Logout succeed
Logout succeed. See you again!

Information Hiding: 8th International Workshop, IH 2006, Alexandria, VA, USA, July 10-12, 2006. Revised Selcted Papers PDF
Preview Information Hiding: 8th International Workshop, IH 2006, Alexandria, VA, USA, July 10-12, 2006. Revised Selcted Papers
Lecture Notes in Computer Science 4437 CommencedPublicationin1973 FoundingandFormerSeriesEditors: GerhardGoos,JurisHartmanis,andJanvanLeeuwen EditorialBoard DavidHutchison LancasterUniversity,UK TakeoKanade CarnegieMellonUniversity,Pittsburgh,PA,USA JosefKittler UniversityofSurrey,Guildford,UK JonM.Kleinberg CornellUniversity,Ithaca,NY,USA FriedemannMattern ETHZurich,Switzerland JohnC.Mitchell StanfordUniversity,CA,USA MoniNaor WeizmannInstituteofScience,Rehovot,Israel OscarNierstrasz UniversityofBern,Switzerland C.PanduRangan IndianInstituteofTechnology,Madras,India BernhardSteffen UniversityofDortmund,Germany MadhuSudan MassachusettsInstituteofTechnology,MA,USA DemetriTerzopoulos UniversityofCalifornia,LosAngeles,CA,USA DougTygar UniversityofCalifornia,Berkeley,CA,USA MosheY.Vardi RiceUniversity,Houston,TX,USA GerhardWeikum Max-PlanckInstituteofComputerScience,Saarbruecken,Germany Jan L. Camenisch Christian S. Collberg Neil F. Johnson Phil Sallee (Eds.) Information Hiding 8th International Workshop, IH 2006 Alexandria, VA, USA, July 10-12, 2006 Revised Selcted Papers 1 3 VolumeEditors JanL.Camenisch IBMResearch CH-8803Rüschlikon,Switzerland E-mail:[email protected] ChristianS.Collberg TheUniversityofArizona Tucson,AZ85721,USA E-mail:[email protected] NeilF.Johnson Johnson&JohnsonTechnologyConsultants Vienna,VA22183,USA E-mail:nfi@jjtc.com and BoozAllenHamilton B-8042,8283GreensboroDrive,MCLean VA22102,USA E-mail:[email protected] PhilSallee BoozAllenHamilton B-8042,8283GreensboroDrive,MCLean VA22102,USA E-mail:[email protected] LibraryofCongressControlNumber:2007935081 CR Subject Classification (1998): E.3, K.6.5, K.4.1, K.5.1, D.4.6, E.4, C.2, H.4.3, H.3,H.5.1 LNCSSublibrary:SL4–SecurityandCryptology ISSN 0302-9743 ISBN-10 3-540-74123-2SpringerBerlinHeidelbergNewYork ISBN-13 978-3-540-74123-7SpringerBerlinHeidelbergNewYork Thisworkissubjecttocopyright.Allrightsarereserved,whetherthewholeorpartofthematerialis concerned,specificallytherightsoftranslation,reprinting,re-useofillustrations,recitation,broadcasting, reproductiononmicrofilmsorinanyotherway,andstorageindatabanks.Duplicationofthispublication orpartsthereofispermittedonlyundertheprovisionsoftheGermanCopyrightLawofSeptember9,1965, initscurrentversion,andpermissionforusemustalwaysbeobtainedfromSpringer.Violationsareliable toprosecutionundertheGermanCopyrightLaw. SpringerisapartofSpringerScience+BusinessMedia springer.com ©Springer-VerlagBerlinHeidelberg2007 PrintedinGermany Typesetting:Camera-readybyauthor,dataconversionbyScientificPublishingServices,Chennai,India Printedonacid-freepaper SPIN:12104833 06/3180 543210 Preface These proceedings contain the 25 papers that were accepted for presentation at the Eighth Information Hiding Conference, held July 10–12, 2006 in Old Town Alexandria,Virginia.ThepaperswereselectedbytheProgramCommitteefrom morethan70 submissionsonthe basis oftheir novelty,originality,andscientific merit.Wearegratefultoallauthorswhosubmittedtheirworkforconsideration. The papers were divided into ten sessions [Watermarking, Information Hiding and Networking, Data Hiding in Unusual Content (2 sessions), Fundamentals, Software Protection, Steganalysis, Steganography (2 sessions), and Subliminal Channels],showingthe breadthofresearchinthe field.Thisyearwasanimpor- tant one in the history of the IHW: “Workshop”wasdropped fromthe name to showthatthefieldhasmaturedandthattheconferencehasbecomethepremier venue for the dissemination of new results. The conference employed a double-blind reviewing process. Each paper was examinedby atleastthree reviewers.Paperssubmitted by ProgramCommittee members were held to a higher standard. We relied on the advice of outside colleagues and would like to extend our thanks for their contribution to the paper selection process and their dedication to excellence in research. We thank our sponsors Booz Allen Hamilton and Johnson & Johnson Tech- nology Consultants for their financial and logistic support, including local ar- rangements, printing the pre-proceedings, and organizing the registration. The walkingtourofOldTownAlexandriaorganizedbyIraMoskowitzandthedessert cruiseonboardtheMissChristinwereenjoyablehighlightsofthesocialprogram and we thank the organizers!Roger Zimmermann helped to run the submission server and without the help of Bjo¨rn Assmann you would not be holding these proceedings in your hands. Thank you guys! Finally, we wish to thank the many researchers who have contributed to extending the state of the art for information hiding research and hope these proceedings will be helpful for future developments. January 2007 Jan Camenisch Christian Collberg Neil F. Johnson Phil Sallee Organization Program Committee Ross J. Anderson (University of Cambridge, UK) Mauro Barni (Universita` di Siena, Italy) Jack Brassil (HP Laboratories,USA) Jan Camenisch (IBM Zurich Research Laboratory, Switzerland) Christian Collberg (University of Arizona, USA) Ee-Chien Chang (National University of Singapore, Singapore) Ingemar J. Cox (University College London, UK) Jessica Fridrich (SUNY Binghamton, USA) Neil F. Johnson (Booz Allen Hamilton and JJTC, USA) John McHugh (SEI/CERT, USA) Ira S. Moskowitz (Naval Research Laboratory,USA) Stefan Katzenbeisser (Philips Research, The Netherlands) Darko Kirovski(Microsoft Research, USA) Richard C. Owens (University of Toronto, Canada) Andreas Pfitzmann (Dresden University of Technology, Germany) Phil Sallee (Booz Allen Hamilton, USA) Michiel van der Veen (Philips Research, The Netherlands) External Reviewers Farid Ahmed Andrew Ker Dagmar Scho¨nfeld Richard Bergmair Johannes Kinder Ashwin Swaminathan Mike Bergmann Patty Lafferty Morton Swimmer Rainer Boehme Aweke Lemma James Troupe Roberto Caldelli Keye Martin Dan Wallach Mehmet Celik Ginger Myles Andreas Westfeld Massimiliano Corsini Alessandro Piva Greg Zaverucha Scott Craver Mila dalla Preda Min Wu Alessia De Rosa Victor Raskin Shan He Antje Schneidewind Susan Hohenberger Franz Schneidewind Table of Contents Hamiltonian Mechanics Natural Watermarking: A Secure Spread Spectrum Technique for WOA .......................................................... 1 Patrick Bas and Fran¸cois Cayre An Improved Asymmetric Watermarking System Using Matrix Embedding ..................................................... 15 Scott Craver A Cryptographic Method for Secure Watermark Detection ............ 26 Michael Malkin and Ton Kalker Steganographic Communication in Ordered Channels................. 42 R.C.Chakinala, A.Kumarasubramanian,R.Manokaran, G.Noubir, C. Pandu Rangan, and R. Sundaram Analyzing Network-Aware Active Wardens in IPv6................... 58 Grzegorz Lewandowski, Norka B. Lucena, and Steve J. Chapin Video Watermarking by Using Geometic Warping Without Visible Artifacts Video Watermarking by Using Geometric Warping Without Visible Artifacts........................................................ 78 Dima Pro¨frock, Mathias Schlauweg, and Erika Mu¨ller Time-Scale InvariantAudio WatermarkingBasedon the Statistical FeaturesinTimeDomain ......................................... 93 Shijun Xiang, Jiwu Huang, and Rui Yang Content-Aware Steganography: About Lazy Prisoners and Narrow-Minded Wardens.......................................... 109 Richard Bergmair and Stefan Katzenbeisser Noisy Timing Channels with Binary Inputs and Outputs.............. 124 Keye Martin and Ira S. Moskowitz A Computational Model for Watermark Robustness .................. 145 Andr´e Adelsbach, Stefan Katzenbeisser, and Ahmad-Reza Sadeghi Hiding Information Hiding ........................................ 161 Adam Young and Moti Yung VIII Table of Contents Reversible Watermarking of NURBS-Based CAD Models.............. 172 Wolfgang Funk A High-Capacity Data Hiding Method for PolygonalMeshes........... 188 Hao-tian Wu and Yiu-ming Cheung Steganographyfor Radio Amateurs—A DSSS BasedApproachfor Slow Scan Television .................................................. 201 Andreas Westfeld Delayed and Controlled Failures in Tamper-Resistant Software......... 216 Gang Tan, Yuqun Chen, and Mariusz H. Jakubowski A Model for Self-Modifying Code .................................. 232 Bertrand Anckaert, Matias Madou, and Koen De Bosschere A Markov Process Based Approach to Effective Attacking JPEG Steganography................................................... 249 Yun Q. Shi, Chunhua Chen, and Wen Chen Batch Steganography and Pooled Steganalysis ....................... 265 Andrew D. Ker On Steganographic Embedding Efficiency ........................... 282 Jessica Fridrich, Petr Lisonˇek, and David Soukal Bandwidth Optimal Steganography Secure Against Adaptive Chosen Stegotext Attacks................................................ 297 Tri Van Le and Kaoru Kurosawa Modified Matrix Encoding Technique for Minimal Distortion Steganography................................................... 314 Younhee Kim, Zoran Duric, and Dana Richards Statistically Secure Anti-Collusion Code Design for Median Attack Robustness for Practical Fingerprinting............................. 328 Jae-Min Seol and Seong-Whan Kim A Collusion-Resistant Video Watermarking Scheme .................. 343 Amir Houmansadr and Shahrokh Ghaemmaghami An Elliptic Curve Backdoor Algorithm for RSASSA .................. 355 Adam Young and Moti Yung A Subliminal-Free Variant of ECDSA............................... 375 Jens-Matthias Bohli, Mar´ıa Isabel Gonza´lez Vasco, and Rainer Steinwandt Author Index.................................................. 389 Natural Watermarking: A Secure Spread Spectrum Technique for WOA Patrick Bas1,2 and Franc¸ois Cayre2 1 CIS / Helsinki Universityof Technology P.O. Box 5400 FI-02015 HUTFINLAND 2 LIS/INPG 961, rue dela Houille Blanche BP 46 F-38042 St. Martin d’H`eres Cedex, France Abstract. This paper presents a spread spectrum (SS) watermarking techniquethatissecureagainstcarriersestimationinaWatermarkOnly Attackframework.Afterreviewingthesufficientconditionstodesignse- curealgorithmsforwatermarkingandsteganography,wepresentasetup based on Blind Source Separation (BSS) theory to assess the lack of security of classical SS techniques such as classical SS or ISS. We mo- tivate a new SS watermarking algorithm called Natural Watermarking (NW)wheretheestimationofthesecretcarriersisimpossibleandwhich achieves perfect secrecy thanks to unchanged Gaussian distributions of the secret carriers. The theoretical evaluation of the NW security is carried out and the case of multi-bit embedding is addressed. Finally, a robust extension of NW is presented and the properties of NW and Robust-NWare both practically verified. 1 Introduction Robustness,capacity andimperceptibility have alwaysbeen considered,since the verybeginningofwatermarking,asthemainthreeconstraintstorespectinorder to build a valuable watermarking scheme. Recently the watermarking commu- nity has thrown light on the problem of security which appears also to be a fundamental constraint to respect in order to guaranty the usability of a wa- termarking technology. Several authors [1][2][3] showed that some information about the secret key may leak from several observations of watermarked pieces ofcontent.Usingthis information,itmaybe possibleto estimatethe secretkey, and then to destroythe security of the consideredscheme by removing,copying or altering the embedded messages. Several studies address also the security of practical watermarking techniques for digital images [4][5]. In this paper, we tackle the problem of security for the well-known class of spread spectrum (SS) watermarking schemes. In this case, the secret key which practically is the seed of a random generator, corresponds to the set of secret carriers that is used to convey the information. It is important to note that an attacker does not need the seed used to initialiaze the random number genera- tor: the secret carriers are good enough to attack the watermark.We propose a J.Camenischetal.(Eds.):IH2006,LNCS4437,pp.1–14,2007. (cid:2)c Springer-VerlagBerlinHeidelberg2007 2 P. Bas and F. Cayre watermarkingschemethatis secure(e.g.itdoesnotofferinformationleakageof the secret key) for the class of Watermark Only Attacks (WOA). This class of attacks,proposedby [1], considers an attack that is basedon the observationof watermarked contents, watermarked with the same key but conveying different messages. We named the proposed scheme natural spread spectrum watermark- ing because embedding is achieved without altering the natural distribution of eachsecretcarrierbeforeandafterembedding.Asshowninthepaper,thischar- acteristic enables to achieve perfect secrecy. Moreover,when embedding several bits,weshowthatifeachcarrierisembeddedinthe contentswithanamplitude following a Gaussian distribution, it is impossible to individually estimate the carriers. The rest of the paper is divided into five sections. First, the security of clas- sical SS techniques for WOA are analysed as a Blind Source Separation (BSS) problem: in section 2 we show that the characterisation of the distributions of each carrier for the observed contents enables to estimate the different carriers. Section 3 presents the constraints,principles andcharacteristicsof NaturalWa- termarking (NW). The embedding, decoding and distortion related to NW are presentedandthe link with the ScalarCosta’sScheme,anotherscheme preserv- ing perfect secrecy, is outlined. An extension of NW to increase the robustness ispresentedinsection4,theimplicationsintermofsecurityarealsomentioned. Section 5 presents a comparison between the estimations of the secret carriers for different SS watermarking schemes including NW. We show that for NW it is impossible to estimate the carriers. For Robust-NW only the estimation of the watermark subspace is possible. Finally section 6 concludes this paper and presents open research lines for future works. 2 Assessing the Security of Spread-Spectrum Techniques Using BSS Techniques 2.1 Notations Vectors are denoted in bold face (v) and coefficients of vectors with parenthesis (v(i) is the coefficient number i in vector v). Matrices are denoted in capital bold face and are generally composed of several realizations of vectors of the same name, column-wise: the columns of V are several realizations v ...v of 1 N a “template” vector v. LetusdenotexthehostvectorofN coefficientsintowhichwewanttohidea v binarymessagevectormofN bits.Theresultingwatermarkedvectorisdenoted c y. To this aim,we use u orthogonalcarriers,1≤i≤N . The decodedmessage i c is denotedmˆ. It is to be estimated from y(cid:3), a potentially degradedversionof y. Let us further denote z the correlation between a vector v and a carrier u : v,ui i 1 (cid:2)Nv z =<v|u >= v(k)u (k) (1) v,ui i N i v k=1 Natural Watermarking: A SecureSpread SpectrumTechniquefor WOA 3 2.2 Information Theoretical Constraints for Perfect Secrecy Perfect secrecy has different meanings according to the domain of application. For steganography, perfect secrecy means the impossibility to distinguish be- tween an original content (x) and a stego content (y). Cachin studied the nec- essary conditions to obtain a secure steganographic scheme and claims that a scheme is secure if the Kullback-Leibler divergence D between the distribu- KL tions P and P of x and y is null. The quantity D is defined by: x y KL (cid:2) P (i) D (P ||P )= P (i)log x (2) KL x y x P (i) y i whichmeansthatperfectsecrecymaybeachievedifandonlyifthedistributions ofxandy areidentical.Apracticalimplementationofasteganographicscheme satisfying the perfect secrecy constraint has been proposed in [6]. Forrobustwatermarking,theproblemdoesnotconcernapossibledistinction between the original and the watermarkedcontent: it is not important to know wether a content is watermarked or not, but is it important not to disclose the secret carriers based on observations of pieces of watermarked contents. The concept of information leakage in the context of robust watermarking has been proposedin [1] and developedin [2][3]. The notion of informationleakage stems fromthedefinitionofthemutualinformationbetweenN watermarkedcontents o Y and the secret carriers U (where the u are the columns of U and the N i o observed y are the columns of Y): I(U,Y)=H(Y)−H(Y|U)=H(U)−H(U|Y) (3) then awatermarkingscheme is secureifthe mutualinformationbetweenU and Y is null: in this case there is no information leakage. 2.3 Spread Spectrum Carriers Estimation As mentioned previously, a SS watermarkingscheme is secure if it is impossible toestimatethe secretcarriersusingobservedsignals.Onthecontrary,ifagiven technique enables to estimate the secret carriers u based only on the observa- i tionsofy,thenthesecurityofthewatermarkingschemeisgreatlyreduced.Such a tool can be provided using BSS theory. The goal of BSS is to decompose the observations as a mixture of signals having special statistical properties. For example, a Principal Component Analysis decomposes observations into orthogonalcomponents according to their variances, and an Independent Com- ponent Analysis decomposes the observations into independent signals. Making connectionsbetweenBSSandSSwatermarkingisstraightforward.Anoteworthy property of the class of spread spectrum watermarking schemes is the fact that the embedding part of a SS scheme can be formulated exactly as a blind source separation problem: Y =X+US . (4) m