loading

Logout succeed

Logout succeed. See you again!

ebook img

Imaging spin properties using spatially varying magnetic fields PDF

file size0.97 MB
languageEnglish

Preview Imaging spin properties using spatially varying magnetic fields

Imaging spin properties using spatially varying magnetic fields V. P. Bhallamudi,1 A. J. Berger,2 D. E. Labanowski,1 D. Stroud,2 and P. C. Hammel2 1Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210, USA 2Department of Physics, The Ohio State University, Columbus, Ohio 43210, USA (Dated: January 18, 2011) We present a novel method to image spin properties of spintronic systems using the spatially confined field of a scanned micromagnetic probe, in conjunction with existing electrical or optical global spin detection schemes. It is thus applicable to all materials systems susceptible to either of thoseapproaches. Theproposedtechniquereliesonnumericalsolutionstothespindiffusionequation 1 inthepresenceofspatiallyvaryingfieldstoobtainthelocalspinresponsetothemicromagneticprobe 1 field. ThesesolutionsalsoprovideinsightintotheeffectsofinhomogeneitiesonHanlemeasurements. 0 2 PACSnumbers: 75.76.+j,75.40.Gb,85.75.-d,75.78.-n n a J Spinelectronicsisarichandrapidlygrowingfieldthat Spin dynamics in nonmagnetic materials are given by 5 integratesmagneticandnonmagneticmaterialstoenable 1 a variety of spin polarized transport phenomena [1, 2]. ∂S =D ∇2S+γB×S− S +G, (1) Muchprogresshasbeenmadeinunderstandinginjection ∂t s τs ] l of spins into non-magnetic semiconductors, the manipu- al lation of those spins within the semiconductor, and both where S is the spin density, Ds is the spin diffusion con- stant, γ = gµ /¯h is the gyromagnetic ratio, B is the h B local and global detection of the spin states [3–6]. Sev- - total magnetic field experienced by the spins, τs is the s eral recent results have brought us closer to electrically- spin relaxation time, and G represents the spin genera- e controlled room-temperature spintronic devices [7–15]. m tionterm,e.g. irradiationwithcircularlypolarizedlight. However, much is still not well understood, particularly S is a function of time t and spatial position r = (x,y) t. regardingthemechanismsthatdegradespinpolarization, for the 2D sample that we consider. a intheoftencomplexmagneticenvironmentthatprevails m The spatially dependent response of the spin polariza- in spintronic devices. Spin lifetimes inferred from mea- tion to the magnetic field of the probe tip can be calcu- - surementsareoftenmuchshorterthantheoreticalexpec- d lated by means of a numerical technique we have devel- n tations and the influence of impurities, inhomogeneities oped for solving the spin diffusion equation in the pres- o andotherdeparturesfromidealstructuresremainpoorly ence of spatially varying vector magnetic fields. Vector c understood. [ precessionisanaddedcomplexitywhichisnotpresentin the case of (scalar) charge deflection by a scanned gate. 3 Atechniquewhichcouldspatiallyresolvethelocalvari- Our technique gives steady state spatial maps of spin v 7 ations of spin density and other key parameters, such as density as a function of the location of the micromag- 4 spinlifetime,inmulticomponentspintronicdeviceswould netic probe over the sample. The numerical solution 7 have enormous impact. Here we show that local infor- is obtained from the time-dependent form of the diffu- 3 mation about the spin properties can be encoded in the sion equation using Euler’s iterative method (please see . 0 variation of the global spin polarization in response to supplementary material for further details). Though we 1 a spatially scanned magnetic field from a micromagnetic do not consider electric fields nor take B, G and τ to s 0 probe. In analogy with electrostatic tip-induced scatter- betime-dependentthesesituationsarestraightforwardly 1 ing in a two-dimensional electron gas [16] the local mag- handled by our approach. : v netization is modified to an extent determined by both We consider spins injected uniformly into the sample i X thevectorfieldofthemicromagneticprobeandthelocal bysomemeans(uniformityisnotanecessarycondition). spin properties. This local perturbation is detected by The injected spins and the scanned dipole are assumed r a established global spin polarization measurement tech- tobeorientedalongˆz. Thissamplehasasmalllocalized niques(suchasspinphotoluminescenceornon-localvolt- regioninwhichthespinlifetimeisfivetimeslongerthan age) which, in themselves, need not provide spatially re- the rest of the sample. Panels (b) and (c) of Fig. 1 show solvedinformation,hencethemethodisapplicabletoany spatial maps of S , the component of the spin density z materials system (whether optically active or inactive). parallel to the injected spin direction, for two positions A schematic of our proposed imaging technique is shown oftheproberelativetothelifetimeinhomogeneity. Panel in Fig. 1(a). As a magnetic dipole is scanned above the (d)presentstheimageofS ,theintegralofS overthe z,g z sample the dependence of a globally detected spin signal entiresample,asafunctionofthepositionofdipoleover on position of the probe provides a map of the sample’s thesample. Theregionofslowerrelaxationrateisclearly spin properties. distinguished from the rest of the sample. 2 uniform systems, the steady-state value of S is propor- (cid:107) tional to (1+θ2)−1). B We are interested in spatially varying fields arising from a micromagnetic tip. The dipole field arising from a magnetic moment m = m zˆ located at (0, 0, z ) over z p a sample in the xy-plane results in a spatial variation of spin density S shown in Fig. 2 (left axis) along with z θ (right axis). Here we assume a sample with uni- B form τ and uniform injection of spins oriented parallel s to zˆ and approximate the probe field by B (x,y) = dip µ0[(3R(m·R)−mR2]/R5, where R = xxˆ +yyˆ +z zˆ 4π p and µ is the permeability of free space. Fig. 2 shows S 0 z bothwithandwithoutdiffusion. Theanticorrelationbe- tweenS andθ isparticularlyevidentwhendiffusionis z B neglected because a given spin experiences a single mag- netic field throughout its lifetime. Diffusion smears out the sharp features, and if the minima in S (for D =0) (cid:107) s occur closer than a spin-diffusion length L away from s the central peak, then the peak will collapse leaving a localized volume of suppressed spin density. This local suppression of the spin polarization by the probetipfieldprovidesthebasisforscannedprobeimag- ing of a spintronic sample: the impact of this tip field is determined by local sample properties. The image con- trast in Fig. 1(d) results from the fact that long-lived spins are more strongly dephased because they experi- ence the tip field for a longer time before being replaced by fresh, well-oriented spins. Thus, the globally aver- aged spin density of the sample will be more strongly FIG. 1: [Color online] Calculated vector magnetization suppressed when the dipole is over the region of longer demonstrating imaging of local properties using global mea- τ . The size of this effect depends on the “global” size surements: (a) Measurement geometry of our proposed ex- s over which the spin polarization is integrated. periment. Embedded in a uniform plane is a small region (dotted line) in which τ is five times larger than throughout Toestimatethespatialresolutionofourimagingtech- s theremainingarea. The2Dsampleisuniformlypumpedwith nique, we consider the effect of a linear magnetic field spins. A probe is positioned above the sample at a distance gradient: B = α(yyˆ −zzˆ) (see Fig. 3). The injected z and its xy-coordinates are scanned to obtain the image p spins are uniformly oriented along zˆ. The resulting vari- presented in panel (d). (b,c) Spatial map of S (x,y) when z ation of S along the y-axis, for α = (γτ L )−1, where the enhanced τ region is found at (2L ,2L ) and (6L ,6L ) (cid:107) s s s s s s s relative to the tip. (d) S , the globally integrated S over z,g z theentiresampleasafunctionofprobeco-ordinates(x ,y ). p p The sensitivity of spin polarization to the position of the probe arises from the interrelationship of the two mechanisms that alter spin polarization: spin relaxation and dephasing of spins in an ensemble as they precess about the spatially inhomogeneous magnetic field vec- tors. Fields parallel and perpendicular have contrast- ing impacts since magnetic field parallel to the injected spin direction will tend to maintain this orientation and maximizespinpolarization,whiletransversecomponents FIG. 2: [Color online] (a) Steady state spin density S (x,y) z cause precession, thus dephasing and a reduction of spin for y = 0 in the presence of the field of a dipole for D = 0 s polarization. Thiscompetitionbetweenthevariouscom- (red)andD τ /z2 =1(blue). Thedipolem zˆ [hereµ m = s s p z 0 z ponentsofthemagneticfieldiswellcapturedbyaquan- 10πz3)] is located at r = (0,0,z ) and uniform injection is p p tity θ2 = γ2B2τ2/(1+γ2B2τ2), which governs the av- assumed. The green curve shows the spin dephasing factor B ⊥ s (cid:107) s θ (x); note that θ =1 =⇒ S =0.5 for D =0. erage projection of the spins along the (cid:107)-axis (e.g., for B B z s 3 gions of suppressed magnetization shown in Fig. 2) can- not be smaller than the probe-sample separation, z , so p for large z this will set the resolution. p Understanding the impact of microscopic inhomo- geneities on spin transport is a centrally important issue that calls for spatially resolved studies. Particularly im- portantareinhomogeneitiesduetothestrayfieldsarising fromimperfectferromagneticinjectorsusedforelectrical injection [13, 15, 23, 24]. Spin lifetime is typically ob- tained from the width of Hanle curves, but such global measures of spin polarization are sensitive to inhomo- geneities, so microscopic approaches are needed to dis- cernthevariousmechanisms thatcanaffectthe shape of a Hanle curve. Non-uniformity of the interface and complex domain FIG. 3: [Color online] The resolution length scale L as a structures can cause the injected spin population to r function of magnetic field gradient α, where length is scaled experience significantly different magnetic fields, and bythediffusionlengthLs,andfieldisintheunitsof(γτs)−1. lose spin-information on time scales much shorter than (inset) Variation of S along the y-axis in the presence of a z spin lifetime due to dephasing. Our numerical method field of the form B = α(yyˆ −zzˆ). A Gaussian fit to the is capable of simulating the impact of magnetic fields numerically simulated data S is shown. The width of the z Gaussian may be considered to be the resolution for a given with random spatial variation. Fig. 4 shows calculated gradient. Hanle curves in the presence of random magnetic fields. We consider a field B = N (0,B )xˆ + N (0,B )yˆ + r x v y v N (0,B )zˆ where we sample normal distributions of z v (γτ )−1 is the half-width of the conventional Lorentzian mean zero and variance B for each field component at s v Hanle curve [17], is presented in the inset of Fig. 3. A every spatial point. Fig. 4 shows results for three values Hanle curve is simply a plot of the dependence of spin of B :(cid:28) (γτ )−1, = (γτ )−1, and > (γτ )−1. We see v s s s polarization on a transverse magnetic field. In the ab- that the maxima can be shifted and, as in the last case, sence of diffusion, spins at different positions along the the curves can be significantly broadened. y-axis will sample different fields, resulting in a map- Itisinstructivetoconsider, inturn, theeffectsofeach ping of the conventional Hanle curve onto the spatial magnetic field component on the Hanle curve, as is done domain. Thus, spins will exist primarily in the region inFig. 5. ForanappliedHanlefieldB =B yˆ,thehalf- h h where |B| ≤ (γτ )−1, i.e., where |y| ≤ (γτ α)−1. The widthathalf-maximumB ofaHanlecurveinthepres- s s 1/2 location of the surviving spin magnetization can be spa- enceofanadditionaluniformfieldB =B xˆ+B yˆ+B zˆ u x y z (cid:112) tially shifted by adding a uniform offset to the gradient is given by γτ B = 1+γ2τ2(B +B )2. A trans- s 1/2 s x z field. verse field B reduces S (B = 0) (blue curve) and x z,g h A measure of the resolution may be obtained from the B ∼B is required to significantly reduce S further. h x z,g width of a Gaussian fit, L , to this curve. Fig. 3 shows A non-zero B (red curve) on the other hand will not r z this width as a function of the applied gradient. The reduce S (B = 0) but will broaden the Hanle curve, z,g h spatial resolution L decreases in inverse proportion to since B ∼ B is required to significantly increase the r h z the gradient until Lr <∼ Ls below which its rate of de- spin precession cone angle. A field By (parallel to Bh) creases slows. This situation is reminiscent of Magnetic shifts the peak of the Hanle curve, since S is maxi- z,g Resonance Imaging (MRI) where spatial information is mizedwhenthetotaltransversefieldiszero(blackcurve). encoded into field or frequency shifts through magnetic The results of Fig. 4 can be considered a superposition field gradients [18]. As in MRI, diffusion degrades res- of the shifting and broadening seen in Fig. 5. Clearly olution, though in the current approach it can be finer these effects can confound the determination of spin life- than the spin diffusion length if one uses strong enough times from Hanle widths. The detailed features of the gradients,asseeninnumericalsimulationsshowninFig. stray field generated by a rough ferromagnetic injector 3. Furthermore,itshouldbenotedthatdiffusionlengths will depend on several characteristics including rough- for many spintronic systems are of the order of a mi- ness, saturation magnetization, domain size, and thick- cron, especially at room temperatures. Field gradients ness. Regardless of these details, stray fields of the order exceeding 10 G/nm are achievable with rare-earth mi- kiloGauss are readily achievable a few nanometers away cromagnetic tips [19] such as are used in Magnetic Force from a rough injector and these can substantially affect Resonance Microscopy [20–22] indicating that high spa- the spin polarization. In fact this has been experimen- tialresolutionispossiblewiththistechnique. Inthecase tally observed in silicon devices [24]. of imaging with a dipole tip, the gradients (and the re- In summary, we have proposed a new technique for 4 lifetime measurements, as in Hanle curves. Microscopic imaging of spin properties of real-world devices will be essential for improving their spin fidelity and functional- ity. We gratefully acknowledge enlightening discussions with Ron Jansen. This work was supported by National Science Foundation through the Materials Research Sci- ence and Engineering Center at The Ohio State Univer- sity (DMR-0820414) and Department of Energy, Office of Science (DE-FG02-03ER46054). FIG. 4: [Color online] Global Hanle curves for a sample with randomlyspatiallyvaryingmagneticfield,B =N (0,B )xˆ+ Supplementary Information r x v N (0,B )yˆ + N (0,B )zˆ. Such fields may be expected in y v z v electricalinjectiondeviceswithroughinjectors. Theinjected Spindynamicsinnonmagneticmaterialsaredescribed spins are assumed to be along the x-axis in this simulation. by ∂S S =D ∇2S+γB×S− +G, (2) ∂t s τ s where S is the spin density, D is the spin diffusion con- s stant, γ = gµ /¯h is the gyromagnetic ratio, B is the B total magnetic field experienced by the spins, τ is the s spin relaxation time, and G represents the spin genera- tion term e.g., irradiation with circularly polarized light. S is a function of time t and spatial position r = (x,y) for the 2D sample that we consider. While all of the terms can be functions of t and r, we will consider B, G and τ which are independent of t, and D will be in- s s FIG.5: [Coloronline]GlobalHanlecurvesforvariouscasesof dependent of both space and time. The formalism can spatially uniform magnetic fields, B , applied in addition to u be readily extended to include electric fields, spin-orbit thesweptHanlefield,B . Thesecurvesarevalidforallvalues h effects, hyperfine coupling and a third spatial dimension of D since globally averaged spin density is insensitive to s for a more comprehensive treatment. Also, we are usu- diffusion (see Supplementary Information), when the sample dimensions are much greater than L . allyinterestedinthesteady-statesolution∂S/∂t=0and s S , the parallel component of S. We will refer to “paral- (cid:107) lel”and“perpendicular”withrespecttotheinjectedspin imaging spin properties of spatially inhomogeneous sam- direction. ExperimentallyS isthemostcommonlymea- (cid:107) ples that achieves applicability to a wide variety of ma- sured quantity. However, it should be noted that we can terials by relying on proven spin polarization detection evaluate any component of the spin in our simulations. techniques such as electrical and optical detection. The If B and τ are position-independent, the steady-state s localizedinformationisobtainedbydetectingthemodifi- differentialequationcanbesolvedanalyticallybyFourier cation to the local spin density by the confined magnetic transform. In the steady state, the Fourier-transformed field of a magnetic dipole scanned over the sample. To equation for the spin density S(k) takes the form thisend,wehavedevelopedamethodforsimulatingspin density in a medium with spatial or temporal inhomo- −k2D S(k)+γB×S(k)−S(k)/τ +G(k)=0 s s geneities of the magnetic field, lifetime, or diffusion con- =⇒S(k)=[(k2D +τ−1)I−B]−1G(k) (3) s s stant, regardless of injection or detection technique. As in MRI, this technique has a spatial resolution inversely where S(k) and G(k) are vectors. I is the 3×3 unit proportionaltothegradientofthemagneticfielddownto matrix. We introduce the 3 × 3 matrix lengthscalescomparabletothespindiffusionlength. Be-   lowthis,resolutionimprovesmoreslowlywithincreasing 0 B −B z y gradient. Our numerical analysis of spin transport em- B =γ−Bz 0 Bx , phasizestheimportanceofexperimentalcharacterization B −B 0 y x of microscopic inhomogeneity, and of models that incor- porate these phenomena. In particular, inhomogeneities The real-space spin density is then given by the inverse can confound the interpretation of spin polarization and Fourier transform of S(k). 5 Animportantcaseexperimentallyisgivenbytheglob- where δˆ represents the unit vectors along the spatial ally averaged spin polarization grid. We iterate until S does not change appreciably with time. We have verified that the analytical results S(cid:107),g = τ(cid:82)(cid:82)ASG(cid:107)(r()rd)2dr2r, (4) fdruocmedthbeyatnhaislymticeathloedx.prSeessvieornasl dexerpievreidmaenbtoavlegalorebarleparnod- s A (cid:107) spatially localized Hanle curves measured under varying forG=G ˆ(cid:107)andtheareaofintegration,A,extendsover conditions[3, 6] can also be qualitatively reproduced by (cid:107) the entire space. Note that S ∝ S (k = 0) and thus this method. z,g (cid:107) from Eq. 3 is independent of D and is given by s 1 S = (5) (cid:107),g 1+θ2 B [1] I. Zˇuti´c, J. Fabian, and S. D. Sarma, Rev. Mod. Phys. where θ is an effective dephasing factor given by (2004). B [2] D.D.AwschalomandM.E.Flatte,NaturePhys.3,153 γ2B2τ2 (2007). θ2 = ⊥ s (6) B 1+γ2B2τ2 [3] F. Jedema et al., Nature 416, 713 (2002). (cid:107) s [4] S. Crooker et al., Science 309, 2191 (2005). [5] X. Lou et al., Nature Phys. 3, 197 (2007). Spins precess in a cone whose opening half-angle is that [6] M. Furis et al., New J. Phys. 9, 347 (2007). between the total vector magnetic field and the injected [7] T. Sasaki et al., IEEE Trans. Magn. 46, 1436 (2010). spin orientation. In combination with this precession, [8] T. Sasaki et al., Appl. Phys. Lett. 96, 122101 (2010). the continuous injection of spins causes a distribution of [9] K. Pi et al., Phys. Rev. Lett. 104, 187201 (2010). phases, relative to ˆ(cid:107), weighted by the spin lifetime. A [10] B. Huang and I. Appelbaum, Phys. Rev. B 77, 165331 parallel field reduces the cone opening angle resulting in (2008). [11] I. Appelbaum, B. Huang, and D. J. Monsma, Nature a spin ensemble more aligned with the injected spin di- 447, 295 (2007). rection,whileB hastheoppositeeffect. Thedephasing ⊥ [12] H. C. Koo et al., Science 325, 1515 (2009). factor θ (representing the competition between parallel B [13] S.P.Dashetal.,Nature462,491(2009),supplementary and transverse fields) describes the projection of spins information. along the injection axis and the behavior of S . [14] J. Wunderlich et al., 1008.2844 (2010). (cid:107),g The experimentally relevant situation will usually in- [15] R. Jansen et al., Phys. Rev. B 82, 241305 (2010). volve spatially varying fields. If B is position-dependent [16] M. Topinka et al., Nature 410, 183 (2001). [17] F. Meier and B. P. Zakharchenya, Optical Orientation and D (cid:54)= 0, Eq. 2 cannot be solved analytically in s (North-Holland, Amsterdam, 1984). real or Fourier space for steady-state. We have found [18] P. T. Callaghan, Principles of Nuclear Magnetic Reso- thatsolvingtheoriginaltime-dependentequationnumer- nance Microscopy (Clarendon Press, Oxford, 1991). icallyusinganEulermethodworkswellforthisproblem. [19] C.L.Degenetal.,Proc.Natl.Acad.Sci.USA106,1313 In this approach, we start from some initial condition, (2009). S(r,t = 0), then iterate in time using a time step ∆t, [20] J. A. Sidles, Appl. Phys. Lett. 58, 2854 (1991). according to the relation [21] D. Rugar, C. S. Yannoni, and J. A. Sidles, Nature 360, 563 (1992). (cid:20) [22] P.C.HammelandD.V.Pelekhov,inHandbook of Mag- S(r,t+∆t) = S(r,t)+∆t× Ds∇2S(r,t) netism and Advanced Magnetic Materials, edited by H. Kronmu¨llerandS.Parkin(JohnWiley&Sons,Ltd.,New (cid:21) S(r,t) York, NY, 2007), Vol. 5, Chap. 4. + γB(r)×S(r,t)− +G(r) τ [23] C. Awo-Affouda et al., Appl. Phys. Lett. 94, 102511 s (2009). The Laplacian is evaluated numerically on a spatial grid [24] S.P.Dashet al.,arXiv:1101.1691v1[cond-mat.mes-hall] (2011). of points separated by a suitable distance ∆x, and is approximated as ∇2S(r,t)∼ 1 (cid:88)[S(r+∆xδˆ,t)−S(r,t)] (7) (∆x)2 δˆ

See more

The list of books you might like