loading

Logout succeed

Logout succeed. See you again!

ebook img

Monoclonal Antibody 1A7 and Related Polypeptides PDF

pages76 Pages
release year2016
file size5.08 MB
languageEnglish

Preview Monoclonal Antibody 1A7 and Related Polypeptides

UUnniivveerrssiittyy ooff KKeennttuucckkyy UUKKnnoowwlleeddggee Microbiology, Immunology and Molecular Microbiology, Immunology, and Molecular Genetics Faculty Patents Genetics 11-2-1999 MMoonnoocclloonnaall AAnnttiibbooddyy 11AA77 aanndd RReellaatteedd PPoollyyppeeppttiiddeess Malaya Chatterjee University of Kentucky Kenneth A. Foon University of Kentucky Sunil K. Chatterjee University of Kentucky Follow this and additional works at: https://uknowledge.uky.edu/microbio_patents Part of the Medical Immunology Commons, and the Medical Microbiology Commons RRiigghhtt cclliicckk ttoo ooppeenn aa ffeeeeddbbaacckk ffoorrmm iinn aa nneeww ttaabb ttoo lleett uuss kknnooww hhooww tthhiiss ddooccuummeenntt bbeenneefifittss yyoouu.. RReeccoommmmeennddeedd CCiittaattiioonn Chatterjee, Malaya; Foon, Kenneth A.; and Chatterjee, Sunil K., "Monoclonal Antibody 1A7 and Related Polypeptides" (1999). Microbiology, Immunology and Molecular Genetics Faculty Patents. 3. https://uknowledge.uky.edu/microbio_patents/3 This Patent is brought to you for free and open access by the Microbiology, Immunology, and Molecular Genetics at UKnowledge. It has been accepted for inclusion in Microbiology, Immunology and Molecular Genetics Faculty Patents by an authorized administrator of UKnowledge. For more information, please contact [email protected]. US005977316A United States Patent [19] [11] Patent Number: 5,977,316 Chatterjee et al. [45] Date of Patent: *Nov. 2, 1999 [54] MONOCLONAL ANTIBODY 1A7 AND OTHER PUBLICATIONS RELATED POLYPEPTIDES Angeles et al., “Isoabzymes: Structurally and mechanisti [75] Inventors: Malaya Chatterjee; Kenneth A. F00n; cally similar catalytic antibodies from the same immuniza tion” Biochemistry (1993) 32:12128—12135. Sunil K. Chatterjee, all of Lexington, Ky. Bhattacharya—Chatterjee et al., “Anti—idiotype antibodies as potential therapeutic agents for human breast cancer” In [73] Assignee: The Board of Trustees of the Antigen and Antibody Molecular Engineering in Breast University of Kentucky, Lexington, Cancer Diagnosis and Treatment, Conference on Breast Ky. Cancer Therapy Immunology, R.L. Ceriani (Ed.), Plenum Press, N.Y., pp. 139—148, 1994. [*] Notice: This patent is subject to a terminal dis Bhattacharya—Chatterjee et al., “Idiotype vaccines against claimer. human T cell acute lymphoblastic leukemia. I. Generation and characterization of biologically active monoclonal anti— [21] Appl. No.: 08/591,196 idiotypes” J. Immunol. (1987) 139:1354—1360. Bhattacharya—Chatterjee et al., “Idiotype vaccines against [22] Filed: Jan. 16, 1996 human T—cell leukemia” J. Immunol. (1988) 141:1398—1403. Related U.S. Application Data Bhattacharya—Chatterjee et al., “Idiotypic antibody immu notherapy of cancer” Cancer Immunol. Immunother. (1994) [63] Continuation-in-part of application No. 08/372,676, Jan. 17, 38:75—82. 1995, Pat. NO. 5,612,030. Bhattacharya—Chatterjee et al., “Murine monoclonal anti— [51] Int. Cl.6 ................................................. .. A61K 39/395 idiotype antibody as a potential network antigen for human [52] U.S. Cl. ................................... .. 530/387.2; 530/387.3; carcinoembryonic antigen” J. Immunol. (1990) 530/387.7; 424/1311; 424/1333; 424/1381 145:2758—2765. [58] Field of Search ............................ .. 530/3872, 387.3, Bhattacharya—Chatterjee et al., “Syngeneic monoclonal 530/387.7;424/131.1, 133.3, 138.1 anti— idiotype antibodies against a monoclonal antibody to human melanoma associated antigen” J. Immunol. (1993) [56] References Cited 150:142A (Abstract 805). Bird et al., “Single—chain antigen—binding proteins” Science U.S. PATENT DOCUMENTS (1988) 242:423—426. 4,675,287 6/1987 Reisfeld et al. . Blier et al., “A limited number of B cell lineages generates 4,693,966 9/1987 Houghton et al. . the heterogeneity of a secondary immune response” J. 4,722,840 2/1988 Valenzuela et al. . Immunol. (1987) 139:3996—4006. 4,849,509 7/1989 Thurin et al. . 4,904,596 2/1990 Hakomori . (List continued on next page.) 4,918,164 4/1990 Hellstrom et al. . 5,009,995 4/1991 Albino et al. . Primary Examiner—Sheela Huff 5,053,224 10/1991 Koprowski et al. . Assistant Examiner—Julie E. Reeves 5,057,540 10/1991 Kensil et al. . Attorney, Agent, or Firm—Morrison & Foerster LLP 5,091,177 2/1992 Hellstrom et al. . 5,102,663 4/1992 Livingston et al. . [57] ABSTRACT 5,134,075 7/1992 Hellstrom et al. . 5,141,742 8/1992 Brown et al. . The present invention relates to monoclonal antibody 1A7. 5,208,146 5/1993 Irie . This is an anti-idiotype produced by immunizing With an 5,240,833 8/1993 Nudelman et al. . antibody speci?c for ganglioside GD2, and identifying a 5,242,824 9/1993 Hellstrom et al. . hybridoma secreting antibody With immunogenic potential 5,270,202 12/1993 Raychaudhuri . in a multi-step screening process. Also disclosed are poly 5,308,614 5/1994 Hakomori . nucleotide and polypeptide derivatives based on 1A7, 5,529,922 6/1996 Chapman et al. . including single chain variable region molecules and fusion 5,571,900 11/1996 Wiegand et al. . proteins, and various pharmaceutical compositions. When 5,612,030 3/1997 Chatterjee et al. . 5,653,977 8/1997 Saleh . administered to an individual, the 1A7 antibody overcomes immune tolerance and induces an immune response against FOREIGN PATENT DOCUMENTS GD2, Which comprises a combination of anti-GD2 antibody and GD2-speci?c T cells. The invention further provides 0368131 5/1990 European Pat. Off. . 0280209 9/1993 European Pat. Off. . methods for treating a disease associated With altered GD2 0661061 7/1995 European Pat. Off. . expression, particularly melanoma, neuroblastoma, glioma, WO 86/00909 2/1986 WIPO . soft tissue sarcoma, and small cell carcinoma. Patients Who WO 92/19266 11/1992 WIPO . are in remission as a result of traditional modes of cancer WO 94/16731 8/1994 WIPO . therapy may be treated With a composition of this invention WO 94/22479 10/1994 WIPO . in hopes of reducing the risk of recurrence. WO 95/04548 2/1995 WIPO . WO 95/34638 12/1995 WIPO . WO 96/22373 7/1996 WIPO . 32 Claims, 22 Drawing Sheets 5,977,316 Page 2 OTHER PUBLICATIONS Handgretinger et al., “Aphase I study of neuroblastoma With the anti—ganglioside GD2 antibody 14G2a” Cancer Immu Chakraborty et al., “Induction of human breast cancer—spe nol. Immunother (1992) 35 :199—204. ci?c antibody responses in cynomolgus monkeys by a Hastings et al., “Production and characteriZation of a murine monoclonal anti—idiotype antibody” Cancer Res. murine/human chimeric anti—idiotype antibody that mimics (1995) 55:1525—1530. ganglioside” Cancer Res. (1992) 52:1681—1686. Chapman et al., “Induction of IgG antibodies against GD3 HaWkins et al., “A genetic approach to idiotypic vaccina ganglioside in rabbits by an anti—idiotypic monoclonal anti tion” J. Immunother (1993) 14:273—278. body” J. Clin. Invest. (1991) 88:186—192. HaWkins et al., “Plasmid vaccination against B—cell lym Charbonnier et al., “Structural convergence in the active phoma” Cancer Gene Therapy (1994) 1(3):208. sites of a family of catalytic antibodies” Science (1997) Heidenheim et al., “CDW60, Which identi?es the acetylated 275:1140—1142. form of GD3 gangliosides, is strongly expressed in human Chattopadhyay et al., “Murine monoclonal anti—idiotope basal cell carcinoma” Brit. J. Dermatol. (1995) antibody breaks unresponsiveness and induces a speci?c 133:392—397. antibody response to human melanoma—associated pro Helling et al., “Ganglioside conjugate vaccines”Mol. Chem. teoglycan antigen in cynomolgus monkeys” Proc. Natl. Neuropath. (1994) 21:299—309. Acad. Sci. USA (1992) 89:2684—2688. Hruby et al., “Fine structure analysis and nucleotide Cheresh et al., “Biosynthesis and expression of the disialo sequence of the vaccinia virus thymidine kinase gene” Proc. ganglioside GD2, a relevant target antigen on small cell lung carcinoma for monoclonal antibody—mediated cytolysis” Natl. Acad. Sci. USA (1983) 80:3411—3415. Cancer Res. (1996) 46:5112—5118. Imclone Systems Incorporated Annual Report, 1995. Cheresh et al., “Disialoganglioside GD2 and GD3 are Irie et al., “Regression of cutaneous metastatic melanoma by involved in the attachment of human melanoma and neuro intralesional injection With human monoclonal antibody to blastoma cells to extracellular matrix proteins” J. Cell. Biol. ganglioside GD2” Proc. Natl. Acad. Sci. USA (1986) (1986) 102:688—696. 83:8694—8698. Cheresh et al., “Disialoganglioside GD2 distributes prefer Kanda et al., “Both VH and VL regions contribute to the entially into substrate—associated microprocesses on human antigenicity of anti—idiotypic antibody that mimics mela melanoma cells during their attachment to ?bronectin” J. noma associated ganglioside GM3” Cell Biophys. (1994) Cell. Biol. (1986) 102:1887—1897. 24/25:65—74. Cheresh et al., “Localization of the gangliosides GD2 and Kaufman et al., “A recombinant vaccinia virus expressing GD3 in adhesion plaques and on the surface of human human carcinoembryonic antigen (CEA)” Int. J. Cancer melanoma cells” Proc. Natl. Sci. USA (1984) 81:5767—5771. (1991) 48:900—906. Cheung et al., “Antibody response to murine anti—GD2 Leahy et al., “Sequences of 12 monoclonal anti—dinitrophe monoclonal antibodies: correlation With patient survival” nyl spin—label antibodies for NMR studies” Proc. Natl. Cancer Res. (1994) 54:2228—2233. Acad. Sci. USA (1988) 85:3661—3665. Cheung et al., “Disialoganglioside GD2 anti—idiotypic Livingston et al., “GD3/proteosome vaccines induce con monoclonal antibodies” Int. J. Cancer (1993) 54:499—505. sistent IgM antibodies against the ganglioside GD3” Vaccine Cheung et al., “Ganglioside GD2 speci?c monoclonal anti (1993) 11(12):1199—1204. body 3F8: a phase I study in patients With neuroblastoma Livingston, “Approaches to augmenting the immunogenic and malignant melanoma” J. Clin. Oncol. ity of melanoma gangliosides: from Whole melanoma cells (1987)5(9):1430—1440. to ganglioside—KLH conjugate vaccines” Immunol. Rev Cochran et al., “In vitro mutagenesis of the promoter region (1995) 145:147—166. for a vaccinia virus gene: evidence for tandem early and late Mittelman et al., “Human high molecular Weight mela regulatory signals” J. Virol. (1985) 54:30—37. noma—associated antigen (HMW—MAA) mimicry by mouse Conry et al., “A carcinoembryonic antigen polynucleotide anti—idiotypic monoclonal antibody MK2—23: Induction of vaccine has in vivo antitumor activity” Gene Therapy (1995) humoral anti—HMW—MAA immunity and prolongation of 2:59—65. survival in patients With stage IV melanoma” Proc. Natl. Foon et al., “Immune response to the carcinoembryonic Acad. Sci. USA (1992) 89:466—470. antigen in patients treated With an anti—idiotype antibody Mittelman et al., “Kinetics of the immune response and vaccine” J. Clin. Invest. (1995) 96:334—342. regression of metastatic lesions folloWing development of Foon et al., “Anti—idiotype antibodies: novel therapeutic humoral anti—high molecular Weight—melanoma associated approach to cancer therapy” Immunology Series (1994) antigen immunity in three patients With advanced malignant 61:281—292. melanoma immuniZed With mouse antiidiotypic monoclonal Guo et al., “Mechanistically different catalytic antibodies antibody MK2—23” Cancer Research (1994) 54:415—421. obtained from immuniZation With a single transition—state Miyashita et al., “A common ancestry for multiple catalytic analog” Proc. Natl. Acad. Sci. USA (1995) 92:1694—1698. antibodies generated against a single transition—state ana Hamilton et al., “Ganglioside expression on human malig log” Proc. Natl. Acad. Sci. USA (1994) 91:6045—6049. nant melanoma assessed by quantitative immune thin—layer Moss, “Vaccinia virus: A tool for research and vaccine chromatography” Int. J. Cancer (1993) 53:566—573. development” Science (1991) 252:1662—1667. Hamilton et al., “Ganglioside expression on sarcoma and Mujoo et al., “Disialoganglioside GD2 on human neuroblas small—cell lung carcinoma compared to tumors of neuroec toma cells: Target antigen for monoclonal antibody—medi todermal origin” Proc. Am. Assoc. Cancer Res. (1993) ated cytolysis and suppression of tumor groWth” Cancer 34:491 (Abstract 2928). Res. (1987) 47:1098—1104. 5,977,316 Page 3 Mujoo et al., “Functional properties and effect on growth Sen et al., “Murine monoclonal antibody—idiotype antibody suppression of human neuroblastoma tumors by isotype breaks tolerance and induces speci?c antibody response to switch variants of monoclonal antiganglioside GD 2 antibody human disialoganglioside GD2 in cynomolgus monkeys” 14.18” Cancer Res. (1989) 49:2857—2861. Abstract presented at the 9th International Congress of Nahmias et al., “The immune response toWard [3—adrenergic Immunology, San Francisco, California, Jul. 23—29, A5250, ligands and their receptors. VIII. Extensive diversity of VH p. 885, 1995. and VL genes encoding anti—alprenolol antibodies” J. Immu nol. (1988) 140:1304—1311. Sen et al., “Murine monoclonal anti—idiotype (Id) antibody Posnett et al., “A novel method for producing anti—peptide induces speci?c humoral responses to the GD2 ganglioside antibodies” J. Biol. Chem. (1988) 263:1719—1725. in melanoma patients” Abstract submitted for AAAAI/AAI/ Qin et al., “Construction of recombinant vaccinia virus CIS Joint Meeting, 1997. expressing GM—CSF and its use as tumor vaccine” Gene Therapy (1996) 3:59—66. Spooner et al., “DNA vaccination for cancer treatment” Reininger et al., “Cryoglobulinemia induced by a murine Gene Therapy (1995) 2:173—180. IgG3 rheumatoid factor: Skin vasculitis and glomerulone StenZel—Poore et al., “Clonal diversity, somatic mutation, phritis arise from distinct pathogenic mechanisms” Proc. and immune memory to phosphocholine—keyhole limpet Natl. Acad. Sci. USA (1990)87(24):10038—10042. hemocyanin” J. Immunol. (1989) 143:4123—4133. Russell et al., “Plasmid vaccination to elicit anti—idiotypic immune responses against surface immunog1obin—positive Tam, “High—density multiple antigen—peptide system for B—ce11 malignancies” Brit. J. Haematology (1994) 86(No. preparation of antipeptide antibodies” Methods Enzymol. Suppl. 1):74 (Abstract P146). (1989) 168:7—15. Saleh et al., “Generation of a human anti—idiotypic antibody that mimics the GD2 antigen” J. Immunol. (1993) Tang et al., “Genetic immuniZation is a simple method for 151(6):3390—3398. eliciting an immune response” Nature (1992) 356:152—154. Saleh et al., “Phase I trial of the murine monoclonal Tsuchida et al., “Gangliosides of human melanoma” J. Natl. anti—GD2 antibody 14G2a in metastatic melanoma” Cancer Cancer Inst. (1987) 78:45—54. Res. (1992) 52:4342—4347. Seaver, “Monoclonal antibodies in industry: More dif?cult Wang et al., “Immunization by direct DNA inoculation than originally thought” Genetic Engineering News (Aug. induces rejection of tumor cell challenge” Human Gene 1994) pp. 10, 21. Therapy (1995) 6:407—418. Sen et al., “Induction of IgG antibodies by an anti—idiotype antibody mimicking disialoganglioside GD2” Galley Proof Yamamoto et al., “Anti—idiotype monoclonal antibody car of article accepted for publication in J. Immunother (1997), rying the internal image of ganglioside GM3” J. Natl. 9 pages total. Cancer Inst. (1990) 82(22):1757—1760. 5,977,316 U.S. Patent Nov. 2, 1999 Sheet 1 0f 22 Fi ure 1 M K L P V R L L V L M F W I P A ATG AAG TTG CCT GTT AGG CTG TTG GTG CTG ATG TTC TGG ATT CCT GCT S S D r11cc AGC GAT (-1 to -19, leader) D V L M T Q T P L S L P V GAT GTT TTG ATG ACC CAA ACT CCA CTC TCC CTG CCT GTC AGT CTT D Q A S I S C GAT CAA GCC TCC ATC TCT TGC (1-23, Frame work 1) R S S Q S I V H S N G N T AGA TCT AG'I‘ CAG AGC ATT GTA CAT AGT AAT GGA AAC ACC (24-39, CDR l) W Y L Q K P G Q S P N L L TGG TAC CTA CAG AAA CCA GGC CAG TCT CCA AAC CTC CTG ATC TAC (40-54, Frame work 2) F V S N R F S TTT GTT TCC AAC CGA TTT TCT (55-61, CDR 2) G V P D R F S G S c; s c; T GGG GTC CCA GAC AGG TTC AGT GGC AGT GGA TCA soc ACA GAT TTC ACA L K I S R V E A E D L G v CTC AAG ATC AGC AGA GTG GAG GCT GAG GAT c'rc GGA GTT TAT TAC TGC (62-93 , Frame work 3) P Q G S H V P W T 'I'TT CAA GG'I‘ TCA CAT GTT CCG TGG ACG (94-102, CDR 3) F G G G T K L E I K TTC GGT GGA GGC ACC AAG CTG GAA ATC AAA (103-112, Frame work 4) R A D A A P T V S I F P P CGG GCT GAT GCT GCA CCA ACT GTA TCC ATC TTC CCA CCA S S K L G TCC AGT AAG CTT GGG (Constant region) U.S. Patent Nov. 2, 1999 Sheet 2 0f 22 5,977,316 Figure 2 M A v L c L L F c L v T F P s c ATc; ccT GTC TTG GGG CTG cTc TTc TGC CTG GTG MA MC CCA AGC TGT v L s GTC CTG Too (-1 to -19, Leader) Q V Q V K E S G P F L V P P S cAG GTG CAG GTG AAG GAG TCA GGA CCT TTC CTG/ GTG CCC CCC TCA CAG S L S I T C T V S G F S L T AGC CTG TCC ATC ACA TGC ACT GTC TCA GGG TTC TCA TTA ACC (1-30, Frame work 1) T Y c; v s Acc TAT GGT GTA AGC (31-35, CDR 1) W I R Q P P G K G L E W L G TGG ATT CGC CAG CCT CCA GGA AAG GGT CTG GAG TGG CTG GGA (36-49, Frame work 2) A I w c D c; T T N y H s A _L I s GCA ATT TGG GGT GAC ccc; Acc AcA AAT TAT cAT TcA GCT cTc ATA Tcc (50-65, c012 2) R L S I S K D N S K S Q V F L K AGA CTG AGC ATC AGC AAG GAT AAC TCC AAG AGC CAA G'I'T TTC TTA AAA L N S L Q T D D T A T Y Y C A K CTG AAC AGT CTG CAA ACT GAT GAC ACG GCC ACG TAC TAC TGT GCC AAA (66-97, Frame work 3) L G N Y D A L D Y CTG GGT AAc TAc GPT GCT CTG GAC TAc (98-106, CDR 3) W G Q G T S V T V S S TGG GGT CAA GGA ACC TCA GTC ACC GTC TCC TCA ( 107-117 , Frame work 4) ' A K T T P P P v Y P L v P c; s L Gcc AAA ACG AcA ccc CCA ccc GTC TAT ccA TTG GTC ccT GGA AGC TTG cc (Constant region) ' U.S. Patent Nov. 2, 1999 Sheet 3 0f 22 5,977,316 Figure 31A! 1A7: 1 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEHYLQKPGQSPNLLIYFVSNRF 60 1 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 2 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 3 1 ..V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 4 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 5 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 6 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 7 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 8 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 9 5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..S...F . . . . . . . . . . 64 1O 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 11 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6O 12 2O . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 13 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..K....K....L 60 14 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 15 5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..S...F . . . . . . . . . . 64 1A7: 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIK 112 1 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 112 2 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 112 3 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 112 4 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 111 5 61 ....X . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 112 6 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..Y . . . . . . . . . .. 112 7 61 . . . . . . . ..C . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 111 8 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. 111 9 65 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..T . . . . . . . . . . . . . .. 116 10 61 . . . . . . . . . . . . . . . . . . ..R . . . . . . . . . . . . . . . . . ..Y . . . . . . . . . .. 112 11 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..R . . . . . . . . . .. 112 12 8O . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..Y...S . . . . . .. 131 13 61 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ..Y . . . . . . . . . .. 112 14 61 . . . . . ..T . . . . . . . . . . . . . . . . . . . . . . . ..H . . . . ..Y . . . . . . . . . .. 112 15 65 . . . . . . . . . . . . . . . . . . . . . . . . . ..Q . . . . . . ..T . . . . . . . . . . . . . .. 116 U.S. Patent Nov. 2, 1999 Sheet 4 0f 22 5,977,316 Fi 11A234567890123457 : 1110111131301131 QVQVKESGPFLVAAAHAHAPHAHAHAHAHAHAPHAHAHAHAH SQSLSITCTVSGFSLTI'YGVSWIRQPPGKGLEWLGAIWGDGSTNSSSSSNNNNNNNN TNYH 5676666866w76886 0209000020290020 HTHHHHUHH..HS... .LLLLLLLLLLLulmLLO UHHHHHQHQHHHQQ .NNNNNNNNNNNNN P. “HHHT.......... THHHHHNNNDNNNNU.............. VVVVVVVVVVVVVVV............... TMMMMVMMVVVVVM.............. nn.S....A A GGGGGN...... B22222 111111 DDDDDDDD...... 123456789012345 568666686H86886 310111131301131 1A7: 61 SALISRLSISKDNSKSQVFLKLNSLQTDDTATYYCAKL- - - - - - - -GNYDALDYWGQGTSVTVSS 117 - -YDYExxxxx. . . . . . .TL. . 109 .1 - -xxxxxxx.K. . . . . . . . . . . . . 120 T. UT. YYYGRSDK.FT. . . . . . . . . . . . . . 144 XXPEEExEDXvEE - - -xx.D.Y.M. . . . . . . . . . . . . 119 - -xxxxxx.Y.M. . . . . . . . . . . . 120 - -xxxx.Y.M. . . . . . . . . . . . 118 - -xxx.X.Y.M. . . . . . . . . . . . 119 ..SR.WRR WM XRRRRR - -=RDYR T 138 MKKKKMMMKKKKKH............. MMMMMMMMMMMMMH............. RRRMRRRMMMMRLH............ ......._...._S. .............T. . 111111 - -=RDYR. . . . . . . .TL 116 ..VAH.HHH HH - -=RDYR. . . . . . . .T. . . . . 248 “........ I. - -=RDYR TL 135 - - - - -GYYDX.M. . . . . . . . . . . . 117 - - -xxxxx.Y.M. . . . . . . . . . . . . 139 - - - - -=RDYR. . . . . . . .T. . . . 138 - -=RDYR T 116 U.S. Patent Nov. 2, 1999 Sheet 5 0f 22 5,977,316 Fi r 3 C WWW-It ****** v|. consensus: 1 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKKGQSPKLLIYFVSNRF 60 1A7: 1 .......................................... ..P....N ........ .. e0 * ********* VL consensus: 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPNTFGGGTKLEIK 112 1A7: 61 .................................................. .. 112 ***** *********** VH consensus: 1 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWGDGSTNYN 60 1A7: 1 ...V.....F..P ............... ..T...S.I .......... ..A.....T...H 60 ***** **~k***"k**** VH consensus: 61 SALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAREXXXXYYAMDYWGQGTSVTVSS 119 1A7: 61 ...I . . . . . . . . . . . . . . . ..L . . . . . . . ..T....KL--GN.D.L . . . . . . . . . . . .. 117 U.S. Patent Nov. 2, 1999 Sheet 6 0f 22 5,977,316 Figure 4 50000 40000l 30000-2 cprn bou nd I 20000-2 .4 10000»; - 0.049 0.098 0.195 0.39 0.78 1.56 3.125 6.25 12.5 25 pg Ab3 added

See more

The list of books you might like