4)11033-79. tions,” Blood 94:4220-4232, 1999. Michaelsen et al., “One disul?de bond in front of the second heavy Lewis et al. (1993) “Differential responses of human tumor cell lines chain constant region is necessary and suf?cient for effector func to anti-pl85HER2 monoclonal antibodies,” Cancer Immunol tions of human IgG3 without a genetic hinge,” Immunolgy 91 19243 Immunother. 37(4):255-263. 9247, 1994. US 8,802,093 B2 Page 6 (56) References Cited Pettersen et al. (1999) “CD47 Signals T Cell Death,” J. Immunol. 162(12):7031-7040. OTHER PUBLICATIONS Pluckthun, A. et al. (1997) “New protein engineering approaches to multivalent and bi speci?c antibody fragments,” Immunotechnology Micklem et al., Different isoforms of human FcRII distinguished by 3(2):83-105. CDw32 antibodies. J Immunol. Mar. 1990;144:2295-2303. Polson, A.G. et al. (Epub Mar. 20, 2007) “Antibody-Drug Conjugates Morgan et al., “The N-terminal end of the CH2 domain of chimeric Targeted to CD79 for the Treatment of Non-Hodgkin Lymphoma,” human IgG1 anti-HLA-DR is necessary for Clq, Fc gamma RI and Fc Blood. 110(2):616-623. gamma RIII binding,” Immunology 86 :319-324, 1995. Presta LG, Engineering antibodies for therapy. Curr Pharm Morrison et al., “Structural determinants of IgG structure,” Immu Biotechnol. Sep. 2002;3(3):237-56. nologist 2 :119-124, 1994. Presta, L.G. et al. (2005) “Selection, Design and Engineering of Munn et al., “Phagocytosis of tumor cells by human monocytes Therapeutic Antibodies,” J. Allergy Clin. Immunol. 1 16(4):731-736. cultured in recombinant macrophage colony-stimulating factor,” J Presta et al. (2002) “Engineering therapeutic antibodies for improved Exp Med. 172(1):231-7, 1990. function,” Biochem. Soc. Thrans. 30(4):487-490. Nagarajan et al., “Ligand binding and phagocytosis by CD16 (Fc Pricop et al., differential modulation of stimulatory and inhibitory gamma receptor III) isoforms. Phagocytic signaling by associated Fc.gamma. receptors on human monocytes by Th1 and Th2 zeta and gamma subunits in Chinese hamster ovary cells,” J Biol cytokines. J Immunol. Jan. 1, 2001;166(1):531-7. Chem 270 :25762-25770, 1995. Pulford et al., 1995 “M65: The immunocytochemical distribution of Nakamura et al., Fc.gamma. receptor IIB-de?cient mice develop CD16, CD32, and CD64 antigens.” Leukocyte Typing V: White cell Goodpasture’s Syndrome upon immunization with Type IV col differentiation antigens 817-821 (Schlossman, Boumsell, Gilks, lagen: a novel murine model for Autoimmune Glomerular Basement Harlan, Kishomoto, eds.) pp. 817-821. Membrane Disease. J. Exp. Med. Mar. 6, 2000;191(5):899-905. Pulford et al., A new monoclonal antibody (KB61) recognizing a Nakamura et al. (2005) “Fc receptor targeting in the treatment of novel antigen which is selectively expressed on a subpopulation of allergy, autoimmune diseases and cancer,” Expert Opin. Ther. Targets human B lymphocytes. Immunology. Jan. 1986;57(1):71-6. 9(1):169-190. Qin et al., Fc.gamma. receptor IIB on follicular dendritic cells regu Neuberger et al., “Recombinant antibodies possessing novel effector lates the B cell recall response. J Immunol. 2000;164:6268-6275. functions,” Nature 312 :604-608, 1984. Radaev and Sun, “Recognition of immunoglobulins by chamma Norderhaug et al., “Chimeric mouse human IgG3 antibodies with an receptors,” Molecular Immunology 38 :1073-1083, 2001. IgG4-like hinge region induce complement-mediated lysis more ef? Rankin, et al. CD32B, the human inhibitory Fc-y receptor IIB, as a ciently than IgG3 with normal hinge,” Eur J Immunol 21:2379-84, target for monoclonal antibody therapy of B-cell lymphoma, Blood 1991 . Journal, Oct. 1, 2006, vol. 108, No. 7 pp. 2384-2391. Noren, C.J. et al. “A General Method for Site-Speci?c Incorporation Ravetch and Bolland, “IgG Fc receptors,” Annu Rev Immunol of Unnatural Amino Acids into Proteins,” Science 244:182-188, 1989. 191275-90, 2001. Norris et al., A naturally occurring mutation in Fc.gamma.RIIA: A Q Ravetch and Clynes, “Divergent roles for Fc receptors and comple to K.sup.127 change confers unique IgG binding properties to the ment in vivo,” Annu Rev Immunol 16:421-432, 1998. R. sup.131 allelic form of the receptor. Blood. Jan. 15, Ravetch and Kinet, “Fc receptors,” Annu Rev Immunol 9:457-492, 1998;91(2):656-662. 1991. Nose and Leanderson, “Substitution of asparagine324 with aspartic Ravetch et al., Fc receptors: rubor redux. Cell. Aug. 26, acid in the Fc portion of mouse antibodies reduces their capacity for 1994;78(4):553-60. Clq binding,” Eur J Immunol 19 :2179-81, 1989. Ravetech and Lanier, “Immune inhibitory receptors,” Science Okazaki et al., “Fucose depletion from human IgG1 oligosaccharide 290:84-89, 2000. enhances binding enthalpy and association rate between IgG1 and Reali et al., IgEs targeted on tumor cells: therapeutic activity and chammaRIIIa,” J Mol Biol 336 :1239-1249, 2004. potential in the design oftumor vaccines. Cancer Res. 2001;61(14): Orfao and Ruiz-Arguelles, “General concepts about cell sorting tech 5 517-22. niques,” Clinical Biochem. 29:5-9, 1996. Redpath et al., “The in?uence of the hinge region length in binding of Ott et al., Downstream of Kinase, p62.sup.dok, Is a mediator of human IgG to human chamma receptors,” Hum Immunol 59 :720 Fc.gamma.RIIB inhibition of Fc.epsilon.RI signaling. J. of Immunol. 727, 1998. 2002;168:4430-9. Reff et al., “A review of modi?cations to recombinant antibodies: Ott, V.L. et al. “chammaRIIB as a potential molecular target for attempt to increase ef?cacy in oncology applications,” Critical intravenous gamma globulin therapy,” J. Allergy Clin Immunol. Oct. Reviews in Oncology/Hematology 40: 25-35; 2001. 2001:S95-S98. Reff et al., “Depletion of B cells in vivo by a chimeric mouse human Panka et al. (1988) Variable region framework differences result in monoclonal antibody to CD20,” Blood 83:435-445, 1994. decreased or increased af?nity of variant anti-digoxin antibodies. Riechmann et al., “Reshaping human antibodies for therapy,” Nature. Proc. Natl. Acad. Sci. USA 85:30803084. 332(6162):323-7, 1988. Pardridge et al., Blood-brain barrier drug targeting: The future of Riemer et al. (Epub Jan. 8, 2005) “Matching of trastuzumab brain drug development. Molecular Interventions. 2003, 3:2:90-105. (Herceptin) epitope mimics onto the surface of Her-2/neuia new See particularly pp. 91-96. method of epitope de?nition,” Mol Immunol. 42(9): 1 121-1 124. Park et al., Immunolipo somes for cancer treatment. Adv Pharmacol. Routledge et al., The effect of aglycosylation on the immunogenicity 1997;40:399-435. of a humanized therapeutic CD3 monoclonal antibody. Transplanta Park YS, Tumor-directed targeting of liposomes. Biosci Rep. Apr. tion. Oct. 27, 1995;60(8):847-53. 2002;22(2):267-81. Rudikoff et al. (1982) “Single amino acid substitution altering anti Partridge et al., “The use of anti-IgG monoclonal antibodies in map gen-binding speci?city” Proc. Natl. Acad. Sci. USA 79:1979-1983. ping the monocyte receptor site on IgG,” Mol Immunol. 23(12): 1365 - Samsom et al. (2005) Fc gamma RIIB regulates nasal and oral toler 72, 1986. ance: a role for dendritic cells Immunol. 174:5279-5287. Paul, William E, (1993) “Fundamental Microbiology, 3 Ed.” pf. 242, Samuelsson et al., Anti-in?ammatory activity of IVIG mediated 292-296. through the inhibitory Fc receptor. Science. Jan. 19, 2001; 291:484 Pereira et al. (1998) Cardiolipin Binding a light Chain from Lupus 486. prone Mice; Biochem. 37:1460-1437. Sarkar et al., Negative signaling via Fc.gamma.RIIB1 in B cells Perussia “Human Natural Killer Cell Protocols” in Methods Molecu blocks phospholipase C.sub..gamma.2 tyrosine phosphorylation but lar Biology. vol. 121 (Campbell et al. eds.) Humana Press Inc., not Syk or Lyn activation. J Biol Chem. Aug. 16, Totowa, NJ. 179-92, 2000. 1996;271(33):20182-6. US 8,802,093 B2 Page 7 (56) References Cited Sondermann et al., “Crystal structure of the soluble form of the human fcgamma-receptor IIb: a new member of the immuno globulin OTHER PUBLICATIONS superfamily at 1.7 A resolution,” EMBO J 18: 1095-1 103, 1999. Sondermann et al., “Molecular basis for immune complex recogni Sarmay et al., “Ligand inhibition studies on the role of Fc receptors in tion: a comparison of Fc-receptor structures,” J. Mol. Biol. 309:737 antibody-dependent cell-mediated cytotoxicity,” M01 Immunol 21 749, 2001. :43-51, 1984. Sondermann et al., “The 3 .2-A crystal structure of the human IgG1 Fc Sarmay et al., “Mapping and comparison of the interaction sites on fragment-Fc gammaRIII complex,” Nature 406:267-273, 2000. the Fc region of IgG responsible for triggering antibody dependent Stancovski et al. (1991) “Mechanistic aspects of the opposing effects cellular cytotoxicity (ADCC) through different types of human Fc of monoclonal antibodies to the ERBB2 receptor on tumor growth,” gamma receptor,” Mol Immunol 29 :633-639, 1992. Proc Natl Acad Sci U S A. 88(19):8691-8695. Sarmay et al., “The effect of synthetic peptides corresponding to Fc Stavenhagen et al. (2007) “Fc Optimization of Therapeutic Antibod sequences in human IgG1 on various steps in the B cell activation ies Enhances Their Ability to Kill Tumor Cells in vitro and Controls pathway,” Eur J Immunol 18 :289-294, 1988. Tumor Expansion in vivo via Low-Af?nity Activatinch ; Receptors” Sautes-Fridman et al., “Fc gamma receptors: a magic link with the Cancer Res. 67(18):8882-8890. outside world,” ASHI Quarterley, 4th Quarter: 148-151, 2003. Stavenhagen et al. (2008) “Enhancing the potency of therapeutic Schaffner et al., “Chimeric interleukin 2 receptor alpha chain anti monoclonal antibodies via Fc optimization,” Advan. Enzyme Regul. body derivatives with fused mu and gamma chains permit improved 48: 152-164. recruitment of effector functions,” Mol Immunol 32 :9-20, 1995 Stefanescu et al. (2004) “Inhibitory Fc Gamma Receptors: From (Erratum in 32 :1299, 1995). Gene to Disease,” J. Clinical Immunol. 24(4):315-326. Schatz et al., “Use of peptide libraries to map the substrate speci?city Steplewski et al., “Biological activity of human-mouse IgGl, IgG2, of a peptide-modifying enzyme: a 13 residue consensus peptide IgG3, and IgG4 chimeric monoclonal antibodies with antitumor speci?es biotinylation in Escherichia coli,” Bio/ Technology speci?city,” Proc. Natl. Acad. Sci. USA. 85:4852-4856, 1988. 11:1138-1143, 2000. Strohmeier et al., “Role of the Fc gamma R subclasses Fc gamma RII Scholl et al., Is colony-stimulating Factor-1 a key mediator of breast and Fc gamma RIII in the activation of human neutrophils by low and cancer invasion and metastasis? Mol Carcinog. 7(4):207-11, (1993). high valency immune complexes,” J Leukocyte Biol 58:415-422, Schuna et al., 2000, “New Drugs for the treatment of rheumatoid 1995. arthritis.” Am J. Health Syst. Phar, 57:225-237. Su et al., Expression pro?le of Fc.gamma.RIIB on leukocytes and its Seaver (1994) “Monoclonal Antibodies in Industry: More Dif?cult dysregulation in systemic lupus erythematosus. J. Immunol. than Originally Thought,” Genetic Engineering News 14(14): 10, 21. 178:3272-3280, 2007. Sensel et al., “Amino acid differences in the N-terminus of C(H)2 Sylvestre and Ravetch, “A dominant role for mast cell Fc receptors in in?uence the relative abilities of IgG2 and IgG3 to activate comple the Arthus reaction,” Immunity 5:387-390, 1996. ment,” Molecular Immunology 34: 1019-1029, 1997. Sylvestre and Ravetch, “Fc receptors initiate the Arthus reaction: Shields et al., “High resolution mapping of the binding site on human rede?ning the in?ammatory cascade,” Science 265: 1095-1098, IgG1 for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and 1994. design of IgG1 variants with improved binding to the Fc gamma R,” Takai et al., “Augmented humoral and anaphylactic responses in Fc J Biol Chem 276 :6591-6604, 2001. gamma RII-de?cient mice,” Nature 379:346-349, 1996. Shields et al., Lack of fucose on human IgG1 N-linked oligosac Takai et al., “FcR gamma chain deletion results in pleiotrophic effec charide improves binding to human Fc.gamma. RIII and antibody tor cell defects,” Cell 76 :519-529, 1994. dependent cellular toxicity. J Biol Chem. Jul. 26, Takai, “Roles of Fc receptors in autoimmunity,” Nature Reviews 2002;277(30):26733-40. 2:580-592, 2002. Shopes et al., “Recombinant human IgGl-murine IgE chimeric Ig. Takai et al. (2003) “Fc Receptors as Potential Targets for the Treat Construction, expression, and binding to human Fc gamma recep ment of Allergy, Autoimmune Disease and Cancer,” Immune, tors,” JImmunol 145 :3842-3848, 1990. Endo. & Meta. Disorders 3:187-197. Shopes, “A genetically engineered human IgG mutant with enhanced Tam et al., A bispeci?c antibody against human IgE and human cytolytic activity,” J Immunol 148 :2918-2922, 1992. Fc.gamma.RII that inhibits antigen-induced histamine release by Shopes, “A genetically engineered human IgG with limited ?exibility human mast cells and basophils. Allergy 2004;59:772-780. fully initiates cytolysis via complement,” Molecular Immunology 30 Tamm et al., “The IgG binding site of human FcyRIIIB receptor :603-609, 1993. involves CC‘ and FG loops of the membrane-proximal domain,” J Shusta et al., “Directed evolution of a stable scaffold for T-cell recep Biol Chem 271:3659-3666, 1996. tor engineering,” Nature Biotechnology 18:754-759, 2000. Tao and Morrison, Studies of aglycosylated chimeric mouse-human Shusta et al., “Increasing the secretory capacity of Saccharomyces IgG. Role of carbohydrate in the structure and effector functions cerevisiae for production of single-chain antibody fragments,” mediated by the human IgG constant region. J Immunol. Oct. 15, Nature Biotechnology 16:773-777, 1998. 1989;143(8):2595-601. Shusta et al., “Yeast polypeptide fusion surface display levels predict Tao et al., “Structural features of human immunoglobulin G that thermal stability and soluble secretion ef?ciency,” J Mol Biol determine isotype-speci?c differences in complement activation,” J 292:949-956, 1999. Exp Med 178:661-667, 1993. Siberil, S. et al. (2006) “Molecular Aspects of Human chammaR Tao et al., “The differential ability of human IgG1 and IgG4 to Interactions with IgG: Functional and Therapeutic Consequences,” activate complement is determined by the COOH-terminal sequence Immunol. Lett. 106: 1 11-1 18 (2006). ofthe CH2 domain,” J Exp Med 173:1025-1028, 1991. Skolnick et al. (2000) From Genes to Protein Structure and Function: Todorovska et a1 ., Design and application of diabodies, triabodies and Novel Aspects of Computational Approaches in the Genomic Era, tetrabodies for cancer targeting. J Immunol Methods. Feb. 1, Trends in Biotechnology 18:34-39. 2001;248(1-2):47-66. Sleister et al., “Subtractive Immunization; A tool for the generation of Tridandapandi et al., “Regulated Expression and Inhibitory Function discriminatory antibodies to proteins of similar sequence,” Journal of of chammaRIIB in Human Monocytic Cells,” Journal of Biological Immunological Methods 261: 213-220, (2002). Chemistry 277(7): 5082-5089, 2002. Smith and Morrison, “Recombinant polymeric IgG: an approach to Umana et al., Engineered glycoforms of an antineuroblastoma IgGl engineering more potent antibodies,” Bio/Technology 12:683-688, with optimized antibody-dependent cellular cytotoxic activity. Nat 1994. Biotechnol. Feb. 1999;17(2):176-80. Sondermann and Oosthuizen, “The structure of Fc receptor/1g com Vajdos et al. (2002) “Comprehensive Functional Maps of the Anti plexes: considerations on stoichiometry and potential inhibitors,” gen-Binding Site of an Anti-ErbB2 Antibody Obtained with Shotgun Immunology Letters, 82:51-56, 2002. Scanning Mutagenesis,” J. Molec. Biol. 320:415-428. US 8,802,093 B2 Page 8 (56) References Cited Witttrup, “Protein engineering by cell-surface display,” Curr, Opin. Biotechnol. 12:395-399, 2001. OTHER PUBLICATIONS Woof et al., “Localisation of the monocyte-binding region on human immunoglobulin G,” Mol Immunol 23 :319-330, 1986. Van Antwerp and Wittrup, “Fine af?nity discrimination by yeast Wright and Morrison, Effect of glycosylation on antibody function: surface display and ?ow cytometry,” Biotechnol Prog 16:31-37, implications for genetic engineering. Trends Biotechnol. Jan. 2000. 1997;15(1):26-32. Van De Winkel et al., 1995, “CD32 cluster workshop report.” Wu et al. (2001) “Multimerization of a chimeric anti-DC20 Single Leukocyte Typing V: White Cell differentiation antigens 823-825 Chain Fv-Fc fusion protein is mediated through variable domain (Schlossman, Boumsell, Gilks, Harlan, Kishomoto, eds.). exchange,” Protein Engineering 14(2): 1025-1033. Van den Beuken et al. (2001) Building novel binding ligands to B7.1 Wu et a1 ., “A novel polymorphism ochyRIIIa (CD16) alters receptor and B72 based on human antibody single variable light chain function and predisposes to autoimmune disease,” J Clin Invst 100 domains; J. Molec. Biol. 310:591-601. :1059-1070, 1997. Van Nguyen et al., Colony stimulating factor-1 is required to recruit Wu et al., “Humanization of a Murine Monoclonal Antibody by macrophages into the mammary gland to facilitate mammary ductal Simultaneous Optimization of Framework and CDR Residues,” J our outgrowth. Dev Biol. 2002;247(1):11-25. nal of Molecular Biology, 1999, vol. 294, pp. 151-162. Van Sorge et al., “chammaR polymorphisms: Implications for func Xu et al. (1993) “Antibody-induced growth inhibition is mediated tion, disease susceptibility and immunotherapy,” Tissue Antigens through immunochemically and functionally distinct epitopes on the 61: 189-202, 2003. extracellular domain of the c-erbB-2 (HER-2/neu) gene product Vely et a1 ., 1997, “A new set of monoclonal antibodies against human p185,” Int. J. Cancer. 53(3):401-408. Fc gamma RII (CD32) and Fc gamma RIII (CD16): characterization Xu et al., “Residue at position 331 in the IgG1 and IgG4 CH2 and use in various assays.” Hybridoma 16(6):519-28. domains contributes to their differential ability to bind and activate Veri, MC. et al. (2007) “Monoclonal antibodies capable of discrimi complement,” J Biol Chem 269 :3469-3474, 1994. nating the human inhibitory chamma-receptor IIB (CD32B) from Xu et al., Fc.gamma.Rs Modulate Cytotoxicity ofAnti-Fas Antibod the activating chamma-receptor IIA (CD32A): biochemical, bio ies: Implications for Agonistic Antibody Based Therapeutics. J logical and functional characterization,” Immunology 121(3):392 Immunol. 2003;171:562-68. 404. Yeung and Wittrup, “Quantitative screening of yeast surface-dis Veri et al. (2010) “Therapeutic Control of B Cell Activiation via played polypeptide libraries by magnetic bead capture,” Biotechnol Recruitment of Fcy Receptor IIb (CD32B) Inhibitory Function With Prog 18:212-220, 2002. a Novel Bispeci?c Antibody Scaffold,” Arth. & Rheum. 62(7): 1933 Zeidler et al., “The Fc-region of a new class of intact bispeci?c 1943. antibody mediates activation of accessory cells and NK cells and Vidarte, “Serine 132 is the C3 covalent attachment point on the CH1 induces direct phagocytosis of tumour cells,” British J Cancer domain ofhuman IgGl,” J Biol Chem 276:38217-38233, 2001. 83:261-266, 2000. Vingerhoeds et al., Immunoliposomes in vivo. Immunomethods. Jun. Zola et al., 2000, “CD32 (chammaRII).” J Biol Regul Homeost 1994;4(3):259-72. Agents 14(4):311-6. Vitetta, E.S. et al. (2006) “Immunology. Cnsidering Therapeutic Zuckier et al., “Chimeric human-mouse IgG antibodies with shuffled Antibodies,” Science 313:308-309. constant region exons demonstrate that multiple domains contribute Vuist et al. (1990) “Two distinct mechanisms of antitumor activity to in vivo half-life,” Cancer Res 58 :3905-3908, 1998. mediated by the combination of interleukin 2 and monoclonal anti Singapore Search Report SG 200607186-4 Nov. 5, 2008. bodies,” Canc. Res. 50:5767-5772. European Search Report (EP 05778285) Apr. 14, 2008. Wallick et al., Glycosylation of a VH residue of a monoclonal anti Extended Search Report EP 058543322 (PCT/US2005/045586) body against {acute over (.alpha.)} (1 .fwdarw.6) dextran increases its (2009). af?nity for antigen. J Exp Med. Sep. 1, 1988;168(3):1099-109. Extended Search Report EP 058575218 (WO 06/088494) (2009). Ward and Ghetie, “The effector functions of immunoglobulins: Extended Search Report EP 077581304 (PCT/US2007/063548) implications for therapy,” Therapeutic Immunology 2:77-94, 1995. (2009). Ward et al. (1989) Building Activities of a repertoire of single Extended Search Report EP 07812341.1 (PCT/US2007/72153) immunoglobulin variable domains secreted from Escherichia coli, (2009) (9 pages). Nature 341:544-546 (1989). Extended Search Report EP 078738267 (PCT/US2007/069767) Warmerdam et al., Molecular basis for a polymorphism of human Fc (2009) 8 pages). gamma receptor II (CD32). J Exp Med. Jul. 1, 1990;172(1):19-25. Extended Search Report EP07799049 (PCT/US2007/072151) Warren, HS et al.(1999) “NK cells and apoptosis,” Immunol. Cell (2010) (7 pages). Biol. 77(1):64-75. International Preliminary Report on Patentability PCT/USO4/ Weinrich, V. et al. “Epitope Mapping of New Monoclonal Antibodies 000643 (W004/063351) (2005). Recognizing Distinct Human FCRII (CD32) Isoforms,” Hybridoma International Preliminary Report on Patentability PCT/USOS/ 15(2):109-116, (Apr. 15, 1996). 024645(W006/088494) (2007). Weng and Levy, “Two immunoglobulin G fragment C receptor International Preliminary Report on Patentability PCT/U 805/ 12798 polymorphisms independently predict response to rituximab in (W006/088494) (2005). patients with follicular lymphoma,” J Clin Oncol 21:3940-3947, International Preliminary Report on Patentability PCT/USO6/ 2003. 031201(W007/021841) (2008). Wheeler, “Preventive Vaccines for Cervical Cancer,” Salud Publica d International Preliminary Report on Patentability PCT/USO7/ Mexico, 1997, vol. 39, pp. 1-9. 069767 (W008/105886) (2008)(7 pages). Wiener, E. et al. “Differences between the activities of human International Preliminary Report on Patentability PCT/USO7/ monoclonal IgG1 and IgG3 anti-D antibodies of the Rh blood group 086793 (W008/140603) (2008). system in their abilities to mediate effector functions of monocytes,” International Preliminary Report on Patentability PCT/US07/72153 Immunol. 65:159-163 (1988). (W008/019199) (2008). Wing et al., “Mechanism of ?rst-dose cytokine-release syndrome by International Search Report; PCT/USO4/000643 (W004/063351) CAMPATH 1-H: Involvement ofCD16 (FcyRIII) and CD11a/CD18 (2004). (LFA-l) on NK cells,” J Clin Invest 98 :2819-2826, 1996. International Search Report; PCT/USOS/024645 (W006/088494) Wingren et al., “Comparison of surface properties of human IgA, IgE, (2007). IgG and IgM antibodies with identical and different speci?cities,” International Search Report; PCT/U 805/ 12798 (W006/088494) Scand J Immunol 44:430-436, 1996. (2005). Wittrup, “The single cell as a microplate well,” Nat Biotechnol International Search Report; PCT/USO6/031201 (W007/021841) 18: 1039-1040, 2000. (2008). US 8,802,093 B2 Page 9 (56) References Cited International Search Report; PCT/US07/72153 (W008/019199) (2008). OTHER PUBLICATIONS International Search Report; PCT/US09/38201 (W009/123894) (2009) (11 pages). International Search Report; PCT/USO7/069767 (WOO8/105886) International Search Report; PCT/US09/38171 24, ZOIOXIZ (2008) (4pages). pages). International Search Report; PCT/US07/086793 (W008/ 140603) (2008). * cited by examiner US. Patent Aug. 12, 2014 Sheet 1 0f 11 US 8,802,093 B2 10 20 30 Murine DIVMTQSHKFMSTSVGDRVSITCKASQDVN Chimeric DIVMTQSHKFMSTSVGDRVSITCKASQDVN Humanized DIQMTQSPSSLSASVGDRVTITCRASQDVN 4O 5O 6O Murine TAVAWYQQKPGHSPKLLIYSASFRYTGVPD Chimeric TAVAWYQQKPGHSPKLLIYSASFRYTGVPD Humanized TAVAWYQQKPGKAPKLLIYSASFLESGVPS 7O 8O 9O Murine RFTGNRSGTDFTFTISSVQAEDLAVYYCQQ Chimeric RFTGSRSGTDFTFTISSVQAEDLAVYYCQQ Humanized RFSGSRSGTDFTLTISSLQPEDFATYYCQQ 100 109 Murine HYTTPPTFGGGTKLEIKRA Chimeric HYTTPPTFGGGTKVEIKRT Humanized HYTTPPTFGQGTKVEIKRT Figure 1