Logout succeed
Logout succeed. See you again!

Micellar structure changes in aqueous mixtures of nonionic surfactants PDF
Preview Micellar structure changes in aqueous mixtures of nonionic surfactants
Micellar structure changes in aqueous mixtures of nonionic surfactants Liang Guo and Ralph H. Colbya) Materials Science and Engineering, The Pennsylvania State University, University Park, Pennsylvania16802 MinY. Lin Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, Maryland20899 Gregory P. Dadob) Air Products and Chemicals, Inc., Allentown, Pennsylvania18195 (Received7February2001;finalrevisionreceived22May2001) Synopsis Rheologyandsmall-angleneutronscatteringareusedtoprobethestructureofnonionicsurfactant mixtures in water. Small amounts of a C diol ~Surfynol® 104! cause enormous structural and 14 rheological changes when added to aqueous solutions of an ethylene oxide-propylene oxide-ethyleneoxidetriblockcopolymer~Pluronic®P105!.TheC diolisonlysolubleupto0.1 14 wt%inpurewater,butcanbeaddedinlargequantitiestoaqueoussolutionsofthecopolymer.The hydrophobicdiolincorporatesintotheexistingcopolymermicellesandcausesacascadeofchanges inthemicellestructure,withresultantchangesinrheology.Particularlystrikingisthesphericalto worm-likemicelletransition,wheretheviscositychangesbyafactorofmorethan104. © 2001 TheSocietyofRheology. @DOI:10.1122/1.1389315# I. INTRODUCTION Water-solubletriblockcopolymersofpoly~ethyleneoxide!andpoly~propyleneoxide!, often denoted PEO–PPO–PEO, are commercially available nonionic macromolecular surfactants commonly known as Poloxamers® ~manufactured by ICI! or Pluronics® ~manufactured by BASF!.Tailoring the copolymer composition and molecular weight in the manufacturing process results in a wide range of products with optimum properties suitable for use in a variety of industrial areas.As a result, PEO–PPO–PEO copolymers have found widespread industrial applications in such areas as detergency, foaming/ defoaming, emulsification, dispersion stabilization, lubrication, as well as some more specialapplicationfieldsascosmetics,pharmaceuticals,andbioprocessing@Alexandridis and Hatton ~1995!; Chu ~1995!#. a!Authortowhomallcorrespondenceshouldbeaddressed.Electronicmail:[email protected] b!Currentaddress:StepanCompany,Northfield,IL60093. ©2001byTheSocietyofRheology,Inc. J.Rheol.45~5!,September/October2001 0148-6055/2001/45~5!/1223/21/$20.00 1223 1224 GUOETAL. OwingtotheapplicationpotentialofPEO–PPO–PEOcopolymersinsuchwidespread importantareas,thisproductfamilyhasremainedanactiveresearchtopicinrecentyears. Aqueous solutions of these copolymers have been studied extensively. The kinetics and thermodynamics of micellization have been studied, including the effects of temperature and system composition on the micelle structure @Zhou and Chu ~1988!; Nagarajan and Ganesh ~1989a and 1989b!; Wanka etal. ~1990!; Brown etal. ~1991!; Brown etal. ~1992!; Mortensen and Brown ~1993a!; Mortensen and Pedersen ~1993b!; Wanka etal. ~1994!;Alexandridis etal. ~1994!; Prud’homme etal. ~1996!; Nagarajan ~1999!#. In contrast to the extensive work on PEO–PPO–PEO copolymers in water, their interactions with additives have been less probed and only a few publications are avail- able @Almgren etal. ~1991a and 1991b!; Bahadur etal. ~1993!; Hecht and Hoffmann ~1994 and 1995!; Hecht etal. ~1995!; Jørgensen etal. ~1997!; Contractor and Bahadur ~1998!; Alexandridis etal. ~2000!; Bromberg etal. ~2000!; Guo etal. ~2000!; Ivanova etal. ~2000a and 2000b!; Plucktaveesak etal. ~2000!#.As PEO–PPO–PEO copolymers find applications mostly in complex environments, studying effects of various additives can be useful for optimizing their applications. In this paper, we report our studies by rheology and small-angle neutron scattering ~SANS! on complex aqueous mixtures of ~EO! ~PO! ~EO! and a hydrophobic nonionic C diol. 37 56 37 14 II. MICELLIZATION OF PEO–PPO–PEO TRIBLOCK COPOLYMERS In a certain temperature range and at a certain copolymer concentration, PEO–PPO– PEO block copolymers of suitable composition and molecular weight form polymolecu- lar aggregates ~micelles! in an aqueous environment. SANS on ~EO! ~PO! ~EO! 78 30 78 aqueous solutions @Zhou and Chu ~1988!# shows a transition at the critical micellization temperature ~CMT!. Below the CMT, a small particle size of unimers ~2.3 nm! is ob- served with very little temperature dependence. Micelle formation becomes appreciable abovetheCMT.Inthemicelleregion,themeasuredmicellarmassincreaseslinearlywith temperature, while the hydrodynamic radius of the micelles remains nearly constant ~8.0 nm!.~EO! ~PO! ~EO! showsdetectableaggregatesat25°Cwhentheconcentrationis 13 30 13 above approximately 6% @Al-Saden etal. ~1982!#. The micelle size increases with con- centration ~10 nm at 8%–12.5 nm at 20%! and exhibits significant polydispersity. At 35°C, however, essentially invariant values for the hydrodynamic radius are found over a wide concentration range and the micelles are roughly monodisperse. Mortensen and co-workers ~1992a, 1992b, 1993a, 1993b! found that the radius of gyration of the free copolymers ~unimers! is 1.7 nm.The micellar sizes ~micelle core radius and hard-sphere interactionradius!areindependentofpolymerconcentration,butshowsmalltemperature dependence reflecting a change in aggregation number. The micelle core radius and hard-sphere interaction radius are 3.8 and 6.0 nm at 20°C, respectively, and increase to 5.1 and 7.5 nm at 50°C. The SANS results of Yang and Alexandridis ~2000a! on 2.5wt%~EO! ~PO! ~EO! in aqueous (D O) solution show that the micelles are well 13 30 13 2 separated while the intermicellar interaction remains strong and a core-shell model is more appropriate for the micelle morphology. Upon an increase of temperature in the range 35–55°C, the micelle radius increases by about 10%, accompanied by the loss of water in the micelle core. In the analysis of SANS intensity distributions from ~EO! ~PO! ~EO! and 19 43 19 ~EO! ~PO! ~EO! micelles in aqueous solutions, Liu and co-workers ~1998! proposed 27 61 27 a‘‘cap-and-gown’’modelforthemicrostructureofthemicelles,takingintoconsideration the polymer segmental distribution and water penetration profile in the core and corona MICELLARSTRUCTURECHANGES 1225 regions, coupled with an adhesive hard-sphere model for describing the intermicellar interactions.The structure of micelles stays essentially constant as a function of concen- tration,butchangesrapidlywithtemperature.Themicellarcoreisnotcompletelydrybut contains up to 20% volume fraction of solvent molecules at low temperatures ~35°C!. The aggregation number increases, but the micelle contains less water with increasing temperature. Contrasting the two polymers suggests that micelles formed by a polymer withhighermolecularweighttendtocarryalargervolumefractionofsolventmolecules. Studies on ~EO! ~PO! ~EO! , ~EO! ~PO! ~EO! , and ~EO! ~PO! ~EO! re- 27 39 27 67 39 67 96 39 96 vealedcomplexstatesofaggregationinsolution@Brownetal.~1992!#.Unimer,micelles, andlargeraggregatedclusterscoexistandtheirfractionsdependstronglyontemperature andconcentration.Theunimershavehydrodynamicradiiintherangeof1.5–3.0nm;the micelle radii are 8–13 nm ~in sequence of increasing PEO block length!, whereas the radiioftheclustersaregreaterthan80nm.MortensenandBrown~1993a!foundthatthe PPO concentration is the relevant parameter that determines the CMT.The micellar core radius,R , isessentiallyindependentofcopolymerconcentrationbutshowsasignificant C increase with temperature. When R is plotted against reduced temperature T–T , C CMT the data for solutions of the three copolymers fall on a common master curve following an empirical scaling relation R ; (T2T )0.2. In the studies of Brown and co- C CMT workers ~1992!, oscillatory shear rheological measurements were also utilized in combi- nation with dynamic light scattering ~DLS! and SANS techniques to probe the gelation process with increasing temperature for the three copolymers at high concentrations. Aqueous solutions of all three copolymers are liquids ~i.e., G9 @ G8! at low tempera- tures and gel at elevated temperatures ~where G8 increases by several orders of magni- tude and becomes much larger than G9!. When the temperature is increased further, G8 9 passes through a maximum and eventually drops to values smaller than G . The entire processofgelformationanddissolutionatdifferenttemperaturesisthermallyreversible, showingverylittlehysteresis.TheirDLSandSANSresultsindicatethatthegelconsists of close-packed micelles. Prud’homme and co-workers ~1996! also used rheometry together with SANS to ex- amine the gelation and gel structure of ~EO! ~PO! ~EO! in water. At copolymer 100 65 100 concentrations of less than 12.5%, the solutions are Newtonian liquids over a wide temperature range from 10 to 75°C. For higher concentration samples (c > 15%), the fluids are non-Newtonian over an intermediate temperature range that becomes wider with increasing polymer concentration. The 15% sample is Newtonian for temperatures <30or >50°Candnon-Newtonianbetween30and50°C,reachingaviscositymaxi- mum at ;40°C. Gels with an ordered structure formed by cubic packing of spherical micelles are observed over a well-defined temperature window when the copolymer concentrationsaregreaterthan17wt%.Lowyieldstresses,veryhighzeroshearviscosi- ties, and shear thinning are the major rheological characteristics of the gels. The yield stressisduetorepulsiveinteractionsofPEOchainsintheoverlappedmicellarshell.The transition between Newtonian and non-Newtonian behavior becomes more abrupt for higher solution concentrations. The sharp transition in the rheological data accompanies the structural order seen in the SANS measurements. The proposed gelation mechanism involvesrepulsiveinteractionsamongclosepackedsphericalmicelles,ratherthanaggre- gation or transitions in micelle morphology to rods or lamellae. Hvidt and co-workers @Hvidt etal. ~1994!# observed more complicated rheology in solutions of ~EO! ~PO! ~EO! . At low concentrations ~,24%! a soft gel is formed 21 47 21 between 60 and 75°C.Above 35%, these solutions form very rigid gels at all tempera- tureshigherthan15°C.However,atintermediateconcentrations,ahardgelisformedat 1226 GUOETAL. low temperatures ~20–45°C! and a soft gel is formed at high temperatures ~50–75°C!, with a liquid state being present in between ~45–50°C!. III. INTERACTION OF PEO–PPO–PEO TRIBLOCK COPOLYMERS WITH ADDITIVES Jørgensen and co-workers @Jørgensen etal. ~1997!# studied ~EO! ~PO! ~EO! with 27 39 27 addedinorganicsalts.Theyexaminedfourcharacteristictransitions:cloudpoints,sphere- to-rod transition temperature, soft gel formation temperature, and hard gel formation temperatureatthecriticalgelationconcentration.Whilethemicellizationandgelationof thecopolymerinsalt-containingsolutionsfollowthesamepatternasthesalt-freesystem, thetemperaturesforcloudpoints,micellarsphere-to-rodtransition,andgelformationare shiftedwiththesaltaddition.Thecloudpointshiftsareingoodagreementwithprevious measurementsbyBahadurandco-workers@Bahaduretal.~1993!#.KFandKCldecrease the cloud point while the inorganic salt K1~CNS!2 gives a higher cloud point. The temperature shifts for the sphere-to-rod transition and the soft gel formation are equal to thetemperatureshiftsincloudpointforthedifferentsalttypesandtheobservedshiftsare proportional to salt concentration. The temperatures of hard gel formation do not follow the same pattern, however. Different salts give different shifts and the shifts are incon- sistent with the shifts in cloud point. Hecht and Hoffmann ~1994 and 1995! have investigated the influence of electrolytes and surfactants on the aggregation behavior of ~EO! ~PO! ~EO! , 100 39 100 ~EO! ~PO! ~EO! and ~EO! ~PO! ~EO! . The micelle formation is influenced by 20 69 20 97 69 97 theadditionofbothsaltsandsurfactants.TheCMTofthecopolymersdecreaseslinearly as salt is added, presumably reflecting a poorer solvent condition. Ionic surfactants strongly interact with PEO–PPO–PEO copolymers. Anionic surfactant sodium dodecyl sulfate ~SDS! binds to monomers of ~EO! ~PO! ~EO! and can suppress completely 97 69 97 theformationofcopolymermicelles.Atsaturation,aboutsixSDSmoleculesbindtoone copolymer molecule. The peak observed in differential scanning calorimetry, associated with the CMT, decreases on the addition of SDS and eventually completely disappears @Hecht etal. ~1995!#. SDS begins to aggregate with ~EO! ~PO! ~EO! at concentra- 100 39 100 tions less than a quarter of its own CMC @Contractor and Bahadur ~1998!#. SDS mol- ecules strongly interact with the hydrophobic PPO core of ~EO! ~PO! ~EO! and 13 30 13 ~EO! ~PO! ~EO! to form mixed micelles at temperatures lower than the CMTof the 78 30 78 copolymers alone @Almgren etal. ~1991a and 1991b!#. Recently,theternaryphasediagramsof~EO! ~PO! ~EO! aqueoussolutionswitha 37 56 37 variety of additives have been reported. The additives promote micellar structural changes, with three possible structures: spherical, worm-like, and lamellar micelles. Structure identification was performed with small-angle x-ray scattering. The additives studied were two esters ~triacetin and propylene carbonate! @Ivanova etal. ~2000a!#, and ethanol, propylene glycol ~a C diol!, glycerol ~a C triol!, and glucose ~a C polyol! 3 3 6 @Ivanova etal. ~2000b!; Alexandridis etal. ~2000!#. Each additive produced a distinct ternary phase diagram, with extensive regions having multiple coexisting phases. IV. EXPERIMENT A. Materials Pluronic®P105wasprovidedbyBASFCorp.andSurfynol®104wassuppliedbyAir Products and Chemicals, Inc. Both materials were used as received without further puri- fication.ThePluronic®P105isatriblockcopolymerofthestructure~EO! ~PO! ~EO! 37 56 37 MICELLARSTRUCTURECHANGES 1227 withawaxyappearanceatroomtemperature.Ithasanominalmolecularweightof6500, composedofacenterPPOblockaccountingfor50%ofthemassandtwoidenticalPEO end blocks accounting for the other 50% of the mass. The Surfynol® 104 is a whitish solidmaterialwithawaxyappearanceatroomtemperatureandhasverylowsolubilityin water~roughly0.1wt%!.ItisaC diolwithmolecularweightof226andthefollowing 14 structure: CH CH CH CH u 3 u 3 u 3 u 3 CH CH C C C C CH CH u u 2uu u w uu u 2uu CH OH OH CH 3 3 B. Equipment SteadyshearviscositymeasurementsweremadeusingtheContravesLS30controlled shear rate rheometer with a concentric cylinder geometry.The cup diameter is 12.0 mm, while the bob has a diameter of 11.1 mm and a height of 8 mm. The dynamic measure- mentswereperformedusingaRheometricScientificSR2000controlledstressrheometer with a cone and plate geometry. The cone has a diameter of 40 mm and cone angle of 0.0397rad.Inbothrheometers,temperatureiscontrolledusingacirculatingwaterbathto 60.1°C. Small-angle neutron scattering experiments were performed at the NIST Center for Neutron Research, Gaithersburg, MD. A combination of three instrumental setups was used to cover a q range from 0.0014 to 0.27 Å21. For the very low q range from 0.0014 to 0.005 Å21, the neutron wavelength used is 12 Å with a 15% full-width-at-half- maximum ~FWHM! wavelength spread. The neutron source to sample distance is 16.32 mandthesampletodetectordistanceis13.10m.Thesourceaperturediameteris25mm and the sample diameter is 9.53 mm. For the low q range from 0.005 to 0.05 Å21, a neutron wavelength of 6 Å with a 15% FWHM wavelength spread is used. The neutron source-sample distance is 16.32 m and the sample-detector distance is 13.10 m. The source aperture diameter is 14.0 mm and the sample diameter is 9.53 mm. For the intermediate to high q range from 0.05 to 0.27 Å21, a 6 Å neutron wavelength with a 15%FWHMspreadhasbeenused.Theneutronsourcetosampledistanceis14.77mand thesampletodetectordistanceis2.35m.Thesourceaperturediameteris50mmandthe sample diameter is 9.53 mm. For data fitting with analytical models, smearing is applied tothewholeqrangewiththeearlierinstrumentalsetupsbyusingtheresolutionfunction R(q,^q&) developed by Pedersen and co-workers @Pedersen etal. ~1990!#. We did not performincoherentbackgroundscatteringmeasurements.Hence,inourmodelfitting,the background scattering is not subtracted. Instead, we treated the background scattering as an adjustable q-independent parameter. V. RESULTSAND DISCUSSION Thecopolymer~EO! ~PO! ~EO! iseasilydissolvedinwateratroomtemperature. 37 56 37 A5wt%stocksolutionofthiscopolymerinde-ionizeddistilledwaterwasfirstprepared. The C diol has a low solubility in water ~up to 0.1 wt%! but can be added to the 14 copolymersolutioninmuchlargeramounts.DifferentamountsofC diolwereaddedto 14 the 5 wt% copolymer stock solution to prepare the samples studied. The samples were annealedat80°Cformorethan30minutesandthentakenoutoftheovenandshakenfor mixing. They were then annealed for another 30 minutes at 80°C, followed by constant 1228 GUOETAL. FIG.1. Lowshearrate~0.001s21!viscosityat25°Cfor5wt%aqueous~EO!37~PO!56~EO!37solutionswith theadditionofC14diolatdifferentlevels.Thedashedlineintheplotismeantforvisualguidance. shaking when taken out of the oven to cool down to room temperature. This heat treat- ment appears to accelerate the approach to equilibrium as detailed later. Lowshearrate~0.001s21!viscositywasmeasuredforthesamplesandtheresultsare showninFig.1.Hereitcanbeseenthatuptothediol/copolymerweightratioof0.3,all the samples show nearly an identical viscosity to that of 5 wt% copolymer in water~1.6 cp!. Above the weight ratio of 0.3, the viscosity increases sharply and reaches a maxi- mum at the weight ratio of 0.61. When the diol level increases further, the viscosity begins to drop significantly until the weight ratio of 0.80 is reached. In the diol/ copolymer weight ratio range from 0.8 to 5, the viscosity is nearly constant at ;10 cp. Whentheweightratioreaches6,theviscosityhasanothersharpincreaseandthesolution has the consistency of a thick paste. Figure 2 shows the shear rate dependent apparent viscosityforthecopolymersolutionswithdifferentamountsofdioladded.Thesolutions FIG.2. Shearratedependenceofapparentviscosityfor5wt%~EO!37~PO!56~EO!37solutionwiththeaddition ofC14diolatdifferentlevels. MICELLARSTRUCTURECHANGES 1229 FIG.3. SchematicrepresentationofthecascadeofmicellarstructurechangesincopolymersolutionsasC14 diolisadded. at the diol/copolymer weight ratio of 0.61 and 6 demonstrate strong shear thinning.This strongshearthinningisinstarkcontrasttothenearlyNewtonianbehavioratotherweight ratios. The very striking rheological changes seen in Figs. 1 and 2 are a consequence of changes in micellar structure as the hydrophobic diol is added. Later we will present SANSevidenceforthecascadeofstructuralchangesshowninFig.3.Thecascadeshown in Fig. 3 is predicted @Nagarajan ~1999!# to occur when an additive incorporates within the core of the micelle and has been observed experimentally in some cases @Teixeira etal. ~2000!#. We interpret our SANS data expecting to find one of the three structures shown in Fig. 3. The form factors for these structures differ sufficiently to allow identi- fication, if these three structures are the only ones possible. SANS measurements have been made on several selected C diol/~EO! ~PO! ~EO! solutions in D O. The results are shown in Fig. 4. The 14 37 56 37 2 FIG.4. Small-angleneutronscatteringintensityfor5wt%~EO!37~PO!56~EO!37solutionswithaddedC14diol atdifferentlevels. 1230 GUOETAL. SANS results at the diol/copolymer weight ratio of 0.3 are consistent with a microstruc- ture of spherical micelles composed of a PPO core and PEO shell regions.This explains thealmostidenticalsolutionviscositytothatofthediol-freesolution.Attheweightratio of 0.61, a worm-like micelle microstructure is indicated from the scattering pattern. The local viscosity maximum as seen at this weight ratio is just the manifestation of the worm-likemicelleshinderedorentangledinsolution.Athigherdiollevels,thescattering patterns are most appropriately described as lamellar and microemulsion-like ~large sphere with pure diol core!. In the subsequent sections, we fit the SANS intensity with known models, and explain the solution microstructure changes with increasing diol content. We assume that the C diol incorporates within the PPO core of the micelles, 14 becausetheC diolpartitionsalmostentirelyintothepolypropyleneglycolrichphasein 14 a ternary mixture of the C diol, polypropylene glycol, and water. 14 A. Spherical micelles SANS intensity for a monodisperse system of particles can be expressed as @Hayter and Penfold ~1981 and 1983!; Chen ~1986!#, I~q!5N~Dr!2V2P~q!S~q!1BG, ~1! where N is the number density of scattering particles, Dris the scattering length density contrast between particle and solvent, V is the volume of an individual particle, P(q) is the particle scattering form factor, S(q) is the structure factor describing interparticle interactions, and BG is the incoherent background scattering. The form factor P(q) for spherical micelles composed of core and shell regions is given as @Chen ~1986!#. F G 4p 3J ~qR ! 4p 3J ~qR ! 2 P~q!~Dr!2V25 R3~r2r! 1 1 1 R3~r2r! 1 2 , ~2! 3 1 1 2 qR 3 2 2 s qR 1 2 whereR andR arethecoreandcoronaradii,respectively,r andr arethescattering 1 2 1 2 length densities of the core and corona regions, r is the scattering length density of the s solvent D O, and J (x) 5 (sinx2xcosx)/x2 is the first-order spherical Bessel function. 2 1 In our data modeling, we assume the C diol is totally incorporated into the PPO 14 micellar core, and the corona is D O-hydrated PEO. It is also reasonable to assume no 2 water content (D O) in the core @Yang andAlexandridis ~2000b!#.The scattering length 2 densities of the core and the corona are, hence, given by r 5f r 1~12f !r , ~3! 1 PPO PPO PPO diol r 5f r 1~12f !r , ~4! 2 PEO PEO PEO D O 2 where f and f are the volume fraction of PPO and PEO in the core and corona PPO PEO of the micelles, r (0.34731026Å22), r (0.57231026Å22), r (0.178 PPO PEO diol 31026Å22), and r (6.3331026Å22) are the scattering length density of PPO, D O 2 PEO, C diol, and D O, respectively. The mass density used for the calculation of 14 2 volume fraction for each component is d 5 d 5 1.009g/cm3, d PPO PEO diol 5 0.898g/cm3, andd 5 1g/cm3~intheSANSmeasurements,D Owasusedasthe H O 2 2 solvent,withitsvolumefractionkeptthesameasthatofH Oasusedforthesamplesin 2 the rheological measurements!. Assuming that the steric interactions between spherical micelles can be described by thehardsphereinteractionpotentialofthePercus–Yevickapproximation,andthespatial correlation fluctuations can be described by the classical Ornstein–Zernike approxima- MICELLARSTRUCTURECHANGES 1231 FIG.5. Schematicofsphericalmicelles.R1andR2aretheradiiofthemicellecoreandshell.Rhsisthehard, sphere interaction radius. For relatively low copolymer concentrations, the micelles are well separated and Rhs . R2. tion,thestructurefactorS(q) canbewritteninthefollowinganalyticalformat@Ashcroft and Lekner ~1996!; Kinning and Thomas ~1984!; Mortensen and Pedersen ~1993b!# 1 S~q!5 , ~5! 1124fG~2qR ,f!/~2qR ! hs hs whereG(x,f) isatrigonometricfunctionofx 5 2qR andthevolumefractionfofthe hs hard sphere of radius R ~2R is just the effective interparticle contact distance!: hs hs G~x,f!5@~112f!2/~12f!2#@~sinx2xcosx!/x2#2@6f~11f/2!2/~12f!4#$@2xsinx 1~22x2!cosx22#/x3%1@~f/2!~112f!2/~12f!4#$@4~x326x! 3sinx2~x4212x2124!cosx124#/x5%. ~6! The micellar core and shell radii and the hard sphere radius are illustrated in Fig. 5.The significance of R is that the micelles cannot come closer than a distance defined by hs 2R due to strong repulsion. It should be pointed out that the volume fraction fin Eq. hs ~6! should be that of the hard spheres instead of the micelles. Only for concentrated solutions does the hard-sphere radius approach the micelle outer shell radius and the hard-sphere volume fraction converge to that of the micelles. The earlier spherical core-shell model is fitted to the SANS data for the ternary copolymersystematthediol/copolymerweightratioof0.3andthefitisshowninFig.6. InstrumentsmearinghasbeenappliedtothefitbyusingtheresolutionfunctionR(q,^q&) developed by Pedersen and co-workers @Pedersen etal. ~1990!#. By assuming that the C diolistotallyincorporatedintothePPOcoreandthereisnowater(D O) inthecore, 14 2 thevolumefractionofC diolinthecoreregioniscalculatedandfixedat0.40.Thecore 14 and shell radii as well as the hard-sphere interaction radius are adjustable parameters. It 1232 GUOETAL. FIG. 6. SANS intensity for 5 wt% ~EO!37~PO!56~EO!37 solution with added C14 diol at a diol/copolymer weightratioof0.3.Thesmearedfitofthesphericalcore-shellmodel@solidline,Eq.~1!#,givesacoreradius R15 65Å, ashellradiusR25 80Å, andhardsphereinteractionradiusRhs5 104Å. is seen that the core-shell model gives a good fit to the experimental data in the low to intermediateqrange.Thefitgeneratesamicellarcoreradiusof65Å,ashellradiusof80 Å,andthehard-sphereinteractionradiusof104Å.TheaveragevolumefractionofPEO in the shell is thereby calculated to be 0.69. Knowing the monomer volume of PO, V 5 95.4Å3, the micelle aggregation number is easily calculated as n PO 5 0.6(4pR3/3)/(56V ) ’ 130. A recent SANS study @Yang and Alexandridis 1 PO ~2000b!# reveals that 8wt%~EO! ~PO! ~EO! in water at 30°C forms spherical mi- 37 56 37 celles with a core radius of 40 Å, a shell radius of 71 Å, and the hard-sphere interaction radius of 84 Å. The core and shell radii increase weakly with temperature and the hard sphere interaction radius basically keeps constant as temperature is raised. The core and shell radii reach the values of 44 and 77 Å at 50°C. The corresponding micelle aggre- gationnumberchangesfrom ;50at30°Cto ;67at50°C.PEO-PPO–PEOmicelles usuallydemonstrateincreasedmicellesizewitheitherincreasedtemperatureorincreased concentration. Our sample has lower concentration ~5 wt%! and was measured at lower temperature ~;22°C! than Yang andAlexandridis’sample but has much larger aggre- gationnumberbyafactorofalmost2.Thisclearlyindicatesthatthehighlyhydrophobic C diolpromotesaggregationofthecopolymers.Itisalsonotedthatthecoresizeofour 14 samplehasincreasedmorethantheshellsize,consistentwithourearlierassumptionthat the C diol is incorporated into the core region. 14 The limited smearing from the instrument resolution still leaves some wiggles in the high q range which do not fit the experimental data very well ~Fig. 6!. Extra smearing would be expected from two sources: polydispersity of the micelle size and smoothly decaying density profile in the corona. In our data fitting, we have assumed a sharp interface between the micelle shell and the surrounding water environment and used the simple core-shell model. In reality, the corona of hydrated PEO has a slowly varying density of monomers from the core boundary to the pure solvent water. The cap-and- gown model proposed by Liu and co-workers ~1998! has a diffuse scattering length densitydistributionintheshellregionandisexpectedtodescribethelargeqdatabetter.