Logout succeed
Logout succeed. See you again!

Homeobox genes and interneuron differentiation PDF
Preview Homeobox genes and interneuron differentiation
Development 128, 1951-1969 (2001) 1951 Printed in Great Britain ©The Company of Biologists Limited 2001 DEV5903 A regulatory cascade of three homeobox genes, ceh-10, ttx-3 and ceh-23, controls cell fate specification of a defined interneuron class in C. elegans Zeynep Altun-Gultekin1, Yoshiki Andachi2, Ephraim L. Tsalik1, David Pilgrim3, Yuji Kohara2 and Oliver Hobert1,* 1Department of Biochemistry and Molecular Biophysics, Center for Neurobiology and Behavior, Columbia University, College of Physicians and Surgeons, New York, NY 10032, USA 2Genome Biology Lab, Center for Genetic Resource Information, National Institute of Genetics, Mishima, Shizuoka, 411-8540, Japan 3Department of Biological Sciences, University of Alberta, Edmonton, Alberta T6G 2E9, Canada *Author for correspondence (e-mail: [email protected]) Accepted 27 February 2001 SUMMARY The development of the nervous system requires the differentiation. Not only are all AIY subtype characteristics coordinated activity of a variety of regulatory factors that lost in ttx-3 mutants, but ectopic misexpression of ttx-3 is define the individual properties of specific neuronal also sufficient to induce AIY-like features in a restricted set subtypes. We report a regulatory cascade composed of of neurons. One of the targets of ceh-10 and ttx-3 is a novel three homeodomain proteins that act to define the type of homeobox gene, ceh-23. We show that ceh-23 is not properties of a specific interneuron class in the nematode required for the initial adoption of AIY differentiation C. elegans. We describe a set of differentiation markers characteristics, but instead is required to maintain the characteristic for the AIY interneuron class and show that expression of one defined AIY differentiation feature. the ceh-10 paired-type and ttx-3 LIM-type homeobox genes Finally, we demonstrate that the regulatory relationship function to regulate all known subtype-specific features of between ceh-10, ttx-3 and ceh-23 is only partially conserved the AIY interneurons. In contrast, the acquisition of several in other neurons in the nervous system. Our findings pan-neuronal features is unaffected in ceh-10 and ttx-3 illustrate the complexity of transcriptional regulation in the mutants, suggesting that the activity of these homeobox nervous system and provide an example for the intricate genes separates pan-neuronal from subtype-specific interdependence of transcription factor action. differentiation programs. The LIM homeobox gene ttx-3 appears to play a central role in regulation of AIY Key words: Homeobox, C. elegans, Neuronal differentiation INTRODUCTION presumably results in a progressive restriction in the developmental potential of a neuron, eventually leading to Differential gene expression patterns are a characteristic the acquisition of its terminal differentiation features. feature of individual cell types within the nervous system. Transcriptional regulatory cascades have, for example, been Complex patterns of tightly controlled gene regulatory described for neurogenic events involving bHLH proteins in events are conferred by transcription factors that act at a vertebrates and flies (Anderson and Jan, 1997), cell fate variety of different stages during neuronal development. determination in the vertebrate spinal cord (Edlund and Some transcription factors act as early neuronal fate Jessell, 1999; Tanabe et al., 1998), and cell subtype determinants such that their disruption leads to the adoption specification of a class of motoneurons (Baum et al., 1999) of distinct, non-neuronal cell fates. Other transcription and touch sensory neurons (Mitani et al., 1993) in the factors function later in development to regionalize the nematode C. elegans. nervous system, while the subsequent activity of yet A prominent class of transcription factors that acts to other transcription factors determines specific subtype determine terminal differentiation characteristics of neurons characteristics of neurons (Anderson and Jan, 1997; Bang is the LIM homeobox class of regulatory factors (Hobert and and Goulding, 1996; Jurata et al., 2000). Transcription Westphal, 2000). In the mouse, Isl1 is required for early factors that act at distinct steps in the developmental history aspects of motoneuron differentiation (Pfaff et al., 1996), of a neuron most likely function in hierarchical cascades of while later acting Lhx genes, such as Lhx3 or Lhx4 define gene regulation, in which early acting transcription factors the identity of specific subtypes of motoneurons in the turn on the expression of later acting transcription spinal cord (Sharma et al., 1998; Tsuchida et al., 1994). factors. The hierarchical activation of transcription factors Lim1 and Lmx1b coordinately direct axonal outgrowth 1952 Z. Altun-Gultekin and others patterns in vertebrate limbs (Kania et al., 2000). In MATERIALS AND METHODS Drosophila, genetic and neuroanatomical studies on apterous, islet and lim3 have revealed their involvement Transgenic strains in several aspects of neuronal differentiation, including Extrachromosomal arrays axon fasciculation, pathfinding and neurotransmitter choice adEx1450=Ex[ser-2::gfp; lin-15(+)] (courtesy of T. Niacaris and L. (Lundgren et al., 1995; Thor et al., 1999; Thor and Thomas, Avery) 1997). As in vertebrates, combinatorial expression of Lhx otEx44 – otEx49, otEx97 – otEx101=Ex[ttx-3full::gfp; pRF4] genes in Drosophila determines motoneuron differentiation otEx57=Ex[ttx-3full::gfp; pBX] and axonal targeting choices in the ventral nerve cord (Thor otEx65=Ex[unc-119::ttx-3; pRF4] otEx75=Ex[unc-33::gfp; unc-4(+)] et al., 1999). otEx93=Ex[pflp-1::gfp; pRF4] As revealed by the genome sequencing project, C. elegans otEx95, otEx96=Ex[unc-119::ttx-3; unc-122::gfp]; unc-122::gfpis a contains seven Lhx genes, which are expressed in largely non- new injection marker (see below) overlapping sets of neurons (Hobert and Westphal, 2000). utEx54=Ex[C36B7.7::gfp; pRF4] (courtesy of T. Ishihara and I. mec-3, one of the founding members of the Lhx gene family, Katsura). represents the end-point in a cascade of transcriptional regulatory factors that determines the fate of touch sensory Chromosomally integrated arrays neurons (Mitani et al., 1993; Way and Chalfie, 1988). mec-3 evIs111=integrated Ex[F25B3.3::gfp;dpy-20(+)] (kindly provided by directly regulates the transcription of genes required for touch Joe Culotti) sensory neuron function such as the mec-7 b -tubulin gene and kyIs5IV=integrated Ex[ceh-23::gfp; lin-15(+)] (Forrester et al., 1998) mgIs18IV and mgIs32III=independently integrated Ex[ttx- the mec-4 ion channel gene (Duggan et al., 1998). The lin-11, 3prom::gfp; plin-15] lim-6 and ceh-14 genes act to control as yet undefined subtype otIs7=integrated Ex[zig-2::gfp; pRF4] (O. Aurelio and O. H., characteristics of specific neurons and other tissue types unpublished) (Cassata et al., 2000; Freyd et al., 1990; Hobert et al., 1998; otIs14=integrated Ex[zig-3::gfp; pRF4] (O. Aurelio and O. H., Hobert et al., 1999), while the lim-4 gene functions as a binary unpublished) cell-type switch in a class of odorsensory neurons (Sagasti et otIs24=integrated Ex[sre-1::gfp; dpy-20(+)] al., 1999). otIs33IV=integrated Ex[kal-1::gfp; pBX] (H. Buelow and O. H., There are three central aspects of Lhx gene function that unpublished) remain poorly understood in any system. First, the precise otIs45=integrated Ex[unc-119::gfp] nature of cellular defects evoked by loss of Lhx protein otIs62, otIs123=integrated Ex[psra-11-3::gfp; pRF4] and integrated Ex[psra-11-3::gfp; unc-4(+)], respectively function is often unclear owing to the paucity of specific cell otIs97IV, otIs98, otIs99=integrated otEx65 fate and neuroanatomical markers. Second, with a few otIs107=integrated adEx1450 exceptions (Benveniste et al., 1998; Duggan et al., 1998), target otIs117=integrated otEx75. genes of Lhx proteins in the nervous system have remained The injection marker pBX was used in a pha-1(e2123ts) largely elusive. Finally, the nature of upstream regulators of background; unc-4(+), lin-15(+) and dpy-20(+) were used in Lhx genes and hence the integration of Lhx gene function into unc-4(e120), lin-15(n765ts) and dpy-20(e1362) backgrounds, larger transcriptional regulatory cascades or networks is little respectively; and pRF4and unc-122::gfpin a wild-type background. understood. (The protocol for integrating extrachromosomal arrays can be We address these key questions for the C. elegans Lhx foundathttp://cpmcnet.columbia.edu/dept/gsas/biochem/labs/hobert/ gene ttx-3. We have previously shown that ttx-3 mutant protocols.htm) animals display defects in thermoregulatory behavior that mimic the defects seen upon ablation of a class of Behavioral assays interneurons in the thermoregulatory neuronal circuit, the Thermotaxis assays were performed as described (Hedgecock and AIY interneuron class (Hobert et al., 1997). The expression Russell, 1975). In our specific set-up, an aluminum slab bridged two of ttx-3 in the AIY interneurons of wild-type animals hence water baths, one at 61°C, the other at 5°C; the ambient temperature was 25°C. Animals were grown at 20°C and assayed on a gridded 10 suggested that ttx-3 is required for the AIY neurons to cm square petri dish that had equilibrated on the aluminum plate to function appropriately (Hobert et al., 1997). We now show establish a stable gradient from 22°C to 16.5°C (measured with a that within the AIY interneurons ttx-3 is part of a surface temperature probe). Animals were placed into the center of transcriptional regulatory cascade, which involves two other the gradient. After an assay time of 40-60 minutes, the animals were homeobox genes, ceh-10 and ceh-23. We demonstrate that anaesthetized. For scoring, the plate was divided into six regions of ttx-3 is not required for the adoption of pan-neuronal features 1.3 cm width (see Fig. 3A) and animals were counted in each region. of the AIY interneurons but is rather required for the subtype Animals that had not left the 1.7 cm2quadrant in which they had been specification of this interneuron class. We describe several initially placed were not scored. genes that participate in defining AIY cell fate and that Dauer assays were performed by allowing four gravid adults per represent either direct or indirect targets of the ttx-3 plate to lay eggs for 20 hours at 15°C. Adults were picked off and their offspring cultivated on an OP50 seeded plate at 25°C. After 3.5 transcription factor. Neuroanatomical defects caused by loss days, the brood was scored. Animals that showed the characteristic of ttx-3 function resemble those seen in axon pathfinding thin elongated shape of dauers and displayed a characteristic dauer mutants, suggesting that ttx-3 is also involved in determining cuticle were scored as dauers; all the remaining animals at a stage patterns of axonal outgrowth. Furthermore, we show that a older than L3 were scored as non-dauers. Many of the daf-7; ttx-3 transcription factor regulated by ttx-3, the ceh-23 homeobox bypasser animals had transiently passed through a dauer-like, if not gene, participates in the regulation of a presumptive ttx-3 complete dauer stage, in which they remained for a variable amount downstream target gene. of time. Hence, at the scoring time, dauer bypass mutants were Homeobox genes and interneuron differentiation 1953 observed at all different stages (L3 to adults). The ‘dauer bypass’ Pilgrim, 1995), the unc-33::gfp reporter is expressed in dividing phenotype thus encompasses a failure to enter the dauer stage, as well neuroblasts at pre-comma embryonic stages (data not shown). unc- as a failure to appropriately arrest in the dauer stage. 33::gfp expression can be observed outside the nervous system in two amphid socket cells and weakly in non-neuronal pharyngeal cells. We Isolation and analysis of ceh-23 null mutant animals also generated a fusion of the gfp gene to the promoter of the F25B3.3 A ceh-23 null allele was isolated using a transposon-tagging strategy gene, the C. elegans ortholog of the Ca2+-regulated ras nucleotide (Zwaal et al., 1993). First, a Tc1 insertion in the ceh-23 gene was exchange factor CalDAG-GEFII/RasGRP, which is ubiquitously isolated by PCR screening of a Tc1 library made from the MT3126 expressed in the vertebrate nervous system (Ebinu et al., 1998; strain, using Tc1- and ceh-23-specific primers. The isolated strain Kawasaki et al., 1998). F25B3.3 and vertebrate CalDAG- YK16[mut-2(r459); ceh-23(ms16::Tc1); dpy-19(n1347)III] contained GEFI/RasGRP both contain a unique combination of domains, a the Tc1 insertion in the last exon in the middle of the homeodomain nucleotide exchange factor domain, two EF hands and a Cys-rich at position 12957 (numbering of cosmid sequence ZK652). YK16 was diacylglycerol binding motif; the respective C. elegans and rat then PCR screened for Tc1 excision events using ceh-23-specific proteins show 35% identity and 57% similarity throughout the whole primers. An imprecise Tc1 excision was identified in strain length of the protein. The F25B3.3::gfp construct contains 3.5 kb YK23[mut-2(r459); ceh-23(ms23); dpy-19(n1347)III] at position genomic sequences upstream of the predicted ATG start site and the 11098-12961. The junction sequence is: 5¢…TTGAGCTTT- first six amino acids of the predicted protein and is exclusively G[deletion]AGTCGGAGCA…3¢. YK23 was outcrossed several times expressed throughout the nervous system in C. elegans (see Fig. 6A). with Bristol N2. As YK23 has no obvious phenotype, the genotype In contrast to unc-119::gfp and unc-33::gfp, which are already was scored using a triplex PCR, in which the three primers U2, D2 expressed in neuroblasts, F25B3.3::gfp is a postmitotic pan-neuronal and D3 gave a 1 kb product on homozygous ceh-23(ms23) animals, marker, i.e. its onset of expression is observed after the terminal a 1 kb/730 bp doublet on heterozygous animals and a 730 bp product division of neurons (around 450 minutes of embryonic development; on wild-type animals. The primer sequences are: U2, 5¢- see Fig. 6B). TACCTGCACAACACACTGAC-3¢; D2, 5¢-TGGCAAAATCATGG- CGGAAC-3¢; and D3, 5¢-TTGGATCCAGCAATTGTTTGAA- Pan-neuronal expression of ttx-3 GAACGT-3¢. The unc-119::ttx-3 construct contains the genomic coding region of ceh-23::gfp expression in several neuron classes other than AIY, ttx-3 from ATG to TGA cloned into the unc-119 expression vector including ADF, ADL, AWC, AFD, PHA, PHB and CAN (Forrester pBY103 (Maduro and Pilgrim, 1995). This construct was injected at et al., 1998), prompted us to assay differentiation of some of these 10 ng/m l together with either pRF4 (rol-6) or unc-122::gfp as injection neurons in ceh-23 null mutants. We found that the AFD and ASE cell marker into a mgIs18; ttx-3(ks5) strain to yield three independent fate markers gcy-8::gfp and gcy-5::gfp, respectively, the ADF, ADL, transgenic lines, otEx65, otEx95 and otEx96. All three lines show PHA, PHB cell fate marker srb-6::gfp, the AWC cell fate marker str- complete rescue of the autoregulatory defects of the ttx-3(ks5) 2::gfp and the CAN cell fate marker kal-1::gfp were all correctly mutation. otEx65 was chromosomally integrated to yield three expressed in ceh-23(ms23)animals (data not shown). Moreover, ADL independent integrants, otIs97, otIs98 and otIs99. All three and PHA/PHB show normal dye filling behavior. In those cases where extrachromosomal lines as well as all three integrated lines show the neuron could be visualized in relative isolation (AFD, ASE, AWC, ectopic ttx-3prom::gfp expression in RID and CAN (CAN expression CAN, PHA/B), the anatomy of the neuron appeared wild type. is less consistent in otEx95 and otEx96). otEx95 and otEx96 were assayed for thermotaxis behavior either in a wild-type or ttx-3(ks5) Genetic screen for new ttx-3 alleles mutant background. To screen for new ttx-3 alleles, we made use of two previously We examined ectopic expression of AIY fate markers other than described consequences of loss of ttx-3 function, the partial ttx-3prom::gfp by using the extrachromosomal line otEx65, which we suppression of the dauer constitutive phenotype of a daf-7 loss-of- crossed with otIs33 (kal-1::gfp), kyIs5 (ceh-23::gfp), otIs107 (ser- function allele and the loss of positive autoregulation of the ttx-3 gene 2::gfp) and otIs123 (sra-11::gfp). As kal-1::gfp and ser-2::gfp are (Hobert et al., 1997). A daf-7(e1372)III; mgIs18IV strain, that already expressed in a substantial number of neurons in the head contains an integrated ttx-3prom::gfp array, was mutagenized with ganglia it was difficult to determine ectopic expression outside their EMS at the L4 larval stage. The F1offspring were allowed to grow to normal expression domains in the head ganglia; it was clear, however, the adult stage at 15°C. Eggs were prepared from these animals using that pan-neuronal expression of ttx-3 did not cause a significant standard bleaching protocols. Approximately 100-300 eggs of this F2 broadening of the expression of either of the markers in the nervous generation were placed on single plates and cultivated at 25°C. Only system. plates that containeddauer bypass mutants quickly grew to starvation. Those plates were chunked and again grown to starvation at 25°C UNC-17 antibody staining twice, in order to enrich for homozygous animals with the bypasser We used a modification of the freeze-cracking method kindly provided phenotype. Animals were isolated from plates that showed to us by J. Duerr. Briefly, mixed stage animals that were grown at 20°C downregulated ttx-3prom::gfp expression, and after testing for X- were transferred onto poly-L-lysine coated slides and covered with a linkage of the defect the ttx-3 genomic locus was sequenced. Out of coverslip. Slides were then frozen in liquid nitrogen and animals were >100,000 haploid genomes screened, we retrieved three ttx-3 alleles, cracked by flipping coverslips off. Animals were quickly fixed in mg158, ot22 and ot23. In addition, we obtained another ttx-3 allele, methanol and acetone, incubated in blocking serum and co-stained nj14, that was isolated by Ikue Mori in an independent screen for with mouse monoclonal anti-UNC-17 (kindly provided by J.Duerr and mutants that affect ttx-3prom::gfp expression. J. Rand) and polyclonal anti-GFP (Molecular Probes) antibodies. Pan-neuronal marker genes Other DNA constructs We reasoned that the unc-33 gene, which appears to affect axon The ttx-3 expression constructs ttx-3rescand ttx-3prom::gfpshown in pathfinding throughout the nervous system (Hedgecock et al., 1985; Fig. 1B, have been described already (Hobert et al., 1997); ttx-3full::gfp McIntire et al., 1992), may be pan-neuronally expressed. We fused a represents a GFP PCR fusion product in which the genomic region 2.7kb genomic fragment that is immediately upstream to the start site contained within ttx-3resc has been PCR-fused to gfp::unc-54-3¢UTR of the previously described unc-33 mRNA transcript (Li et al., 1992) from the pPD95.75 vector. (Protocol for PCR fusion can be found at: to gfp and found this reporter gene to be expressed throughout the http://cpmcnet.columbia.edu/dept/gsas/biochem/labs/hobert/protocols. whole nervous system (see Fig. 6A). Like unc-119::gfp (Maduro and htm). The sra-11::gfpconstruct is termed psra-11-3::gfp and contains 1954 Z. Altun-Gultekin and others Fig. 1. Expression of homeobox genes in the AIY interneuron class. (A)Overlap of a DIC and a fluorescent image showing expression of a ttx- 3full::gfp reporter gene construct (schematically shown in part B) in the nucleus of several head neurons of an early L2 stage animal. The fluorescent images were taken in several optical sections and layered upon each other. In this animal (genotype: otEx57) comparably strong expression can be seen in AIY, AIA, ADL and ASI. Within a population, 41/41 otEx57 animals show strong expression in AIY and 39/41 show expression in AIA, 28/41 in ADL and 25/41 in ASI. Similar patterns of expression can be seen with a total of 12 independently obtained extrachromosomal arrays (otEx45-otEx49, otEx57 and otEx97-otEx101). Pharyn. n., pharyngeal neuron. (B)Schematic representation of the expression constructs used. ttx-3resc rescues the thermotaxis phenotype of ttx-3 mutant animals (Hobert et al., 1997), ttx- 3prom::gfpreveals postembryonic expression exclusively in the AIY interneuron class (Hobert et al., 1997), ttx-3full::gfp expressionis shown in A. (C)Schematic representation of the expression of ceh-10::lacZ (Svendsen and McGhee, 1995), ttx-3full::gfp (this study)and ceh-23::gfp (Forrester et al., 1998) reporter constructs in the C. elegans nervous system. Expression in neurons of the tail ganglia is not shown. The name of neurons in which expression of any of the three genes overlaps is bold and underlined. interneuron pair. unc-122::gfp is a reporter gene construct that is strongly and exclusively expressed in coloemocytes and used as an injection marker (P. Loria and O. H., unpublished). Genomic fragments were amplified by PCR and subcloned into the standard GFP vectors pPD95.75 or pPD95.77. kal- 1::gfp, zig-2::gfp, zig-3::gfp, ser-2::gfp and C36B7.7::gfp will be described elsewhere. RESULTS Expression of three homeobox genes in the AIY interneurons We have previously shown that a genomic fragment that contains 3.1 kb of sequence 5¢ of the ttx-3 translational start site as well as the first two exons and introns of the ttx-3 gene directs expression of a gfp reporter gene to a single class of two bilaterally symmetric interneurons, AIYL and AIYR (Hobert et al., 1997). As additional regulatory elements for a 3.9 kb XbaI genomic fragment, which encompasses most of the ttx-3 gene expression may exist in more downstream located coding region of sra-11 and 2.8 kb of sequence upstream of the introns, we inserted gfp coding sequences into a genomic predicted start codon. This construct is different from the one previously construct, which we had previously shown to rescue the ttx-3 published (Troemel et al., 1995) and is more stably expressed in similar mutant phenotype; this construct contains 3.1 kb of 5¢ upstream neuronal subtypes, namely AVB and AIY, but is also weakly expressed sequence and all exons and introns of the ttx-3 gene (Fig. 1). in AIA (see Fig. 5). The flp-1::gfp construct contains a genomic fragment from the 5¢ region of the flp-1 gene (Nelson et al., 1998), Expression of this reporter gene construct is restricted to several which extends from position - 513 to - 9 relative to the flp-1 start codon. head neurons throughout larval and adult stages (Fig. 1). The This construct is strongly and exclusively expressed in the AVK AIY interneuron class consistently expresses the reporter gene; Homeobox genes and interneuron differentiation 1955 slightly weaker but still very consistent expression is also differentiation by analyzing the loss-of-function phenotypes of observed in the AIA interneuron class and less consistent and these genes. To this end, we used the previously identified ceh- weaker expression can be observed in the ADL and ASI sensory 10 null allele, gm58(Forrester et al., 1998) and newly identified classes as well as two pharyngeal neurons. ttx-3 and ceh-23 loss-of-function alleles, which we describe As shown schematically in Fig. 1C, two other homeobox below. genes are also expressed in AIY, ceh-10 and ceh-23. ceh-10 was identified by sequence homology to homeobox genes ceh-23 mutant allele (Hawkins and McGhee, 1990) and independently in a screen We isolated a ceh-23 deletion allele, ms23, through PCR-based for mutants affecting neuronal migration (Forrester et al., screening of a Tc1 transposon library (see Materials and 1998); it contains a paired-type homeobox and represents the Methods). ceh-23(ms23) contains a 1864 bp deletion that C. elegans ortholog of the vertebrate Chx10/Chx10-1 genes, extends from 301 bp 5¢ of the ATG start codon into the last which are expressed in a restricted set of interneurons in the exon of the gene and deletes more than 75% of the coding retina and spinal cord (Chen and Cepko, 2000). ceh-23 was sequence, including half of the homeobox (Fig. 2B). It is thus identified due to its proximity to the C. elegans Hox cluster likely that this allele represents a complete loss-of-function (Wang et al., 1993) and represents a diverged homeobox gene allele. Despite expression of ceh-23 in the CAN neurons, a with no clear ortholog in other species and no conserved motif neuron class that is essential for survival (Forrester and outside the homeodomain (Fig. 2A). Isolation of mutations in homeobox A m-DLX5 genes expressed in the AIY zf-DLX4 interneurons m-DLX2 m-DLX1 We sought to define the regulatory relationship of ceh-10, ttx-3 and ceh-23 as zf-DLX8 Distalless family well as their function in AIY interneuron Dm-DLL m-DLX6 m-DLX7 Fig. 2. ceh-23 and ttx-3 sequences and alleles. Ce-C28A5.4 (A)Relationship of the CEH-23 homeodomain to its most closely related CEH-23 homeodomains. Although the CEH-23 m-EMX1 homeodomain bears a strong affinity to the m-EMX2 distal-less and empty spiracles protein Empty spiracles family Dm-CG9930 families, other C. elegans proteins represent Dm-EMS the trueDll and ems orthologs. CEH-23 appears to have no ortholog in other species, B Ce-CEH-2 suggesting that CEH-23 may have arisen by a gene duplication event in the nematode ceh-23 lineage. C. elegans proteins are bold and underlined. Homeodomains that show the highest similarity to the CEH-23 homeodomain were identified by BLAST searches (including searches of the 11/23/00 ms23 deletion 250bp release of the C. elegans genome, the = homeodomain 11/6/2000 release of the human genome sequence and the 9/16/2000 release of the = LIM domains C Drosophilagenome sequence) and assembled into a phylogenetic tree using the ttx-3 ot23 ks5 ot22 nj14 mg158 pileup/distances/growtree algorithms of the G -> A G -> A G -> A Tc1 T->A GCG package with default parameters. The (splice acceptor site) (splice donor site) (premature stop) (missense) tree is rooted with LIM and POU homeodomain proteins (not shown). (B)ceh- 23(ms23) deletion allele. (C)ttx-3 mutant alleles.The upper panel shows the schematic localization of the nucleotide changes in ttx-3 alleles. The lower panel shows the corresponding amino acid changes in the 1 kb ot22 nj14 mg158 Q303stop F340I homeodomain. mg158 contains a missense Tc1 mutation in one of the most highly conserved 1 10 20 30 40 50 60 residues of the homeodomain, F49 C.e. TTX-3: SKRMRTSFKHHQLRAMKTYFALNHNPDAKDLKQLAAKTNLTKRVLQVWFQNARAKYRREL (homeodomain numbering), which appears to D.m. APTEROUS: T-------------T--S---I------------SQ--G-P--------------W--MM be indispensable for the structural integrity of H.s. LHX2: T-------------T--S---I-------------Q--G----------------F--N- homeodomains (Gehring et al., 1994). nj14 C.e. MEC-3: RRGL--TI-QN--DVLQEM-SNTPK-SKHRRAK--LE-G-SM--I------R-S-E--LK C.e. LIN-11: RRGP--TI-AK--ETL-NA--ATPK-TRHIRE----E-G-NM--I------R-S-E--MK was provided by Ikue Mori; due to its X.l. XLIM-1: RRGP--TI-AK--ETL-AA--ATPK-TRHIRE---QE-G-NM--I------R-S-E--MK molecular similarity to ot22, it was not further X.l. XLIM-3: A--P--TITAK--ETL-NAYNNSPK-ARHVRE--SSE-G-DM--V------R---EK-LK H.s. ISLET-1: TT-V--VLNEK--HTLR-CY-A-PR---LMKE--VEM-G-SP--IR-----K-C-DKKRS characterized. G.g. LMX-1: P--P--ILTTQ-R-AF-AS-EVSSK-CR-VRET---E-G-SV--V------Q---MKKLA 1956 Z. Altun-Gultekin and others A 90 80 n 70 o gi re 60 n e v 50 gi n s i 40 al m 30 ni % a 20 10 0 wildty p ece h-2 3(m s2 3) ttx-3(ks5)ttx-3(m g 1 5 8)ttx-3(ot2 2) ttx-3(ot2 3) Region 1 Region 6 22˚C 16.5˚C 1.3 cm C D ttx-3prom::gfp wildtype ttx-3(ks5) ttx-3(ot22) ttx-3(ot23) ttx-3(mg158) genotype bypasser at 25˚C n expression in AIY daf-7(e1372) 1% 489 strong 99% 10% 0% 0% 0% daf-7(e1372); ttx-3(ks5) 45% 558 dim 1% 75% 4% 2% 8% daf-7(e1372); ttx-3(ot22) 63% 493 very dim 0% 0% 23% 5% 2% daf-7(e1372); ttx-3(ot23) 53% 256 undetectable 0% 15% 73% 93% 90% daf-7(e1372); ttx-3(mg158) 62% 635 n 94 129 81 71 66 daf-7(e1372); ceh-23(ms23) 1% 650 Fig. 3. Phenotypic characterization of ttx-3 and ceh-23 alleles. (A)Thermotaxis assays (see Materials and Methods). Animals were grown at 20°C. Number of assays per genotype: wild type N2=11; ceh-23(ms23)=8; ttx-3(ks5)=6; ttx-3(mg158)=6; ttx-3(ot22)=7; ttx-3(ot23)=8. For each genotype, an average of 284-417 animals were tested per assay. The error bars represent the standard error of the mean. The difference in cryophilic behavior between wild type and ceh-23(ms23) is not statistically significantly different (P>0.3; paired and unpaired Student’s t-test). Our observation of a certain fraction of wild-type animals showing cryophilic behavior is consistent with previous reports (Hedgecock and Russell, 1975; Mori and Ohshima, 1995). (B)Effect of ttx-3 alleles on the level of ttx-3prom::gfp expression in AIY (white arrows point to AIYL/R in different animals). All animals shown contain the integrated ttx-3prom::gfp array mgIs18, which was crossed into the respective mutant backgrounds. In ks5 mutant animals signal strength of mgIs18 is clearly reduced, yet enough freely diffusible GFP protein is made in the cell to allow visualization of the axons. In contrast, mgIs18 expression is mostly undetectable in mg158, ot22, and ot23 mutants. (C)Quantification of the defects shown in B. ‘Dim’ refers to clearly reduced gfp expression with the axons being barely visible, ‘very dim’ to gfp expression that is insufficient to visualize the axons. (D)Dauer assays (see Materials and Methods). Results are from four experiments. Garriga, 1997), ceh-23(ms23) mutant animals are viable amounts of truncated and partially active TTX-3 protein could and display no obvious neuroanatomical, morphological or be generated through incorrect splicing. To undertake a locomotory abnormalities (see Materials and Methods). detailed analysis of AIY interneuron fate in ttx-3 mutants, we thus sought to identify new mutant alleles of the ttx-3 gene, ttx-3 mutant alleles whose molecular nature may more unambiguously imply a Prior to this study, only one ttx-3 allele, ks5, was available. ks5 complete loss of ttx-3function. Through screening for mutants mutant animals show thermotaxis defects that are similar to with characteristic ttx-3-like defects, we identified a total of those seen in animals in which the AIY interneurons have three new ttx-3 alleles, termed mg158, ot22 and ot23 (see been ablated; additionally, when placed over a chromosomal Materials and Methods). All three alleles result in deficiency, ttx-3(ks5) behaves as a complete loss-of-function characteristic thermotaxis defects (Fig. 3A), which mimic the allele (Hobert et al., 1997). However, the molecular nature of thermotaxis defects seen upon laser ablation of the AIY ks5, a splice site mutation, left open the possibility that small interneurons (Mori and Ohshima, 1995). Each allele was Homeobox genes and interneuron differentiation 1957 Fig. 4. Regulation of homeobox gene expression in AIY. (A)ttx-3prom::gfp expression is absent in ceh-10(gm58) animals. Homozygous ceh-10(gm58) offspring of ceh-10(gm58)/+; mgIs18 hermaphrodites arrest as L1 larvae and were identified based on their clr phenotype. Expression was never observed (n>50). (B)ceh-23::gfp expression is dependent on ttx-3. Adult ttx-3(mg158); kyIs5 were scored. Quantification is shown in Table 1. (C)ttx-3prom::gfp expression is unaffected in ceh-23(ms23) null mutant animals (n>50). Note the morphological integrity of the AIY neuron in terms of its cell position and axon morphology. Table 1. Expression of AIY subtype markers in ttx-3 and ceh-23 mutant animals Wild type‡ ttx-3 (ks5)§ ttx-3 (mg158)§ ceh-23 (ms23)§ AIY cell fate marker* L1 Adult L1 Adult L1 Adult L1 Adult ttx-3 Homeobox 100 (n=94) 99 (n=104) 7 (n=128) 10 (n=129) 0 (n=45) 0 (n=72) 100 (n=56) 100 (n=79) ceh-23 Homeobox 87 (n=55) 100 (n=67) 8 (n=40) 0 (n=117) 11 (n=47) 0 (n=87) N.D. N.D. sra-11 Orphan 7TMR 92 (n=73) 75 (n=49) 0¶ (n=75) 4¶ (n=89) 0 (n=84) 0 (55) 94 (53) 4 (105) ser-2 Putative metabotropic 84 (n=32) 91 (n=24) 19 (n=21) 30 (n=91) 27 (n=26) 26 (n=83) 83 (n=24) 85 (n=80) 5-HT receptor kal-1 Secreted protein 95 (n=21) 92 (n=92) 6 (n=29) 0 (n=97) 2 (n=37) 2 (59) 94 (n=32) 93 (n=56) C36B7.7 Secreted protein 70 (n=36) 83 (n=143) 44 (n=54) 35 (n=59) 41 (n=43) 38 (n=26) 65 (n=20) 79 (n=73) unc-17 Vesicular acetylcholine N.D. 87 (n=46) N.D. 26 (n=24) N.D. N.D. N.D. 93 (n=70) transporter As residual expression of some AIY differentiation markers is still occasionally observed in the absence of ttx-3 function, we tested whether ceh-23 has a supplementary but non-essential role in ttx-3 dependent gene regulatory events. For example, a residual amount of CEH-23 protein may still be expressed in ttx-3 mutants and be able to induce small amounts of expression of ttx-3-dependent target genes. We tested this possibility by examining AIY marker gene expression in ceh-23; ttx-3 double mutants and found that the defects were no worse than in the ttx-3 single mutant (data not shown). Thus, while ttx-3 and ceh-23 apparently both contribute to the regulation of the sra-11 gene, the regulation of other ttx-3 target genes appears to be entirely independent of ceh-23function. *Cell fate marker expression was monitored by antibody staining (unc-17) or by examining the expression of gfp reporter gene constructs (ttx-3: mgIs18, ceh- 23: kyIs5, sra-11: otIs62, ser-2: adEx1450, kal-1: otIs33, C36B7.7: utEx54) that were crossed into the respective mutant backgrounds. Expression of the reporter gene in wild-type and mutant phenotypes were compared side-by-side. ‡Numbers are percentages of animals that show expression of the respective marker in the AIY interneuron class. §Numbers are percentages of mutant animals that show ‘wild-type-like’ expression levels of the respective marker. ‘Non-wild-type-like’ expression can be subdivided into weak but detectable expression or entirely absent expression. ¶We had previously noted effects of ttx-3(ks5) on sra-11::gfp expression from an extrachromosomal array, yet found a substantial number of ttx-3(ks5) animals that still express the reporter (Fig. 5B in Hobert et al., 1997). Here, we use a distinct sra-11::gfpconstruct (see Materials and Methods) that is expressed from a chromosomally integrated array. N.D., not determined. defective in autoregulation of a ttx-3prom::gfp reporter gene ceh-10, ttx-3 and ceh-23 constitute a regulatory (Fig. 3B,C) and suppressed the dauer-constitutive phenotype of cascade of transcription factors in the AIY neurons daf-7(e1372) at 25°C (Fig. 3D). While the behavioral defects The availability of mutant alleles in all three homeobox genes of the new alleles were comparable with those seen in the has allowed us to address whether these transcriptional previously available ks5 allele, the autoregulatory defects of the regulators act either in a linear pathway or, alternatively, in new alleles were stronger than in those observed with the ks5 independent pathways within the AIY interneuron class. In a allele (Fig. 3B,C). Sequencing of the new ttx-3 alleles presumptive linear pathway, ceh-10 would likely be the most confirmed the notion that at least two of them (mg158, ot22) upstream acting gene, as ceh-10 expression in AIY is only are likely to be null for ttx-3 function (Fig. 2C). observed during embryogenesis and fades after hatching 1958 Z. Altun-Gultekin and others Fig. 5. Expression of the AIY cell fate marker sra-11::gfp in ttx-3 and ceh-23 mutant animals.sra-11::gfp expression was monitored by mating otIs62 animals that harbor an integrated sra-11::gfp construct with animals of the respective mutant backgrounds. The animals carry a rol-6 injection marker, leading to a slight distortion in the spatial arrangement of neurons. Quantification of the expression data in the AIY interneurons is shown in Table 1. While expression of sra-11::gfp in AVB is strong and highly penetrant in L1 larvae, it is observed less consistently and more weakly in adult animals (compare upper and lower panels; this observation was made with three independently created integrants, otIs62, otIs122 and otIs123). Expression of sra-11::gfp in AVB came to lie out of the plane of focus in the ceh-23(ms23); otIs62 adult animal shown in the lower right panel. Expression of sra-11::gfp in AIA is difficult to consistently detect in larvae, yet clearly visible in adult animals. 64% of wild-type adults show expression (n=45) in AIA and 38% (n=70) of ttx-3(mg158); otIs62 adultsshow expression in AIA (see lower middle panel). (Svendsen and McGhee, 1995), while expression of both ttx-3 in AIY and several other head neurons (H. Buelow, Z. A.-G. and ceh-23 is initiated in embryogenesis and maintained and O. H., unpublished). As the AIY neurons may constitute an throughout adulthood (data not shown). Thus, we first tested integration point of temperature and food sensory inputs whether ceh-10 is involved in initiation of ttx-3prom::gfp and (Hobert et al., 1997; Mori and Ohshima, 1995) and since ceh-23::gfp expression. We found that in the ceh-10 null allele serotonin (5-HT) is involved in food signaling (Sze et al., 2000), gm58, ttx-3prom::gfp expression is abolished in the AIY we reasoned that 5-HT receptors may be expressed in AIY; we interneurons (Fig. 4A). Conversely, a ceh-10::lacZ reporter indeed found that a seven-transmembrane receptor with gene construct is still expressed in ttx-3 mutants (data not similarity to 5-HT and octopamine receptors, termed SER-2 shown). Forrester et al. have previously shown that ceh-10 is (identified by T. Niacaris and L. Avery), is expressed in AIY. required for ceh-23::gfp expression in AIY (Forrester et al., Moreover, an orphan serpentine receptor of unknown function, 1998). These findings demonstrate that ceh-10 either directly SRA-11 (Troemel et al., 1995), an acetylcholine transporter or indirectly regulates both ttx-3 and ceh-23 expression. protein, UNC-17 (Alfonso et al., 1993; J. Duerr and J. Rand, To elucidate the regulatory relationship between ttx-3 and personal communication) and a novel secreted protein of ceh-23, we examined ceh-23::gfp expression in ttx-3 mutant unknown function, C36B7.7 (T. Ishihara and I. Katsura, animals and found that loss of ttx-3 function leads to an almost pers.comm.) had been previously identified as being expressed complete loss of ceh-23::gfp expression in AIY (Fig. 4B; Table in AIY and several other neurons. While the expression of none 1). Conversely, ttx-3prom::gfp expression was unaffected in of these eight markers (ceh-10,ttx-3,ceh-23,kal-1,ser-2,sra- ceh-23 null mutants (Fig. 4C; Table 1). Thus, ceh-10, ttx-3 and 11, unc-17 and C36B7.7) is entirely restricted to AIY, the ceh-23 act in a linear regulatory cascade in the AIY expression of all eight markers exclusively overlaps in the AIY interneurons with ceh-10 regulating the expression of ttx-3, interneuron class. AIY thus has a unique ‘address’, which which then controls ceh-23 expression. defines its identity and allows it to be distinguished from other neurons. This ‘address’ has enabled us to investigate if and how AIY differentiation can be monitored by expression the three homeobox genes ceh-10, ttx-3 and ceh-23 influence of a series of cell fate markers AIY interneuron differentiation. We next investigated how the ceh-10fi ttx-3fi ceh-23 regulatory cascade couples to AIY interneuron development and function. ceh-23 is required to maintain one feature of the AIY Cell type diversification in the nervous system is a consequence differentiation program of differential gene expression within a given neuronal subtype. We examined the function of ceh-23, the transcription factor Hence, individual neuronal subtypes are defined by the that is most downstream in the ceh-10fi ttx-3fi ceh-23 cascade, expression of a specific and unique combination of molecular by analyzing the expression of AIY marker genes in a ceh-23 markers. The AIY interneuron class can be described by such null mutant background. We found that ceh-23 has no impact a unique combinatorial gene expression profile: in a genome- on the regulation of kal-1, C36B7.7, ser-2 and unc-17 sequence based survey of expression patterns of putative expression, yet it affects expression of the orphan seven neuronal cell surface molecules, we identified a FnIII-domain- transmembrane receptor sra-11. While sra-11::gfp expression containing cell surface protein with homology to the human in ceh-23(ms23) L1 larvae appears normal, expression Kallmann’s syndrome gene, termed KAL-1, which is expressed decreases significantly in adult animals (Fig. 5 and Table 1). Homeobox genes and interneuron differentiation 1959 We also tested whether ceh-23 is required for the known Table 2. Neuronal cell fate analysis in ttx-3 mutant animals functions of the AIY interneurons, thermotaxis and dauer Expression in arrest. Both behaviors were normal in ceh-23(ms23) mutant ttx-3(mg158) animals (Fig. 3A,D). We also observed that AIY interneuron Cell fate In wild-type Ectopically structure, i.e. cell body position and axon morphology appears Neuronal cell type marker* location‡ in AIY wild-type in ceh-23 null mutants (Fig. 4C). In summary, ceh- Cells that are related to SMDD ZC21.2::gfp + - 23 has no role in the regulation of known aspects of AIY AIY by lineage§ AVK flp-1::gfp + - function, but it is required for the maintenance of one AIY AWC str-2::gfp + - differentiation characteristic, the expression of the sra-11 AVL unc-25::gfp + - gene. Additionally, ceh-23 may affect other as yet unknown Cells that are synaptically AIZ lin-11::gfp + - parameters of AIY structure and function. connected to AIY and/or AFD gcy-8::gfp + - functionally related¶ AWA odr-10::gfp + - ttx-3 is required for the expression of all known ASE gcy-5::gfp + - AWC str-2::gfp + - subtype-specific aspects of AIY interneuron differentiation Cells with AIY-like axon AIM zig-3::gfp + - projections and/or similar AVK flp-1::gfp + - The finding that loss of ceh-23 function has neither an obvious cell body position** effect on axonal morphology of the AIY interneurons nor on Cells that express ttx-3 in ADL srb-6::gfp + - the known behaviors mediated by the AIY interneurons wild-type animals ADL sre-1::gfp + - demonstrates that the function of ttx-3, the upstream regulator ASI srd-1::gfp + - of ceh-23, must go beyond regulation of the ceh-23 gene, as ASI osm-10::gfp + - ttx-3 animals display severe axonal and functional defects of ASI daf-7::gfp + - ASI zig-2::gfp + - the AIY interneurons (Fig. 3 and see Fig. 7). We examined ASI zig-3::gfp + - parameters of AIY differentiation in ttx-3(mg158) mutant AIA sra-11::gfp +/- ‡‡ - animals using the AIY cell fate markers described above. We found that the expression of every known AIY subtype marker *ZC21.2::gfp=kyIs123(Colbert et al., 1997); flp-1::gfp=otEx93 (Materials and Methods); str-2::gfp=kyIs140(Sagasti et al., 1999); unc-25::gfp=juIs8 depends on ttx-3 function (Fig. 5 and Table 1). Expression of (Jin et al., 1999); lin-11::gfp=mgIs21 (Hobert et al., 1998); gcy-5::gfp=ntIs1; ceh-23, kal-1, C36B7.7, ser-2, unc-17 and sra-11 is either gcy-8=oyIs17 (Yu et al., 1997); odr-10::gfp=kyIs37 (Sengupta et al., 1996); significantly reduced or absent in ttx-3(mg158) and ttx-3(ks5) zig-2::gfp=otIs7, zig-3::gfp=otIs14 (O. Aurelio and O. H., unpublished); srb- mutant animals (Fig. 5 and Table 1). As shown in Fig. 5, the 6::gfp=gmIs12; sra-11::gfp=otIs62 (Troemel et al., 1997); daf-7::gfp=saIs7 effect of loss of ttx-3 function on expression of the sra-11 gene (Schackwitz et al., 1996). Reporter gene arrays were crossed into ttx- 3(mg158) animals. is stronger (loss in larvae and adults) when compared with the ‡+, animals that show expression that is comparable with wild-type loss of ceh-23 function (loss only in adults), suggesting that expression (n>20). the effect of ttx-3 on sra-11 gene expression cannot be solely §This category includes neurons that show a lineage history that differs explained by loss of ceh-23 function. Rather, both ttx-3 and from AIYL/R at only one step in the invariant cell division pattern that generates AIYL/R (Sulston, 1983). ceh-23 seem to be contributing individually to the regulation of sra-11 expression. The finding that ttx-3 is required for AIYL/R: AB pl/rpapaaap expression of all known AIY subtype markers is in accordance SMDDL/R: AB ––/––––––-a (=sister cell) AVKL/R: AB ––/––––-p–– with the complete loss of AIY function in thermotaxis and AVL: AB ––/–––––p–- dauer arrest as shown in Fig. 3 and suggests that ttx-3 is a AWCL/R: AB ––/––-a–––– central regulator of AIY interneuron differentiation. At this ¶AIY receives major synaptic input from the AFD, AWA, AWC and ASE point it can not be assessed how aberrant expression of these sensory neurons and makes prominent synapses onto AIZ (White et al., marker genes relates to the defects of AIY structure and 1986). AFD, AIY and AIZ are functionally interconnected neurons in the function in ttx-3 mutants, as mutations in these marker genes thermotaxis circuit (Mori and Ohshima, 1995). **AIML, AIYL and AVKL are located in a characteristic row of three cells have – with the exception of unc-17 – not been described so behind the excretory cell in adult animals (Sulston et al., 1983; White et al., far. unc-17 null mutants die as embryos (Alfonso et al., 1993) 1986). Additionally, AIM extends a monopolar axon into the nerve ring that and can thus not be readily tested for AIY structure and closely resembles that of AIY (White et al., 1986). function. unc-17 hypomorphs show normal AIY morphology ‡‡sra-11::gfp expression of the otIs62 strain in the AIA interneurons is (see Table 3). observed in 64% of wild-type animals (n=45) and 38% (n=70) of ttx- 3(mg158); otIs62 animals. As loss of ttx-3 function causes the AIY interneurons to adopt a variably defective axon morphology which is unlike that of any other neuron, we consider it unlikely that a complete lost several, if not all, of its subtype-specific characteristics and transformation from AIY fate to the fate of another neuron remains in an at least partially undifferentiated state. has taken place. We nevertheless tested this possibility by examining the expression of a spectrum of markers for other ttx-3 and ceh-10 separate pan-neuronal from cell fates in ttx-3 mutant animals. We monitored fate markers subtype-specific characteristics expressed in cells that are related to AIY by either lineage, In ttx-3 mutant animals, the AIY interneuron class may have synaptic connectivity, function or axon morphology (Table 2). either completely lost all components of its neuronal identity We found that none of these markers are ectopically activated or it may have exclusively lost subtype-specific aspects of its in AIY in ttx-3(mg158) mutant animals and thus found no differentiation program, while still maintaining nonspecific evidence that AIY has adopted other distinct cell fate features aspects of neuronal identity. We set out to distinguish between (Table 2). We instead favor the possibility that AIY has simply these possibilities by examining the expression of reporter gene 1960 Z. Altun-Gultekin and others Fig. 6. Examination of pan- neuronal cell fate in ttx-3 mutants. (A)Expression of three pan- neuronal markers, unc-119::gfp (otIs45), unc-33::gfp (otEx75)and F25B3.3::gfp (evIs111), in wild- type L1 larvae (see also Materials and Methods). (B)F25B3.3::GFP is expressed in postmitotic neurons. Three evIs111 embryos are shown in a fluorescence micrograph (left panel) and a corresponding DIC micrograph (right panel); the embryos are at the threefold stage (>500 minutes; upper left), the 1.5- fold stage (>400 minutes; upper right) and approximately the 350 minute stage (lower right). Most embryonically generated neurons have been born by the 350 minute stage (Sulston et al., 1983). (C)Expression of pan-neuronal markers in ttx-3(mg158)animals. Fluorescence micrographs and the corresponding DIC images are shown side by side. The three white arrows point to the characteristic row of three neurons behind the excretory cell, AIM, AIY and AVK. Animals are late larvae/young adults. 100% ttx- 3(mg158); evIs111 animals showed expression in AIY (n=25; large white arrow). Expression of otIs45 and otEx75 is mosaic in wild-type animals. 90% of otIs45animals show gfp expression in AIY (n=39); in ttx-3(mg158);otIs45, 88% of animals show gfp expression in AIY (n=48). In otEx75, 62% of animals show expression in AIY (n=24); in ttx- 3(mg158); otEx75, 53% of animals show expression in AIY (n=28). tools that monitor aspects of pan-neuronal and non-subtype- that several AIY subtype markers failed to be expressed in ceh- specific neuronal differentiation. Besides the previously 10-null mutants (Fig. 4 and data not shown). To address described unc-119 gene (Maduro and Pilgrim, 1995), we whether AIY lost pan-neuronal characteristics in ceh-10-null constructed two other pan-neuronally expressed marker genes, mutants, we examined expression of the F25B3.3::gfp pan- unc-33::gfp and F25B3.3::gfp (see Materials and Methods). neuronal marker in ceh-10-null mutants and found it to be unc-33::gfp, like unc-119::gfp, marks all neuroblasts and unaffected (Fig. 6C). The integrity of AIY generation and differentiated neurons, while F25B3.3::gfp is a marker for all positioning in ceh-10(gm58)had also been noted previously by postmitotic neurons (Fig. 6A and Materials and Methods). We DIC microscopy (Forrester et al., 1998). Thus, ceh-10 and ttx- crossed each of the three pan-neuronal marker genes into ttx- 3 both act downstream or in parallel to the determination of 3(mg158) mutant animals and found that loss of ttx-3 function pan-neuronal cell fate but upstream of the determination of the has no appreciable effect on the expression of any of these subtype-specific differentiation program. marker genes in AIY (Fig. 6C). These findings show that the adoption of subtype-specific characteristics can be separated Ectopic ttx-3 expression reveals ceh-10-dependent from the adoption of pan-neuronal characteristics and that ttx- constraints on ttx-3 function 3 is required for the former but not the latter aspect of AIY The results shown above reveal that ttx-3 is an essential development. regulator of subtype-specific aspects of the AIY differentiation As ceh-10 acts upstream of ttx-3, it can be assumed that AIY program. To address whether ttx-3 is also sufficient to induce development is at least as severely affected in ceh-10 mutants AIY-like features in other neurons, we ectopically expressed as it is in ttx-3 mutants. Consistent with this notion we found ttx-3 throughout the nervous system, using the pan-neuronal