loading

Logout succeed

Logout succeed. See you again!

ebook img

Nucleic Acid Sequence Alignments of Partly Coding Regions PDF

pages142 Pages
release year2003
file size1.18 MB
languageEnglish

Preview Nucleic Acid Sequence Alignments of Partly Coding Regions

Nucleic Acid Sequence Alignments of Partly Coding Regions DISSERTATION zur Erlangung des akademischen Grades Doctor rerum naturalium Vorgelegt der Fakult¨at fu¨r Naturwissenschaften und Mathematik der Universit¨at Wien von Mag. Roman Stocsits am Institut fu¨r Theoretische Chemie und Molekulare Strukturbiologie Februar 2003 i Abstract High quality sequence alignments of RNA and DNA sequences are a prereq- uisite for the comparative analysis of genomic sequence data. The high level of sequence heterogeneity, as compared to proteins, makes good alignments of nucleic acid sequences often impossible. In many cases, the nucleic acid sequencesunderconsideration,orpartsofthem,codeforproteins. Whilepro- tein sequences can still show substantial homology, the corresponding nucleic acid sequences have already evolutionarily diverged, thus they are essentially randomized. This is caused by the inherent redundancy of the genetic code: Most amino acids have more than one codon on the level of nucleic acid. This specific problem leads to gaps and incorrectly aligned segments within coding regions. Inthethesisamultiplenucleicacidalignmentprocedurewasimplemented that uses genetic information about coding and non-coding regions as part of the scoring function in order to improve the resulting alignment. Our algorithm combines (mis)match scores for nucleic acids with those for the underlying amino acids in the case of open reading frames and exons. The program makes explicit use of information about overlapping open reading frames, as they occur in virus sequences, to further improve the reliability and quality of the nucleic acid alignment. The implementation is realized in the program package code2aln which is freely available. Code2aln is based upon a Gotoh-type dynamic programming algorithm with affine gap penalties, and features more complex scoring functions for coding regions that combine nucleic acid with amino acid scores. Alignments computed with code2aln have a significantly improved qual- ity in coding regions compared to other methods for nucleic acids. In par- ticular, disruptions of codons are reduced. Code2aln alignments are shown to improve the sensitivity of a method for the detection of conserved RNA structures. An application of code2aln to two unrelated groups of viruses is de- scribed. We processed the alignments as input for the procedure of alidot for detecting conserved RNA secondary structure elements in RNA genomes of Leviviridae and the pregenomic RNA of human hepatitis B virus. Virus genomes contain various (partially overlapping) open reading frames and are ii an ideal test case for a procedure that makes usage of information about (overlapping) coding regions to improve the input alignments and, therefore, the identification of conserved secondary structures. We find a number of highly significant secondary structure elements, not being described in the literature so far, and some well known elements like the ε-elements and two important elements of the HPRE region in hepatitis B virus. Also the results of the Levivirus group are of particular interest: We detect various secondary structure elements that are strongly confirmed by compensatory mutations and gain novel insight into the structural orga- nization of Levivirus genomes. iii Zusammenfassung Nukleins¨auresequenz-Alignments hoher Qualit¨at sind von großer Bedeutung fu¨r die vergleichende Analyse genomischer Sequenzdaten. Die h¨ohere Sequ- enzheterogenit¨at auf der Ebene von Nukleins¨auren, verglichen mit Protein- sequenzen, macht es oft unm¨oglich, gute Nukleins¨aure-Alignments zu errei- chen. Invielen F¨allencodieren die betrachteten Sequenzen, oder Teile davon, fu¨r Proteine. W¨ahrend Proteinsequenzen weitgehend Homologie zeigen, k¨on- nen die entsprechenden Nukleins¨auresequenzen evolution¨are Divergenz bis hin zur v¨olligen Heterogenit¨at zeigen. Der Grund ist die inh¨arente Redun- danz des genetischen Codes: die meisten Aminos¨auren haben mehr als ein Nukleins¨aure-Codon. Das fu¨hrt zu ’Gaps’ und schlecht alignierten Teilen innerhalb codierender Regionen. Wir haben einen multiplen Nukleins¨aure-Alignmentalgorithmus entwik- kelt, der genetische Information u¨ber codierende und nicht codierende Regio- nen als Teil der Scoring-Funktion nutzt, um die resultierenden Alignments zu verbessern. Unsere Implementation kombiniert (Mis)match-Scores vonNukl- eins¨auren mit denen der entsprechenden Aminos¨auren innerhalb codierender Bereiche und Exons. Der Algorithmus zieht explizit Nutzen aus der Infor- mation u¨ber u¨berlappende ORFs, wie sie in Virussequenzen oft vorkommen, um die Qualit¨at der Nukleins¨aure-Alignments weiter zu optimieren. DerAlgorithmusistimplementiert indemProgrammpaketcode2aln, das frei erh¨altlich ist. Code2alnisteineVersioneinesDynamic-Programming-Algorithmusnach dem ’Gotoh-Typ’ mit affinen Gap-Penalties und einer komplexeren Scoring- Funktion, die Nukleins¨aure- mit Aminos¨aure-Scores kombiniert. Wir konnten zeigen, dassdieAlignments tats¨achlich signifikant verbessert wurden. Wir fanden die starke Tendenz von code2aln, Codons innerhalb codierender Regionen nicht durch das Einfu¨gen von Gaps zu unterbrechen. Wir haben die Resultate von code2aln als Input fu¨r die Detektion kon- servierter RNA-Sekund¨arstrukturelemente in RNA-Genomen von Leviviri- dae und pr¨agenomischen RNA-Sequenzen von humanen Hepatitis B-Viren durch alidot angewandt. Virusgenome sind ideale Testf¨alle fu¨r eine Methode, die Information u¨ber (u¨berlappende) codierende Regionen nutzt, um deren Alignments zu verbess- ern, weil sie oft mehrere (auch u¨berlappende) ORFs enthalten. iv Wir fanden etliche hochsignifikante Sekund¨arstrukturelemente, die bis dato in der Literatur nicht beschrieben sind, sowie auch einige bekannte Elemente, wie das ε-Element und Elemente der HPRE-Region in Hepatitis B-Viren. Auch die Resultate fu¨r die Levivirus-Gruppe sind hochinteressant: wir detektierten verschiedene Elemente, die durch kompensatorische Mutationen deutlich best¨atigt sind, und wir konnten neue Einblicke in die strukturelle Organisation des Genus Levivirus gewinnen. v Danksagung Ich danke Peter Stadler fu¨r die hervorragende und freundschaftliche Be- treuung meiner Arbeit und die M¨oglichkeit, bei ihm diese Dissertation fer- tigzustellen. Danke an Ivo Hofacker fu¨r viele sehr hilfreiche Ratschl¨age und Hinweise. Ich danke Peter Schuster fu¨r die freundliche Aufnahme an seinem Institut. Vielen Dank auch an Christoph Flamm fu¨r seine immerw¨ahrende Hilfsbe- reitschaft. DankeanallemeineFreundeundKollegen: MichaelWolfinger,StefanieWid- der, Daniela Dorigoni, Michael Kospach, Kurt Gru¨nberger, Judith Ivansits, Caroline Thurner, Christina Witwer, Stephan Bernhart, Stefan Mu¨ller, An- dreas Svrcek-Seiler (die unersch¨opfliche Quelle weiser Danksagungen), An- dreas Wernitznig, Gu¨nther Weberndorfer, B¨arbel Stadler, Jan Cupal, Ulli Mu¨ckstein, UliLanghammer, GilBenk¨o, CamilleStephanOttoAttolini, J¨org Hackermu¨ller, Ingrid Abfalter, Sonja Prohaska, Claudia Fried. Zuletzt vielen Dank an meine Eltern, die mir dieses Studium erm¨oglicht haben. Contents vi Contents 1 Introduction 1 2 Theoretical Background 8 2.1 Alignments in Principle . . . . . . . . . . . . . . . . . . . . . . 8 2.2 The Scoring of Alignments . . . . . . . . . . . . . . . . . . . . 8 2.3 Pairwise Alignment Algorithms . . . . . . . . . . . . . . . . . 13 2.4 Alignments with Affine Gap Penalties . . . . . . . . . . . . . . 15 2.5 Multiple Alignments . . . . . . . . . . . . . . . . . . . . . . . 17 2.6 Some Other Multiple Alignment Algorithms . . . . . . . . . . 22 2.7 RNA Secondary Structure Prediction . . . . . . . . . . . . . . 26 2.8 Inherent Difficulties of Nucleic Acid Alignments . . . . . . . . 29 3 A First Attempt: The ralign Project 31 3.1 The Idea behind ralign . . . . . . . . . . . . . . . . . . . . . . 31 3.2 The ralign Algorithm . . . . . . . . . . . . . . . . . . . . . . . 32 3.3 Results and Conclusions on ralign . . . . . . . . . . . . . . . . 36 4 The code2aln Project 40 4.1 Code2aln in Short . . . . . . . . . . . . . . . . . . . . . . . . . 40 4.2 More Complex Scoring Systems . . . . . . . . . . . . . . . . . 41 4.3 The code2aln Algorithm . . . . . . . . . . . . . . . . . . . . . 46 4.4 An Example Program Run . . . . . . . . . . . . . . . . . . . . 53 5 An Example for an Application 57 6 Hepatitis B Virus 62 6.1 The Morphology of the Hepatitis B Virus . . . . . . . . . . . . 62 6.2 The Genomic Organization of Hepadnaviruses . . . . . . . . . 64 6.3 The ε-Structure: a proximal Encapsidation Signal . . . . . . . 67 6.4 The HPRE regulatory element . . . . . . . . . . . . . . . . . . 67 6.5 Results for Hepatitis B Virus . . . . . . . . . . . . . . . . . . 68 6.5.1 Using clustalw . . . . . . . . . . . . . . . . . . . . . . . 70 6.5.2 Using code2aln . . . . . . . . . . . . . . . . . . . . . . 73 7 Leviviridae 80 7.1 The Morphology of the Levivirus Genus . . . . . . . . . . . . 80 7.2 The Genomic Organization of Levivirus . . . . . . . . . . . . . 80 Contents vii 7.3 Results for Levivirus . . . . . . . . . . . . . . . . . . . . . . . 82 7.3.1 Using clustalw . . . . . . . . . . . . . . . . . . . . . . . 87 7.3.2 Using code2aln . . . . . . . . . . . . . . . . . . . . . . 91 8 Conclusions and Outlook 97 9 Appendix A - The Codon Tables 102 10 Appendix B - The Program Description 103 10.1 The Structure Variables . . . . . . . . . . . . . . . . . . . . . 103 10.2 The Routines . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 11 Appendix C - The Manual Page 117 11.1 NAME . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117 11.2 SYNOPSIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117 11.3 DESCRIPTION . . . . . . . . . . . . . . . . . . . . . . . . . . 117 11.4 OPTIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118 11.5 VERSION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 119 11.6 AUTHOR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 119 11.7 BUGS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 119 1 Introduction 1 1 Introduction During the last decades, research in the fields of molecular biology and bio- chemistry has provided the scientific community with huge amounts of se- quence data sets. These data are available as entries in data banks such as GenBank. In many cases, however, there are no satisfactory tools to process the data [117]. One of the most basic and essential tools for data analysis in molecular biology is the alignment of nucleotide or amino acid sequences. In principle, it is used to tell whether two or more sequences are related and to give an impression how close a relationship is in terms of sequence similarity. Multiple sequence alignments are used, for instance, to find diagnostic patterns that characterize protein families; to detect or demonstrate ho- mology between new sequences and existing families of sequences; to help predict the secondary and tertiary structures of new sequences; to suggest oligonucleotide primers for PCR; and as an essential prelude to molecular evolutionary analysis [62]. Beside the basic necessity to process existing data, the rate of appearance of new sequence data is steadily increasing and the development of efficient andaccurateautomaticmethodsformultiple sequence alignmentsisofmajor importance [1, 3]. In fact, many advanced techniques of sequence analysis are dependent upon the availablity of high quality multiple sequence alignments. A proce- dure for extracting conserved secondary structure elements from a moderate size sample of related RNA sequences will be one example in this thesis. A procedure like this needs essentially a high quality alignment of nucleic acid sequences. Recent research in our group aims at finding conserved secondary struc- ture elements that are part of the genomes of RNA viruses and the prege- nomic RNA intermediates of some DNA viruses like the Hepatitis B viruses 1 Introduction 2 HBA_HUMAN GSAQVKGHGKKVADALTNAVAHV---D--DMPNALSALSDLHAHKL ++ ++++H+ KV + +A ++ +L+ L+++H+ K LGB2_LUPLU NNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKNLGSVHVSKG Figure 1: This figure shows a protein sequence alignment between a fragment of human alpha globin and leghaemoglobin from yellow lupin. Some identities are shown and some similarpositionswhichhaveapositivescoreinthesubstitutionmatrix(indicatedby’+’). This is a biologicallymeaningfulalignment, in that we knowthat these two sequences are evolutionarily related. ADI-MAL AU-AGUACAUGGCAGAAUAAUGGUGC----AAGA------CU-AA--GU----AAUAGCACAGAGUC---AACUGGUAGUAUCACACUCCCAUG AE-90CF402 AU-AGUACUUGGAUA---------------AAUGGAACCAUGCAGGAGGUU--AAUGGCACAAACUC---A---GGCAAUAUCACACUUCCAUG B-896 AU-AGUACUUGGAAU-------G-------U-UA------CUGGAGGGACA--AAUGGCACUGAAGG---AAAUGACAUAAUCACACUCCAAUG B-ACH320A AU-AGUACUUGG------AAUGAUACUGGGAAUGUUA---CUGAAAGGUCA--AAUAACAAUGA------AAAU------AUCACACUCCCAUG B-D31 AU-AGUACUUGGAAU------------------GAUA---CUAAAGAGUCA--AAUAACACAAAU---------GGAACUAUCACACUCCCAUG B-JRCSF AU-AGUACUUGGAAU-------G-------A-UA------CUGAAAAGUCA--AGUGGCACUGAAGG---AAAUGACACCAUCAUACUCCCAUG B-LAI AU-AGUACUUGGUUU---AAUAGUACUUGGAGUA------CUGAAGGGUCA--AAUAACACUGAAGG---AAGUGACACAAUCACACUCCCAUG B-MANC AU-AGUACUUGGAAUACUGGG---------AAUGAUA---CUAGAGAGUCA--AAUGACACAAAUAA---UACUGGAAAUAUCACACUCCCAUG B-OYI AU-AGUACUUGGAAU------------------GAUA---CUACAAGGGCA--AAUAGCACUGAA---------GUAACUAUCACACUCCCAUG B-YU2 -------CUUGG------AAUGAUACUAGAAA---------------GUUA--AAUAACACUGGAAG---AAAU------AUCACACUCCCAUG D-NDK AU-AGUACAUGGAAU----------CA--GACUAAUAG---UACAGGGUUC--AAUAAUGGCACAG---------------UCACACUCCCAUG O-ANT70 AUUA-UACCUUU-UCA----------UGUAACGGAACCACCUGUAGUGUUAGUAAUGUUAGUCAAGG------UAACAAUGGCACUCUACCUUG SIVCPZGAB CUGACAACAUUA-------------------------------------CA--AAUGGCAUU------------------AUAAUACUGCCAUG Figure2: ThisfigureshowspartofaclustalwnucleicacidalignmentofHIV-1sequences. The region shown here is a coding region located at the center of the env gene. The alignment is highly disrupted. We see various gaps where they are not really necessary, because the biologically important part of the system is protein in this region of the genome. [79, 91]. For this reason predicted secondary structures of genomic RNA sequences have to be compared on the basis of a reliable multiple sequence alignment. As far as we know, almost all RNA molecules and consequently also almost all subsequences of a large RNA molecule form secondary structures. But the presence of secondary structure in itself therefore does not indicate any functional significance. Extensive computer simulations [30] showed that a small number of point mutations is very likely to cause large changes in the

See more

The list of books you might like