Logout succeed
Logout succeed. See you again!

Involvement of ayu NOD2 in NF-κB and MAPK signaling pathways: Insights into functional conservation of NOD2 in antibacterial innate immunity PDF
Preview Involvement of ayu NOD2 in NF-κB and MAPK signaling pathways: Insights into functional conservation of NOD2 in antibacterial innate immunity
ZOOLOGICAL RESEARCH Involvement of ayu NOD2 in NF-κB and MAPK signaling pathways: Insights into functional conservation of NOD2 in antibacterial innate immunity YiRen1,#,Shui-FangLiu1,#,LiNie1,*,Shi-YuCai1,JiongChen1,2,* 1LaboratoryofBiochemistryandMolecularBiology,SchoolofMarineSciences,NingboUniversity,NingboZhejiang315211,China 2KeyLaboratoryofAppliedMarineBiotechnologyofMinistryofEducation,NingboUniversity,NingboZhejiang315211,China ABSTRACT diseasesandtherapeuticapplications. Nucleotide oligomerization domain 2 (NOD2) is a Keywords: Ayu NOD2; NF-κB signaling; MAPK majorcytoplasmicsensorforpathogensandiscritical signaling;Inflammatorycytokines;Vibrioanguillarum infection for the clearance of cytosolic bacteria in mammals. However, studies regarding NOD2, especially the INTRODUCTION initiated signaling pathways, are scarce in teleost Microorganisms that invade a host are initially recognized species. In this study, we identified a NOD2 and cleared by the innate immune system and related molecule(PaNOD2)fromayu(Plecoglossusaltivelis). immune responses (Medzhitov, 2007a). Innate immune Bioinformatics analysis showed the structure of responses are the first line of host defense and are primed NOD2 to be highly conserved during vertebrate upon recognizing pathogen-associated molecular patterns (PAMPs) by germline-encoded pattern recognition receptors evolution. Dual-luciferasereporterassaysexamined (PRRs). SeveralclassesofPRRs,includingToll-likereceptors, the activation of NF-κB signaling and Western retinoicacid-induciblegeneI(RIG-I)-likereceptors,nucleotide blotting analysis detected the phosphorylation of oligomerization domain (NOD)-like receptors (NLRs), and three MAP kinases (p-38, Erk1/2, and JNK1/2). cytosolic viral DNA sensors, recognize distinct microbial Functional study revealed that, like its mammalian components and directly activate immune cells (Brubaker et counterparts, PaNOD2 was the receptor of the al., 2015; Keating et al., 2011; Medzhitov, 2007b; Sabbah et al., 2009; Yoneyama et al., 2004). Exposure of these bacterial cell wall component muramyl dipeptide receptorstotheircorrespondingPAMPsactivatesintracellular (MDP), and the leucine-rich repeat motif was signaling cascades that induce the expression of a variety of responsible for the recognition and binding of inflammatory-relatedgenesandcytokines. PaNOD2withtheligand. OverexpressionofPaNOD2 Nucleotide oligomerization domain 2 (NOD2), a member activated the NF-κB signaling pathway, leading to theupregulationofinflammatorycytokines,including TNF-α and IL-1β in HEK293T cells and ayu head Received: 14March2018; Accepted: 27April2018; Online: 25May kidney-derived monocytes/macrophages (MO/MΦ). 2018 Particularly, we found that PaNOD2 activated the Foundationitems: ThisprojectwassupportedbytheNationalNatural MAPK signaling pathways, as indicated by the ScienceFoundationofChina(31772876,31702374),NaturalScience increased phosphorylation of p-38, Erk1/2, and Foundation of Zhejiang Province (LZ18C190001, LQ17C190001), JNK1/2, which have not been characterized in any Zhejiang Xinmiao Talents Program (2017R405023), and K.C. Wong teleostspeciespreviously. Ourfindingsprovedthatthe MagnaFundinNingboUniversity NOD2moleculeandinitiatedpathwaysareconserved #Authorscontributedequallytothiswork betweenmammalsandayu. Therefore,ayucouldbe *Correspondingauthors,E-mail:[email protected];[email protected] usedasananimalmodeltoinvestigateNOD2-based DOI:10.24272/j.issn.2095-8137.2018.066 SciencePress ZoologicalResearch40(2):77–88,2019 77 of the NLR family, is a major cytoplasmic sensor for a PaNOD2 were analyzed. Importantly, we demonstrated the peptidoglycan fragment existing in both gram-positive and conserved involvement of PaNOD2 in the NF-κB and MAPK gram-negative bacteria, named muramyl dipeptide (MDP) signaling pathways. This study will hopefully enrich current (Kuferetal.,2006).Structurally,NOD2containstwoN-terminal understanding of teleost NLRs in antibacterial immunity and tandemcaspaseactivationandrecruitmentdomains(CARDs), provide valuable insights into the evolutionary history of a central nucleotide-binding domain (NBD), and multiple cytosolicPRRsininnateimmunityfromteleoststomammals. C-terminal leucine-rich repeats (LRRs). In resting cells, MATERIALSANDMETHODS NOD2 is held in an autoinhibited monomeric state by intramolecular inhibition of the NBD domain through the LRR Experimentalfish motifs. After recognizing MDP by LRRs, NOD2 oligomerizes All experimental ayu (45.0±2.4 g, n=250) used in the present throughitsNBDdomainandrecruitsthedownstreamadaptor studywerepurchasedfromafisheryinNinghaiCounty,Ningbo receptor-interacting serine/threonine kinase 2 (RIPK2) by City, China. Healthy fish were temporarily maintained in a homotypic CARD-CARD interactions to activate NF-κB and recirculating water system (21.0±1.0 ◦C) with regular feeding, mitogen-activated protein kinase (MAPK) signaling pathways, as described previously (Zhang et al., 2018). The fish were thus inducing a series of immune responses (Girardin et al., acclimatizedtolaboratoryconditionsfortwoweeksbeforethe 2003; Tanabe et al., 2004; Windheim et al., 2007). These experiments. Allexperimentswereperformedaccordingtothe pathways are essential for bacterial clearance, the disruption ExperimentalAnimalManagementLawofChinaandapproved of which increases host susceptibility to various kinds of bytheAnimalEthicsCommitteeofNingboUniversity. pathogens. MolecularcharacterizationofPaNOD2 Despite the substantial information about NOD2 in The cDNA sequence of PaNOD2 was retrieved from mammals, knowledge of this molecule in lower vertebrates, the transcriptome data of the ayu head kidney-derived especially in teleosts, remains limited. Compared with other monocytes/macrophages (MO/MΦ). Specific primers were teleost species, studies on NOD2 in zebrafish (Danio rerio) designedtoamplifytheopenreadingframe(ORF)ofPaNOD2 are the most comprehensive. For example, the structural using reverse transcription PCR (NOD2 F1/R1, Table 1), model of the NACHT domain and ATP binding orientations, followed by cloning and sequencing. Multiple sequence antibacterialandprotectivefunctions,inducedNF-κBsignaling alignment was performed using ClustalW with homologous pathways, and mutual regulation between NOD2 and RIG-I sequences retrieved by BLAST (http://blast.ncbi.nlm.nih.gov/ signaling in zebrafish have been well studied (Maharana et Blast.cgi). Functional motifs in proteins were analyzed al., 2015; Nie et al., 2017; Oehlers et al., 2011; Zou et al., usingtheSMART(http://smart.embl-heidelberg.de/)andPfam 2016). Other than zebrafish, preliminary studies on NOD2 databases (http://smart.embl-heidelberg.de/; http://pfam.xfam. in other teleosts, including grass carp (Ctenopharyngodon org/) (Letunic et al., 2012). The phylogenies of the protein idella), Nile tilapia (Oreochromis niloticus), Indian major carp sequences were estimated with MEGA 5.0 software using (Catla catla), rohu (Labeo rohita), orange-spotted grouper parsimony and the neighbor-joining method (Tamura et al., (Epinephelus coioides), miiuy croaker (Miichthys miiuy), and 2011).SequencesusedinthisstudyarelistedinTable2. rainbow trout (Oncorhynchus mykiss) have been carried out (Basu et al., 2016; Chang et al., 2011; Chen et al., 2010; Plasmidconstructions Gao et al., 2018; Hou et al., 2012; Li et al., 2015; Maharana The ORF of PaNOD2 was inserted into EGPF-N1 (Clontech, et al., 2013). However, most studies have focused on USA) between the EcoR I and BamH I sites to construct bioinformaticsanalysisofthisprotein,tissueexpressionlevels EGFP fusion proteins (pEGFP-PaNOD2, NOD2 F2/R2), and andinflammatorygeneexpressionlevelsunderdifferentstress. was inserted into pcDNA3.1-FLAG (kind gift from Prof. Hence, comprehensive study regarding signaling pathways, Zong-Ping Xia) between Not I and SfaA I to construct especially whether teleost NOD2 can also activate MAPK eukaryotic expression vectors (pcDNA3.1-PaNOD2, NOD2 signalingpathwayslikeinmammals,isrequired. F3/R3). The LRR motif-deleted mutant (∆LRR) constructs Ayu (Plecoglossus altivelis) is an economically important [pcDNA3.1-PaNOD2 (∆LRR), NOD2 F3/R4] were cloned and and widely cultured fish in East Asia. However, the inserted into pcDNA3.1-FLAG between the Not I and SfaA I developmentoftheayuaquacultureischallengedbybacterial sites. The NF-κB luciferase construct was purchased from andviralfishdiseasesthathavecausedproductionandanimal Clontech(PaloAlto,USA)andthepRL-TKvectorwasobtained welfare problems (Zhang et al., 2015). Given the importance from Promega (Madison, USA). All constructed sequences of NOD2 in antibacterial innate immune responses, studying were confirmed by sequencing analysis. The plasmids for theligands, functions, andinducedsignalingpathwaysofayu transfectionwerepreparedattheendotoxin-freelevelusingan NOD2 is important. In the present study, we identified a EZNA™PlasmidMidiKit(OmegaBio-Tek,USA). NOD2 gene from ayu (PaNOD2), which, like its mammalian In vivo bacterial challenge and expression analysis of counterparts, contains all functional domains. The mRNA PaNOD2 expression patterns of PaNOD2 were examined in various The V. anguillarum challenge was carried out as reported tissues under normal conditions and after Vibrio anguillarum previously(Zhangetal.,2018).Briefly,V.anguillarumweregrown challenge. The subcellular localization and ligands of 78 www.zoores.ac.cn at 28 ◦C in nutrient broth and harvested at the logarithmic into 35-mm dishes (2×107/mL) and cultured in RPMI 1640 phase before washing, resuspending, and diluting to the medium (Invitrogen, China) supplemented with 5% (v/v) fetal appropriate concentration in sterile phosphate-buffered saline bovineserum(FBS)(Gibco,LifeTechnologies,USA),5%(v/v) (PBS). The final bacterial concentration was confirmed by ayuserum,penicillin(100U/mL),andstreptomycin(100µg/mL) plating serial dilutions on solid media. Each ayu was at 24 ◦C in 5% CO after washing off non-adherent cells. 2 intraperitoneally injected with 1.2×104 colony forming units The HEK293T cells were maintained in Dulbecco’s modified (CFUs) of live V. anguillarum (in 100 µL PBS), with PBS Eagle’s medium (DMEM, Invitrogen, China) supplemented injectedaloneusedasthecontrolgroup. Ayuweresacrificed with 10% (v/v) FBS, penicillin (100 U/mL), and streptomycin at 4, 8, 12, 24, or 48 h post-infection (hpi) and the gill, (100 µg/mL) at 37 ◦C in 5% CO . The HEK293T cells 2 spleen, head kidney, liver, and intestine were collected for (1×105/mL)wereseededintomulti-wellplates(Corning,USA) totalRNAextraction(Chenetal.,2018). TheRNAofhealthy to allow growth until 70%–90% confluence on the day of fish tissues, including the muscle, skin, heart, gill, spleen, transfection. Both cell types were transiently transfected with head kidney, liver, and intestine, were also extracted for DNAusinglipofectamine3000(Invitrogen,China)accordingto tissueexpressionpatternanalysis.Real-timequantitativePCR themanufacturer’sinstructions. (RT-qPCR)wasperformedonanABIStepOneReal-TimePCR Subcellularlocalization System(AppliedBiosystems,USA)usingSYBRpremixExTaq TheHEK293Tcellswereculturedandseededontocoverslips II(TaKaRa,Japan)withthefollowingprotocol: (1)40cyclesof in 6-well plates before transfection. After 24 h of culture, the amplificationat95◦Cfor30sand60◦Cfor20s;(2)melting cells were transfected with pEGFP-PaNOD2 (1 µg/mL). At 36 curveanalysisat95◦Cfor5s,65◦Cfor15s,and95◦Cfor15 hpost-transfection(hpt),thecellswerewashedtwicewithPBS s;and(3)coolingat40◦Cfor30s. Relativegeneexpression and fixed for 20 min in 4% (v/v) paraformaldehyde, followed wascalculatedusingthe2−∆∆CT methodwithPaNOD2initially by staining with DiI (Beyotime, China) for 10 min. After twice normalizedagainstPa18SrRNA.Theprimersusedarelisted washingwithPBS,thenucleiwerestainedwithDAPI(Sigma, inTable1(NOD2qRTF/R).EachPCRtrialwasperformedin USA) for 5 min. Fluorescence images of cells were obtained triplicateandrepeatedatleastthreetimes. usingaconfocalmicroscope(ZeissLSM710NLO,CarlZeiss, Cellcultureandtransienttransfection Germany). Ayu head kidney-derived MO/MΦ were isolated as described previously(Heetal.,2013).TheisolatedMO/MΦwereseeded Table1Oligonucleotideprimersusedinthiswork GenBank Nucleotide Amplicon Usageof Primer Gene accessionNo. sequence(5(cid:48)–3(cid:48)) size(bp) primerpairs NOD2F1 PaNOD2 MG674830 ATGAGTGCCCAGCAGTTGGTGCTAAG 2964 CloningofPaNOD2 NOD2R1 TCAGAACGTTAGTCGGGA ConstructEGFP NOD2F2 PaNOD2 MG674830 GAATTCATGAGTGCCCAGCAGTTGGTGCTAA 2964 fusionplasmid NOD2R2 GGATCCCGGAACGTTAGTCGGGACTCT Constructeukaryotic NOD2F3 PaNOD2 MG674830 ATGCGCGGCCGCTATGAGTGCCCAGCAGTTGGTGCTAA 2964 expressionplasmid NOD2R3 PaNOD2 MG674830 ATGCGCGATCGCGAACGTTAGTCGGGACTCT NOD2R4 PaNOD2 MG674830 ATGCGCGATCGCGATTGCCAGAGGAACGATGGCG 2205 Construct∆LRRmutant QuantificationofNOD2 NOD2qRTF PaNOD2 MG674830 GGATGACATTTACACCGAAGG 244 geneexpression NOD2qRTR TCTGCGACAACTGAATGGA QuantificationofTNF-α TNF-αqRTF PaTNF-α JP740414 ACATGGGAGCTGTGTTCCTC 115 geneexpression TNF-αqRTR GCAAACACACCGAAAAAGGT Quantificationof IL-1βqRTF PaIL-1β HF543937 TACCGGTTGGTACATCAGCA 104 IL-1βgeneexpression IL-1βqRTR TGACGGTAAAGTTGGTGCAA Quantificationof18S 18SrRNAqRTF Pa18SrRNA FN646593 GAATGTCTGCCCTATCAACT 103 rRNAgene 18SrRNAqRTR GATGTGGTAGCCGTTTCT expression ZoologicalResearch40(2):77–88,2019 79 Table2NOD1andNOD2sequencesusedinthisstudy Species GenBankaccessionNo. Protein Latinname Englishname MG674830 Plecoglossusaltivelis Ayu NOD2 XP_022597963.1 Serioladumerili Amberjack NOD2 XP_022522840.1 Astyanaxmexicanus Mexicantetra NOD2 ERE77544.1 Cricetulusgriseus Chinesehamster NOD2 XP_020797036.1 Boleophthalmuspectinirostris Mudskipper NOD2 XP_015236187.1 Cyprinodonvariegatus Sheepsheadminnows NOD2 XP_008335431.1 Cynoglossussemilaevis Half-smoothtonguesole NOD2 XP_012715032.1 Fundulusheteroclitus Killifish NOD2 ACX71753.1 Ctenopharyngodonidella Grasscarp NOD2 AFV53358.1 Epinepheluscoioides Orange-spottedgrouper NOD2 AEG89706.1 Labeorohita Rohu NOD2 AKR76246.1 Miichthysmiiuy Miiuycroaker NOD2 XP_003437591.1 Oreochromisniloticus Niletilapia NOD2 XP_014031576.1 Salmosalar Atlanticsalmon NOD2 ADV31549.1 Oncorhynchusmykiss Rainbowtrout NOD2a ADV31550.1 Oncorhynchusmykiss Rainbowtrout NOD2b XP_017314821.1 Ictaluruspunctatus Channelcatfish NOD2 XP_018522174.1 Larimichthyscrocea Largeyellowcroaker NOD2 XP_020481540.1 Labrusbergylta Ballanwrasse NOD2 NP_001314973.1 Daniorerio Zebrafish NOD2 XP_017548715.1 Pygocentrusnattereri Red-belliedpiranhas NOD2 XP_019935411.1 Paralichthysolivaceus Japaneseflounder NOD2 NP_001035913.1 Takifugurubripes Pufferfish NOD2 NP_001002889.1 Bostaurus Cattle NOD2 NP_665856.2 Musmusculus Mouse NOD2 NP_001280486.1 Homosapiens Human NOD2 XP_020792937.1 Boleophthalmuspectinirostris Mudskipper NOD1 XP_004571362.1 Maylandiazebra Zebrambuna NOD1 XP_002665106.3 Daniorerio Zebrafish NOD1 AII73558.1 Oncorhynchusmykiss Rainbowtrout NOD1 XP_018418247.1 Nanoranaparkeri Tibetanfrog NOD1 NP_001002889.1 Bostaurus Cattle NOD1 NP_001164478.1 Musmusculus Mouse NOD1 NP_006083.1 Homosapiens Human NOD1 Dual-luciferasereportassay to above description. For luciferase assay, pcDNA3.1-FLAG, The HEK293T cells and ayu MO/MΦ were transfected with pcDNA3.1-PaNOD2, or pcDNA3.1-PaNOD2 (∆LRR), together relative plasmids (1 µg/mL) and NF-κB luciferase reporter withtheNF-κBluciferasereportergene,weretransfectedinto both cell types, with the pRL-TK Renilla luciferase reporter vectors (200 pg/mL). The pRL-TK Renilla luciferase reporter plasmid used as an internal control. At 24 hpt, cells were plasmid was used as an internal control. The empty control harvested and firefly and Renilla luciferase activities were plasmid pcDNA3.1-FLAG was added to ensure the same assayed with three replicates according to the manufacturer’s amounts of total DNA. Cells were lysed at 24 hpt and instructions. Luciferase activity was normalized to pRL-TK dual-luciferasereporterassaywasperformed(Nieetal.,2015). activity and expressed as fold stimulation relative to the Luciferase activity was normalized to pRL-TK activity and control.ForRT-qPCR,pcDNA3.1-FLAGorpcDNA3.1-PaNOD2 expressedasfoldstimulationrelativetothecontrol. (1µg/mL)weretransfectedintoHEK293TcellsorayuMO/MΦ RoleofPaNOD2inactivatingNF-κBsignalingpathway andtheexpressionofTNF-αandIL-1βwereanalyzedat6,12, and24hpt.Eachtrialwasperformedintriplicateandrepeated NF-κB activation was examined in both HEK293T cells and at least three times. Results were displayed relative to the ayu MO/MΦ using luciferase assay and RT-qPCR according 80 www.zoores.ac.cn corresponding Pa18S rRNA values to calculate relative copy of ayu. The highest expression of PaNOD2 was observed in numbers. the intestine, followed by the liver and head kidney (Figure 3A).UponV.anguillaruminfection,PaNOD2mRNAexpression Recognitionassay was upregulated in all examined immune-related tissues in a AsHEK293TcellsdonotexpressendogenousNOD2,theyare time-dependentmanner.ThePaNOD2transcriptinthegillwas theperfectsystemtoinvestigatetheligandsofPaNOD2. The dramatically upregulated at 12 hpi, then gradually decreased HEK293T cells were transfected with pcDNA3.1-PaNOD2 (1 and returned to normal status at 48 hpi (Figure 3B). In the µg/mL) or MDP (10 ng/mL) or both with PaNOD2 at gradient spleen, head kidney, liver, and intestine, PaNOD2 expression levels, together with NF-κB luciferase reporter vector. The was upregulated at 8 hpi and gradually increased as the pRL-TK Renilla luciferase reporter plasmid was used as the infectioncontinued.Thehighestexpressioninthespleen,liver, internal control. Empty control plasmid pcDNA3.1-FLAG was andintestinewasobservedat24hpi,whereasthatinthehead added to ensure the same amounts of total DNA. At 24 kidneywasdetectedat48hpi(Figure3B–F). hpt, cells were lysed, and dual-luciferase reporter assay was conducted,asdescribedabove. SubcellularlocalizationofPaNOD2 Before functional characterization, subcellular localization of RoleofPaNOD2inactivatingMAPKsignalingpathways Both cell types were transfected with pcDNA3.1-FLAG or PaNOD2wasinitiallyevaluatedbyintroducinganEGFP-fused pcDNA3.1-PaNOD2 (1 µg/mL). At 12, 24, 36, and 48 construct(EGFP-PaNOD2)intotheHEK293Tcells. PaNOD2 hpt, the activation of the MAPK signaling pathways was wasclearlydistributedinthecytoplasmofthetransfectedcells, examined by Western blotting using antibodies against with no colocalized signals with DiI (membrane indicator) or three representative MAP kinases (p-38, ERK1/2, and DAPI(nucleusindicator)(Figure4). JNK1/2). The primary antibodies used were rabbit RoleofPaNOD2inactivatingNF-κBsignalingpathway phospho-p38MAPK(Thr180/Tyr182),rabbitp38MAPK,rabbit AsanimportantpathwayinitiatedbyNOD2signaling,activation phospho-SAPK/JNK1/2(Thr183/Tyr185),rabbitSAPK/JNK1/2, of the NF-κB signaling pathway was examined to provide rabbit phospho-p44/42 MAPK (ERK1/2) (Thr202/Tyr204), and evidence for the conserved role of PaNOD2 in antibacterial rabbit p44/42 MAPK (ERK1/2) (Cell Signaling Technology, immunity. Luciferase reporter activity and inflammatory China). The secondary antibody used was HRP-conjugated cytokine (TNF-α and IL-1β) expression were detected to goat anti-rabbit IgG (Life Technologies, China). The evaluatetheactivationoftheNF-κBsignalingpathway.Results blot was then incubated with enhanced chemiluminescence showedthatoverexpressionofPaNOD2inboththeHEK293T (ECL) reagents (Life Technologies, China) according to the cells and ayu MO/MΦ for 24 h significantly (P<0.05 and manufacturer’sprotocols. P<0.01) induced NF-κB activation, as determined by the Statisticalanalyses dual-luciferase report assay (Figure 5A, B). In addition, the Datafromthreeindependentexperimentswereexpressedas expressions of TNF-α and IL-1β were also upregulated in means±SEM. Statistical analysis was conducted by one-way the PaNOD2 overexpression group (Figure 5C, D). The analysisofvariance(ANOVA)withSPSSversion13.0(SPSS LRR-deleted mutant PaNOD2 (∆LRR) construct was used Inc, Chicago, USA). P<0.05 and P<0.01 were considered to examine whether the LRR domain in PaNOD2 acted to statisticallysignificant. keep this molecule in an autoinhibited status. As expected, overexpressionofthe∆LRRmutantinbothHEK293Tcellsand RESULTS ayu MO/MΦ greatly enhanced the extent of NF-κB activation MolecularcharacterizationofPaNOD2 comparedwiththewildgroup(Figure5A,B).Clearly,PaNOD2 The ORF of PaNOD2 was 2 964 bp in length and encoded playedaconservedroleintheNF-κBsignalingpathwayandthe a protein with 987 amino acids. The molecular weight (MW) LRR structure acted as an autoinhibition domain, which was of the protein was 1.1036×105 and the putative isoelectric regulatedbyrecognitionofthereceptortobacterialPAMPs. point (pI) was 6.20. The PaNOD2 protein also contained RecognitionofPaNOD2tobacterialPAMPs two N-terminal tandem CARD domains, central NBD domain, and multiple C-terminal LRRs. Multiple sequence alignment Forrecognitionanalysis,HEK293Tcells(withnoendogenous showed that the protein sequence and domains of NOD2 expression of NOD2) were used for ectopic expression of were conserved among vertebrates, and PaNOD2 shared PaNOD2;andMDP,atypicalPAMPmoleculeonthecellwalls highest amino acid identity and similarity (67% identity and ofbothgram-negativeandgram-positivebacteria,wasusedfor 81% similarity) with the large yellow croaker homolog (Figure stimulation of PaNOD2-dependent NF-κB activation. Results 1). Phylogenetic tree analysis showed that all teleost NOD2 showed that activation of NF-κB could be induced (P<0.05) proteins were clustered together with their higher vertebrate withincreasedadministrationofthePaNOD2-expressionvector counterparts and formed a distinct group with the NOD1 and significantly higher with the co-administration of MDP proteins,whichalsobelongedtotheNLRfamily(Figure2). (P<0.05 and P<0.01, Figure 6). Thus, PaNOD2 is an intracellular PRR participating in the recognition of bacterial TissuedistributionandexpressionanalysisofPaNOD2 MDP, whose performance is similar to that of mammalian The mRNA expression pattern of PaNOD2 was detected in NOD2s. the skin, heart, gill, spleen, head kidney, liver, and intestine ZoologicalResearch40(2):77–88,2019 81 Figure1MultiplesequencealignmentofPaNOD2withotherhomologues Thethresholdforshadingis>60%; similarresiduesaremarkedwithgrayshading, identicalresiduesaremarkedwithblackshading, andalignmentgaps aremarkedas“–”. AccessionnumbersofsequencesusedarelistedinTable2. TwoN-terminaltandemCARDdomains,centralNBDdomain,andmultiple C-terminalLRRsareindicatedabovethealignment. 82 www.zoores.ac.cn Figure 1 Multiple sequence alignment of PaNOD2 with other homologues The threshold for shading is >60%; similar residues are marked with gray shading, identical residues are marked with black shading, and alignment gaps are marked as “–”. Accession numbers of sequences used are listed in Table 2. Two N-terminal tandem CARD domains, central NBD domain, and multiple C-terminal LRRs are indicated above the alignment. homologues and other NLR family members using MEGA 5.0. Values at forks indicate the percentage of trees in which this grouping occurred after bootstrapping (1000 replicates; shown only when >60%). Scale bar shows number of Figure2PhylogenetictreeshowingrelationshipofPaNOD2withotherknownNOD2homologuesandotherNLRfamilymembers substitutions per base. GenBank accession Nos. of sequences are listed in Table 2. usingMEGA5.0 VFaluiegsuatrforeks 2ind iPcahteythelopegrceenntaegetoifctr eterseinew hsichhtohiswgrionupging roeccluarretdioaftnersbhooitsptra oppfin gP(1a0N00OreplDicat2es ;wshoiwthno nolytwhheenr> 6k0%n)o.Swcalneb NarsOhowDs 2 The ayu NOD2 site is marked with ■. numberofsubstitutionsperbase.GenBankaccessionNos.ofsequencesarelistedinTable2.TheayuNOD2siteismarkedwith . Tissue distributionZ oaonlodg iecaxlpRreessesairocnh 4a0n(2a):ly7s7i–s8 o8,f2 P01a9NO83D2 The mRNA expression pattern of PaNOD2 was detected in the skin, heart, gill, spleen, head kidney, liver, and intestine of ayu. The highest expression of PaNOD2 was observed in the intestine, followed by the liver and head kidney (Figure 3A). Upon V. anguillarum infection, PaNOD2 mRNA expression was upregulated in all examined immune-related tissues in a time-dependent manner. The PaNOD2 transcript in the gill was dramatically upregulated at 12 hpi, then gradually decreased and returned to normal status at 48 hpi (Figure 3B). In the spleen, head kidney, liver, and intestine, PaNOD2 expression was upregulated at 8 hpi and gradually increased as the infection continued. The highest expression in the spleen, liver, and intestine was observed at 24 hpi, whereas that in the head kidney was detected at 48 hpi (Figure 3B–F). of four fish samples. B–F: PaNOD2 transcripts in immune tissues of ayu challenged with V. anguillarum. Tissues were collected at 4, 8, 12, 24, and 48 hpi. Relative PaNOD2 transcript levels to 18S rRNA were quantified, and the mRNA level in the 4-h PBS-injected group was normalized to 1. Data are means±SEM of results from three replicates *: P<0.05, **: P<0.01. Subcellular localization of PaNOD2 Before functional characterization, subcellular localization of PaNOD2 was initially evaluated by introducing an EGFP-fused construct (EGFP-PaNOD2) into the HEK293T cells. PaNOD2 was clearly distributed in the cytoplasm of the transfected Figure3RT-qPCRanalysisofPaNOD2expressionpatternsinhealthyayutissuesandimmunetissuesafterV.anguillaruminfection Figure 3 RT-qPCR analysis of PaNOD2 expression patterns in healthy ayu tissues A:RelativePaNOD2expressioninvarioushealthyayutissues(muscle,skin,heart,gill,spleen,headkidney,liver,intestine)against18SrRNA,NDisnotdetected. Relativeexpresscioenlwlsa,s cwalciuthla tendoaans dct hioemlamovuecnraaegl tieizsoseufdeths raesfeitegrre nVp.lai calanstge uswi,lleiaatrchuhm cD ionnfiseIics tt(iinomgn oefmfoubrrfiashnsea minpledsi.cBa–tFo:rP)a NoOrD 2DtraAnsPcIri pt(sninuicmlmeuunse tissuesofayu challengedwithV.anguillarum. Tissueswerecollectedat4,8,12,24,and48hpi. RelativePaNOD2transcriptlevelsto18SrRNAwerequantified,andthe A: Relative PaNOD2 expression in various healthy ayu tissues (muscle, skin, heart, mRNAlevelinthien4d-hicPaBtSo-irn)je c(tFediggruourep w4a)s.n ormalizedto1.Dataaremeans±SEMofresultsfromthreereplicates*:P<0.05,**:P<0.01. gill, spleen, head kidney, liver, intestine) against 18S rRNA, ND is not detected. Relative expression was calculated as the average of three replicates, each consisting Figure4SubcellularlocalizationofPaNOD2 Figure 4 Subcellular localization of PaNOD2 CytoplasmiclocalizationofPaNOD2inHEK293Tcellsobservedusingconfocalmicroscopy. NucleuswasstainedbyDAPIandcellmembranewasstainedby DiI.Scalebars:10µm,originalmagnification×640. Cytoplasmic localization of PaNOD2 in HEK293T cells observed using confocal microscopy. Nucleus was stained by DAPI and cell membrane was stained by DiI. 84 www.zoores.ac.cn Scale bars: 10 μm, original magnification ×640. Conserved role of PaNOD2 in activating MAPK signaling pathways As another important pathway activated by NOD2 signaling, activationoftheMAPKsignalingpathwaywasfurtherexamined to verify the conserved role of PaNOD2 in antibacterial processes. The phosphorylation of three conventional MAP kinases (p-38, ERK1/2, and JNK1/2) was examined in both HEK293T cells and ayu MO/MΦ when PaNOD2 was overexpressed, representing the activation of corresponding MAPK signaling. Results showed that the three MAP kinases were not phosphorylated in naïve HEK293T cells, the phosphorylation of which was clearly observed at 12, 24, 36, and 48 h post PaNOD2 transfection (Figure 7A–C). The phosphorylationofp-38andJNK1/2butnotErk1/2wasobserved in naïve ayu MO/MΦ, but at a relatively low level. After the overexpression of PaNOD2, phosphorylation of p38 was significantly upregulated at 12 hpt, then gradually decreased and returned to the control level at 48 hpt (Figure 7D). PhosphorylationofErk1/2wasobservedat12hpt,andreached thehighestlevelat48hpt,withaslightdecreaseat24hpt(Figure 7E).PhosphorylationofJNK1/2wassignificantlyupregulatedat 12hptandremainedatasimilarleveltill48hpt(Figure7F). DISCUSSION The NLRs are a large family of cytosolic receptors involved FigFuirgeure5 5 AAccttivivataiotni oofn NoF-fκBN sFig-nκaBlings piagthnwaalyi nbyg PpaNaOthD2w aanyd LbRyR-PdealeNtedO D2 in innate immune responses (Kanneganti et al., 2007; Proell andmuLtaRntR P-adNOeDle2t (eΔdLRmR)u tantPaNOD2(∆LRR) et al., 2008). Bioinformatics have revealed that 23 NLR HEK293T cells (A) and ayu MO/MΦ (B) were transfected with HEK293T cells (A) and ayu MO/MΦ (B) were transfected with pcDNA3.1-PaNOD2 genes exist in the human genome and at least 34 NLR pcDNA3.1-PaNOD2orpcDNA3.1-PaNOD2(∆LRR),togetherwiththeNF-κB genes exist in mice (Harton et al., 2002; Kanneganti et or pcDNA3.1-PaNOD2 (ΔLRR), together with the NF-κB luciferase reporter vector, luciferase reporter vector, with an empty plasmid transfected group used al., 2007). The NLR family can be divided into three astwhieth caonn etrmopl.ty Lpluascmifiedr atrsaensfreectpeod rgterorupa susseady sas wtheer ecocnotronld. uLcutceifderaaset 2re4pohrtpert . C, groups, one of which consists of NOD1 and NOD2, which sense cytosolic peptidoglycan fragments iE-DAP (dipeptide D: Examination of the expression of inflammatory cytokines (TNF-α and γ-D-glutamyl-meso-diaminopimelicacid)andMDP,respectively, IL-1β). HEK293T cells (C) and ayu MO/MΦ (D) were transfected with driving the activation of the NF-κB and MAPK signaling pcDNA3.1-PaNOD2 or empty plasmid, with cells collected at 6, 12, and pathways. The second group consists of NLRs required for 24hptforRNAextractionandreal-timePCRtomeasuretheexpressionof the assembly of inflammasomes, leading to the activation of TNF-αandIL-1β.Valuesaremeans±SEM;*:P<0.05,**:P<0.01. caspase-1 and maturation of IL-1β. The last group consists of the CIITA transcription factor, which is involved in the transcription of genes encoding MHC I (Fitzgerald, 2010; Meissneretal.,2010). NOD2isanessentialNLRthatparticipatesintherecognition ofbacterialinvasionandviralinfection.ItinitiatestheNF-κBand MAPK signaling pathways to induce the production of various proinflammatorycytokinesaswellasapoptosisandautophagyto eliminateinvadingpathogens(Shawetal.,2011). Althoughthe NOD2genehasbeenclonedfromseveralfishspecies,studies regarding its functions and signaling pathways in teleosts are limited,especiallytheactivationofMAPkinases. Inthepresent study, we described the functional characterization of a NOD2 FiguFrigeur6e 6F Fuunncctiotinoaln eavallueavtioanl uofa PtaiNoOnDo2 fasP aa reNceOptDor 2of aMsDaP receptorofMDP homologue (PaNOD2) in an ayu model. Structural analysis Non-endogenous NOD2-expression HEK293T cells were used for this Non-endogenous NOD2-expression HEK293T cells were used for this purpose. showedthatPaNOD2sharedconservedfunctionaldomainswith purpose.HEK293TcellsweretransfectedwithpcDNA3.1-PaNOD2orMDP itsmammaliancounterparts,includingN-terminaltandemCARD HEK293T cells were transfected with pcDNA3.1-PaNOD2 or MDP (10 ng/mL) or (10ng/mL)orbothwithPaNOD2atgradientlevels(upto1µg/mL),together domains, central NBD domain, and multiple C-terminal LRRs. withbNoFth- wκBith lPuacNifOerDa2s aet grerapdoierntte lrevveelsc (tuopr .toE 1m μgp/tmyL-p),l atosgmethidert wraitnhs NfeFc-κteBd lugcirfoeruapse was The structural similarity indicates that functional conservation may also exist between PaNOD2 and its higher species usedreaposrtethr evecctoorn. tEroml.ptyL-pulcasifmeirda tsreansrfeepctoedr tgerrouaps wsaasy susewde arse thce ocnondturocl.t eLducaifter2as4e hpt. homologues. Valureespoartreer masseaaysn sw±eSreE cMon;du*c:tePd< a0t .2045 ,hp**t.: VPa<lu0es. 0a1re. means±SEM; *: P<0.05, **: P<0.01. ZoologicalResearch40(2):77–88,2019 85 Conserved role of PaNOD2 in activating MAPK signaling pathways As another important pathway activated by NOD2 signaling, activation of the MAPK signaling pathway was further examined to verify the conserved role of PaNOD2 in antibacterial processes. The phosphorylation of three conventional MAP kinases (p-38, ERK1/2, and JNK1/2) was examined in both HEK293T cells and ayu MO/MΦ when PaNOD2 was overexpressed, representing the activation of corresponding MAPK signaling. Results showed that the three MAP kinases were not phosphorylated in naïve HEK293T cells, the phosphorylation of which was clearly observed at 12, 24, 36, and 48 h post PaNOD2 transfection (Figure 7A–C). The phosphorylation of p-38 and JNK1/2 but not Erk1/2 was observed in naïve ayu MO/MΦ, but at a relatively low level. After the overexpression of PaNOD2, phosphorylation of p38 was significantly upregulated at 12 hpt, then gradually decreased and returned to the control level at 48 hpt (Figure 7D). Phosphorylation of Erk1/2 was observed at 12 hpt, and reached the highest level at 48 hpt, with a slight decrease at 24 hpt (Figure 7E). Phosphorylation of JNK1/2 was significantly upregulated at 12 hpt and remained at a similar level till 48 hpt (Figure 7F). Figure7ActivationofMAPKsignalingbyPaNOD2 HEK293T cells (A–C) and ayu MO/MΦ (D–F) were transfected with pcDNA3.1-PaNOD2 or empty plasmid, with cells collected at 12, 24, 36, and 48 hpt andthephosphorylationofp-38(AandD),Erk1/2(BandE),andJNK1/2(CandF)thenexamined.Histogramshowschangesintherelativebandintensityof phosphorylatedp-38,Erk1/2,andJNK1/2,withtheircorrespondingtotalproteins(phosphorylatedandnon-phosphorylated).Valuesaremeans±SEM;*:P<0.05, **:P<0.01. Previous studies in mammals have shown that, in addition SBP is increased in patients with Crohn’s disease (Wiest to its role in the activation of cytosolic antibacterial signaling, & Garcia-Tsao, 2005). Furthermore, the upregulation of NOD2 also plays an essential role in the prevention of NOD2 has also been reported during liver injury in mice and inflammatoryboweldisease(IBD).Threemutationsofhuman humans, and NOD2 may directly contribute to liver injury via NOD2 (R702W, G908R, and L1007insC) are also highly a regulatory mechanism affecting immune cells infiltrating the associated with susceptibility to Crohn’s disease in the liver and hepatocytes (Appenrodt et al., 2010). As shown in intestinal tract (Hugot et al., 2001; Strober et al., 2014). ourexpressionpatternanalysisofPaNOD2,themRNAlevels In addition, NOD2 is involved in maintaining the equilibrium in the liver and intestine were significantly upregulated after between the constant exposure of the intestine to various V. anguillarum infection. Compared to the control group at microorganisms and induced host immune responses (Al 24 hpi, the expression of PaNOD2 significantly increased by Nabhani et al., 2017; Balasubramanian & Gao, 2017). 111.8- and 241.4-fold in the liver and intestine, respectively, Imbalance of this homeostasis can lead to the prevalence indicatingthatPaNOD2maybeinvolvedinthemaintenanceof of pathogenic bacteria and the explosion of inflammation as homeostasisintheliverandintestine.Hence,ayumayalsobe well as damage to the intestinal epithelial barrier (Ramanan apotentialmodelforstudyingIBDandliverinjury.However,the et al., 2014). It has been reported that a negative feedback detailed mechanisms, signaling pathways, and cells involved loopexistsbetweenNOD2andintestinalbacteria,wherebythe stillneedfurtherelucidation. accumulationofpathogenicbacteriapromotestheexpression Studies in mammals and zebrafish have shown that the of NOD2, which, in turn, prevents bacterial overexpansion LRR motif maintains NOD2 in an autoinhibition state, such (Biswas et al., 2012). Furthermore, spontaneous bacterial thatitcannotinitiatesignalingunderphysiologicalstatewithout peritonitis (SBP), a liver cirrhosis, has been attributed to the stimulation of its ligand MDP (Girardin et al., 2003; Nie bacterial translocation from the intestine to liver (Wiest & et al., 2017). After recognition of MDP by LRR, NOD2 Garcia-Tsao, 2005). Hence, the involvement of NOD2 undergoes self-oligomerization and recruits the downstream in maintaining intestinal equilibrium is also likely essential adaptor receptor-interacting serine/threonine-protein kinase 2 for liver inflammation, albeit indirectly, as susceptibility to (RIPK2) through CARD-CARD interaction (Park et al., 2007). 86 www.zoores.ac.cn