loading

Logout succeed

Logout succeed. See you again!

ebook img

Origin of Insulin Receptor-Like Tyrosine Kinases in Marine Sponges PDF

pages9 Pages
release year1999
file size4 MB
languageEnglish

Preview Origin of Insulin Receptor-Like Tyrosine Kinases in Marine Sponges

Reference: Binl. Bull 197: 198-206. (October 1999) Origin of Insulin Receptor-Like Tyrosine Kinases Marine in Sponges ALEXANDER SKOROKHOD1 : VERA GAMULIN3 DIETMAR GUNDACKER1 . , . VADIM KAVSAN2, ISABEL M. MULLER', AND WERNER E. G. MULLER'* 1 Institut fiir Physiologische Clieniie, Ahteilung Angewandte Molekularbiologie, Universita't. Duesbergweg 6. D-55099 Mainz, Germany: Ukrainian Academy ofSciences. Department of Biosynthesis ofNucleic Acids, Institute ofMolecular Biology and Genetics, 252627 Kiev, Ukraine, anil * Institute Rudjer Boskovic, Department ofMolecular Genetics, 10000 Zagreb, Croatia Abstract. One autapomorphic character restricted to all molecules evolved in sponges prior to the "Cambrian Ex- Metazoa including Porifera [sponges] is the existence of plosion" and contributed to the rapid appearance of the transmembrane receptor tyrosine kinases (RTKs). In this higher metazoan phyla; (//) the sponges constitute a mono- study we screened for molecules from one subfamily within phyletic taxon, and (//';') epidermal growth factor (EGF)-like the superfainily of the insulin receptors. The subfamily domains are present in sponges, which allows the insertion includes the insulin receptors (InsR), the insulin-like growth ofthis domain into potential receptor and matrix molecules. factor I receptors, and the InsR-related receptors all found in vertebrates as well as the InsR-homolog from Drosoph- Introduction ila melanogaster. cDNAs encoding putative InsRs were isolated from the hexactinellid sponge Aphrocallistex vas- The Porifera [sponges] are the oldest metazoan phylum; tus. the demosponge Suberites domuncula, and the calcar- they existed 40 to 50 million years prior to the onset of the eous sponge Svcan raphanus. Phylogenetic analyses of the "Cambrian Explosion" (Valentine et ai, 1996), the time of catalytic domains of the putative RTKs showed that the main divergence of metazoan phyla (Valentine, 1994). sponge polypeptides must be grouped with the InsRs. The Highly conserved amino acid (aa) sequences in sponges relationshipsrevealed that all sponge sequences fall intoone indicate that the Porifera share one common ancestor with branch ofthis group, whereas related sequences from mam- other metazoan phyla (Muller et ai. 1994; also see Muller, mals (human, mouse, and rat), insects and molluscs, and 1995, 1997. and 1998). These sequences include those (/) polypeptides from one cephalochordate, fall together into a for transmembrane receptors, e.g.. transmembrane tyrosine second branch. We have concluded that (/) the InsR-like kinase (TK] receptors [RTKs] (Muller and Schiicke. 1996); (/;') for transmembrane adhesion molecules, e.g., the inte- Received 13 January 1999; accepted 26 July 1999. grins (Pancer ct al., I997a); and (/;'/') for G-protein linked Towhomcorrespondenceshouldheaddressed.E-mail:WMUELLERO? transmembrane receptors for signaling molecules, e.g., the nuul.UNI-Mainz.DE metabotropic glutamate receptor (Perovic et ai, 1999). Ad- The sequences reported here are deposited in the EMBL/GenBank data ditional sequences from homeodomain transcription factors bsAaiVsoIen:NnRSuu:mbbeaercircteeYsss1di7oo8nm8u0nn;cuAumplbhaem.rcuclYDl1iN7sA8t8ets1o;rvaSIsyntcusnsR,n-lcirkDaepNhmAaonlufeoscr.ulIecn,sDRS-NlDAi1kNefRomr:oltaeyccpcueelse-1 oslhdoewstthMaetttahzeotaranisscrsiipmtiiloanraltocotnhtartolofoftgheenemoesxtprersecseinotn ipnhytlhae InsR-like molecule, SRINRI: accession numberY17877;Svctm raphanus, (Seimiya et ai. 1994; Richelle-Maurer et al, 1998; Coutinho cDNAfortype 2 InsR-likemolecule.SRINR2: accessionnumberY17878; ettil.. 1998). One metazoan autapomorphiccharacterrestricted Syciin raphanus. clJNA fortype3 InsR-like molecule,SRINR3: accession to Porifera is the presence ofhigh telomerase activity in all (or number Y17879. ivcAcbpbiroerv;iaOtRiFo.ns:opaean.aremamdoingacifdr;amkeb;,kEiGlFo,baseep;idnte,rmnaucllegortoiwdte;hIfnascRt.or;insIuGlFi-n almTohset aldli)scceollvse,ryincltuhadtingsspoomnagteisc ccelolnsta(iKnozitolraentsaml.e,mb1r99a8n)e. I-R, insulin growth factor I receptor; PTK, protein tyrosine kinase; RTK. (Schiicke et ai. 1994a), cytoplasmic (Ottilie et ai. 1992). receptor tyrosine kinase; TK, tyrosine kinase and nuclear TKs (Cetkovic et ai. 1998) suggests that the 198 INSULIN RECEPTOR-LIKE TYROSINE KINASES IN SPONGES 199 signaling system in these animals is sophisticated enough to DIG-11-dUTP, anti-DIG AP Fab fragments, and CDP respond to peptide growth factors and to cell adhesion [disodium 2-chloro-5-(4-methoxyspiro{ l,2-dioxetane-3.2'- (Miiller and Miiller. 1999). The catalytic domain of the (5'-chloro)-tricyclo[3.3.1.13'7]decan)-4-yl)phenyl phosphate] RTKs is related to that of the cytoplasmic protein tyrosine were from Boehringer Mannheim (Mannheim; Germany). kinases [PTKs] and the Ser/Thrkinases (Hanks and Hunter, 1995; Kruse et ai, 1997). The catalytic domain ofthe TKs Sponges is subdivided into 12 smaller subdomains. the first eight of which are most highly conserved (Hardie and Hanks. 1995). Live specimens of Svcon raphanus [Schmidt] (Porifera, In addition to the characteristic tyrosine protein kinase- Calcarea, Calcaronea, Leucosoleniida, Sycettidae) and specific active-site signature, the previously described cat- Suberites domuncula [Olivi] (Porifera, Demospongiae. Tet- alytic domain of the RTK from the demosponge Geodia ractinomorpha, Hadromerida, Suberitidae) were collected c\donium contains no further site that marks this molecule from the Adriatic Sea near Rovinj (Croatia). The specimens as belonging to a specific class of RTKs (Schacke et ai, ofAphrocallistes vastus [Schulze] (Porifera. Hexactinellida. 1994a). In this study, we have demonstrated for the first Hexasterophora. Hexactinosida, Aphrocallistidae) were col- time that one distinct subfamily of the RTKs is already lected from Saanich Inlet and Barkley Sound, British Co- present in all three classes of Porifera, and that it contains lumbia (Canada) by scuba diving. They were a gift of Dr. the TK class II signature with the consensus pattern Sally P. Leys (Department of Biology, University of Vic- D-[LIV]-Y-xrY-Y-R (PC/GENE, 1995 [Prosite]). By toria, P.O. Box 1700, Victoria, BC, Canada). The material choosing appropriate primers for the polymerase chain re- was immediately frozen in liquid nitrogen until use. action, sequences were obtained from sponges that must be grouped with the insulin receptors [InsRs] of vertebrates Construction ofcDNA libraryfrom A. vastus (Ullrich et al., 1985), the insulin-like growth factor I recep- Total RNA was extracted from sponge tissue, and poly- tors [IGF-I-Rs] of vertebrates (Ullrich et ai, 1986). the adenylated mRNA was isolated from total RNA as already InsR-related receptors of vertebrates (Shier and Watt. described (Pfeifer etal., 1993a and b). cDNA was prepared 1989), and the InsR homolog from Dwsophila melano- with a ZAP Express cDNA synthesis kit. The cDNA library gaster (Fernandez et al., 1995). These molecules are all ofA. vastus was prepared in Hybri ZAPII (Stratagene) and members of the class II RTKs which display, within sub- packaged in vitro with the MaxPlax Packaging Extract domain VII, the following consensus for InsRs. GF-I-Rs, (Epicentre Technologies). The library contained approxi- and InsR-homologs R-D-[IV]-Y-E-[TS]-D-Y (Hardie and mately 2.4 X 106 independent plaque forming units (pfu); HanHkesr,e w19e95p)r.esent theTKdomains ofInsR-(like) molecules the amplified library was stored at 4':'C. that have been isolated from the hexactinellid sponge Screening and isolation ofthe cDNAs encoding InsR-like Aphrocallistes vastus, the demosponge Suberites domun- molecules cula. and the calcareous sponge Sycon raphaniis. From S. raphanus, three full-length clones from the InsR-like mol- The complete cDNAs as well as those encoding the ecules are given. All of the sequences were used for phy- catalytic domains were cloned by the polymerase chain logenetic analyses. These revealed that the sponge InsR-like reaction (PCR) from the A. vastus cDNA library (see molecules are statistically significantly distinct from the above), the S. domuncula (Kruse et al., 1997), or the S. related molecules of higher Metazoa, and allowed an as- raphanus cDNA libraries (Kruse etal., 1997). The degenerate sessment of the evolutionary order in which the three sense primer 5'-TTYGGIATGGTITAYGARGG-3' (Y = py- classes of Porifera appeared. rimidine. R = purine. I = inosine)andthedownstreamprimer (anti sense) 5'-TARTARTCIGTYTCRTADATRTC-3' were Materials and Methods designed against the conserved regions ofTK subdomain I (FGMVYEG) andTKsubdomain VII (DIYETDY) ofInsRs Materials as well as IGF-I-Rs from mammalian species; these regions Restriction endonucleases and other enzymes for recom- are different from the corresponding protein kinases ofother binant DNA techniques and vectors were obtained from classes (Scavo et al.. 1991). The two primers define a Stratagene (La Jolla, CA; USA), QIAGEN (Hilden; Ger- 470 190 bp long sequence encoding part of the TK cata- many). Boehringer Mannheim (Mannheim; Germany), lytic domain (Fig. 1). The PCR was carried out using a GibcoBRL (Grand Island, NY; USA), Amersham (Buck- GeneAmp 9600 thermal cycler (Perkin Elmer), with an inghamshire; UK), USB (Cleveland, OH; USA), DUPONT initial denaturation at 95C for 3 min, then 35 amplification (Bad Homburg; Germany), Epicentre Technologies (Madi- cycles each at 95C for 30 s. 50C for 45 s, 72C for 1.5 son, WI; USA), and Promega (Madison, WI; USA). Tut/ min, and a final extension step at 74C for 10 min. The DNA polymerase, DIG [digoxigeninj DNA labeling kit. reaction mixture of50 /u,l included 20pmol ofthe respective 200 A. SKOROKHOD ET AL degenerate primer and 10 pmol of the primer T7 (Strat- Results acgDenNeA),li2b0r0aripe.s,Mboufffeera,channduc2l.e5otuindiet,s o1fjTalaqofDtNheArpesopleycmteirv-e Clloning and sequencing the cDNAs encoding the InsR-like molecules ase. The expected amplified products were purified and concentrated using Geneclean Spin Kit and directly ligated The S. domuncula nt sequence, SDINR, is 491 nt long and into pGEM-T vector. After isolation and purification, the has a potential open reading frame [ORFj of 489 bases plasmid DNAs were sequenced with an automatic DNA encoding a deduced protein sequence of 163 aa residues. sequenator [Li-Cor 42001. The sequence fromA. vastus. AVINR, is490 nt long with an The TK catalytic domains ofthe three S. raplumus InsR- ORFof 489 nt (163 aa). like molecules were used and completed by both 5'- and Three putative sequences of InsR-like molecules were 3'-RACE. using the kits "5'-" and "3'-RACE System" to isolated from the cDNA library ofS. raplumus. The cDNA full-length cDNAs. for type 1 InsR, SRINR1, is 2026 nt long with an ORF of 1848 ntencoding aputative sequence of616 aa (Figs. 1 and 2); type 2 InsR, SRINR2. is 2150 nt long with an ORF of Sequence analyses 1842 nt (614 aa); and type 3 InsR (Fig. 2K SRINR3. is 1433 Sequences were analyzed using PC/GENE, release 14.0, nt long with an ORF of 1368 nt (456 aa) (Fig. 2). Northern from IntelliGenetics, Mountain View, CA (USA). Similar- blot analyses were performed with these S. raplumus cDNA ity searches and sequence retrieval were performed via the probes. One bandeach ofapproximately 2.2 kb (type 1), 2.3 e-mail servers at the European Bioinformatics Institute. kb (type 2), and 1.6 kb (type 3) were obtained, confirming Hinxton Hall, UK (BLITZ and FASTA), and the National that the full-length cDNAs were isolated (Fig. 3). Institutes of Health. Bethesda. MD. USA (BLAST). The phylogenetic tree was constructed from an aa alignment by Deduced aa sequences ofthe catalytic domains ofthe the neighbor-joining method (Saitou and Nei, 1987) apply- putative sponge InsRs i1n9g93t)h.e PTHheYLdIePgrpeaeckoafgesuvpeprosritonf3o.r5cinptreorngarlambr(aFenlcsheensstewians, The deduced aa sequences ofthe catalytic domains ofthe cfaurltchuelrataesdseassseddebscyribbooetdst(rDaapypihnogf.fTehleadii,sta1n9c7e8).matMruilxtiwpalse aIlnisgRn-leidke(Fsige.que1)n.ceTshebebtowredeenrssuobfdsoumbadionmsaIintosVIIItohaVvIeIb(eaecn- alignments were performed with CLUSTAL W version 1.6 cording to Hardie and Hanks, 1995), could be defined forall (Thompson et al.. 1994) and their graphic presentations by sponge sequences unequivocally (Fig. 1). Specific sites and the program GeneDoc (Nicholas and Nicholas, 1997). sequence characteristics were also present as outlined ear- lier (Muller and Schacke, 1996): in subdomain I. the ATP- binding site [consensus: GxGxxGxV; but in the hexactinel- Northern him lid INR_AV sequence G is replaced by R]; within subdomain II, the residue Lys in the consensus VAxK, RNA was extracted from liquid-nitrogen-pulverized which is required forkinaseactivity; within subdomain VIb: sponge tissue with TRIzol Reagent (GibcoBRL) as recom- the aa D [Asp] and N [Asn] as well as in subdomain VII: the mended by the manufacturer. Total RNA (1 jag) was elec- DFG tripeptide is present. The DFG segment has been trophoresed through tormaldehyde/agarose gel and blotted implicated in ATP binding (Hanks et al.. 1988) and repre- onto Hybond N+ membrane following the manufacturer's sents the most conserved portion within the catalytic do- instructions (Amersham). Hybridization experiments were main. The tyrosine residue (Y) in subdomain VII (aa no. performed with the probes SRINR1. SR1NR2. or SRINR3 180ofthe catalytic domain, with respect to the G. cyiioniuni [==600 bp segments] from S. raplumus. These probes were RTK) undergoes phosphorylation and is the tyrosine kinase labeled with DIG-11-dUTP by the DIG DNA labeling kit. phosphorylation site. Signatures within subdomains VIII, Hybridization was performed with the anti sense DIG- IX, X, and XI are generally less well conserved. Therefore, labeled probes at 42C overnight using 50% formamide the PCR-based sequencing was restricted to the part within containing 5XSSC, 2% blocking reagent [Boehringer], 7% subdomains I to VII. The TK-specific active-site signature, [w/v] SDS. and 0.1% [w/v] N-lauroylsarcosine, following D-L-A-T/A-R-N, characteristic for both vertebrate and in- the instructions of the manufacturer [Boehringer]. After vertebrate TKs (Ottilie et al., 1992; Hanks et al., 1988) is washing. DIG-labeled nucleic acid was detected with anti- found in subdomain VIb. Within the subdomain VII the DIG Fab fragments [conjugated to alkaline phosphatase) signature for the TK class II receptors with the consensus and visuah/ed by a chemiluminescence technique using pattern is found, D-|LIV]-Y-x,-Y-Y-R (PC/GENE, 1995 CDP, the chemiluminescence substrate for alkaline phos- [Prosite]). phatase, according to the instructions of the manufacturer The PCR primers were chosen to identify, in sponges, [Boehringer]. those catalytic domains of class II RTKs that share the INSULIN RECEPTOR-LIKE TYROSINE KINASES IN SPONGES 201 highest similarity to InsRs, IGF-l-Rs. to InsR-related recep- Phylogenetic analvses tors, and to the insulin receptor homolog from D. mclano- When the deduced aa sequences of the TK catalytic gaster (Fernandez el al., 1995). These receptors have the domains from the three sponge species were analyzed using consensus within the class II signature of R-D-[IV]-Y-E- the programs BLITZ, FASTA, and BLAST, they displayed [TS]-D-Y (Hardie and Hanks, 1995). As seen in Figure 1, highest similarity to the polypeptides from both inverte- this consensus is. as expected, present in all sponge se- brates and vertebrates. Among invertebrates, these domains quences; therefore the sequences from the demosponge S. were most similar to the insulin-like receptors from the domunciila. the calcareous sponge S. raphanus, and the insectsAedesaegypti and D. melanogaster, as well as to the hexactinellid sponge A. vastus were termed InsR-like mol- insulin receptor ofthe mollusc Aplysia californica. In addi- ecules. tion an InsR-homolog sequence isolated, so far. from one Branchiostoma lanceolatimi, as well as cephalochordate, InsRs, IGF-I-Rs, or InsR-homologs from selected verte- Complete aa sequences ofthe InsR-like sequences brates (human, mouse and rat) were highly similar to the from S. raphanus sponge sequences. They share about 40%-45% ofidentical aa and about 609r-65% of similar aa (including identical Three cDNAs encoding complete putative InsR-like se- aa) with the selected corresponding molecules. Taking only quences from S. raphanus have been isolated from the the sponge sequences, the sequence from S. raphanus, type library. The sequences are termed type 1, SRINR1. type 2, 1, is identical in 67% ofthe aa(similarity of78%) within the SRINR2. and type 3, SR1NR3, InsR-like molecules. The domain with A. vastus and in 69% (79%) with S. catalytic phSuaRtsIatNainRv1eM)rh6oa1fs66a9c,aa2al1c3u,slaeatqneuddenMIcNerRo_fSI6NR9,R34J7oS7fR;41I5N6R(a_daSedhRau2sceoadfn6M1f4rroaomaf dfinortmoeumrnescStu.ilnarg;.apthTyahpneeusf1isndhdiafifrneegrstchoaontnlsytihd7ee5r%ta'hbrlieydeenfsteriqocuamleneacaaecsh(soiobmtithlaeairrnietidys 51,259. 86%) with type 2 and only 79% identical aa (similarity The sequence INR_SR2 was selected for the analysis 88%) with type 3. siven here. The transmembrane segment, determined ac- The phylogenetic tree was constructed and rooted with cording to the program "RAOARGOS" (PC/GENE, 1995) the sequence of the catalytic domain of the Fes/FER non- ranges from aam to aa,96. The intracellulardomain is. as in receptor TK domain from S. raphanus (Cetkovic et al.. other RTKs (Hardie and Hanks. 1995), divided into a jux- 1998; Fig. 4A). All sequences used were cut for the align- tamembrane domain (aa,97 to aa242) and the catalytic do- ment to obtain the 12 subdomains, comprising approxi- main [TK domain] (aa24, to aa521) (Fig. 2). The catalytic mately 300 aa. All of the sponge sequences fall into one dchoamraacitneriisstsiucbTdKi-vsipdeecdifiintcoac1t2ivseu-sbidtoemsaiignnsatuarnedacnodnttahiensRTthKe bIrGaF-nIc-hRosf,tohreItnrseeR,-rwehlearteedassetqheuesnecleesctfedrosmeqiunevnercteesbroafteIsnsaRnsd. class II signature (see above); in addition, the putative vertebrates are grouped together into a second one. This ATP-binding site (Hanks et al., 1988) is present (Fig. 2). relationship is statistically very robust as analyzed by boot- The extracellular domain contains one calcium-binding, strapping. Hence, support for monophyly ofPorifera can be epidermal growth factor receptor [EGF]-like domain that deduced. In consequence, the presented findings, based on reads D-x-N-E-C'-D-x5-C2-D-E-C3-Q-N-C4-x-N-x6-C3-x- the dataobtained with the catalytic domainsofthe InsR-like N-x3-C6-D; it is located from aa,2s) to aai62 [the Cys resi- molecules from sponges, shed new light on the assumed dues are numbered consecutively]. This EGF-like domain uncertain position ofsponges as reviewed by Rodrigo et al. consists of six Cys residues, flanked by aa with carbonyl (1994). In addition, the data given do not support earlier oxygen atoms, which are arranged slightly differently from notions which suggested that the phylum Porifera might be tlahro,sethfeoCuynds4inanmdolCeycsul5easrefrsoempahriagtheedrbMyetmaozroea.thIannpaornteicau-a paraphyletic (Cavalier-Smith et al., 1996). (Bork er al.. 1996). Furthermore, an incomplete EGF-like Rate ofevolution ofthe catalytic domains ofsponge domain is present from aa4y to aa]2K. The two othertypes of InsR-like molecules InsR-like molecules from S. raphanus also have two EGF- like domains, and they are similarly arranged. This finding Use ofourdata collected on the percentage ofaa identity is the first demonstration that EGF-like domains are present among the polypeptide sequences from the different sponge in the lowest metazoan phylum. Until now, this domain, species on one side and the sponge sequences in comparison which is widely found in vertebrate receptors e.g.. mam- to those from higher metazoan allows a relative approach to malian epidermal growthfactorreceptors (Geeretal., 1994) determining the time of divergence of the sponge classes and matrix proteins like fibulin (Pan eta1.. 1993) has only from acommon ancestor. Thisestimation, which isbasedon been identified among invertebrates in Caenorhabditis el- the number of point mutations per 100 aa within given egans (Campbell and Bork, 1993). polypeptides, might reflect the time of divergence of two 202 A. SKOROKHOD ET AL. [ i I I I I ] IGlR_HUMAN ITMSRELGQGS. -VAKGVVKD 1 55 INSR_HUMAN ITLLRELGQGSi -NARDIIKG- -EAETR1 VHESASLRERIEI BB IGF_RAT ITMNRELGQGS -VAKGVVKD- -EPETR\ VHEAASMRERIEi BB INSR_RAT ITLLRELGQGS NAKDIIKG- -EVETRVF VHESASLRERIE SB INSR_MOUSE ITLLRELGQGS NAKDIIKG- -EAETRVSVilTVNESASLRERIEI BB ILPR_BRALA ITLIRELGQGSj -EAKDVVKD- -EPMVS' VNESASIRERIE 55 INSR_APLA IKLIKELGQGSj -VAKGIRDD PNEEIP VHDRASFSDRREI ITT 56 INSR_AEDAE IIQLEELGQGSI -ILTQLRGE KCNQPC VNESATAREKDSi: LL~ AS? 55 INR_DROME IIQLAPLGQGSi ILKSFPPN GVDREcl VNENATDRERTNl LSI ASV 55 INR_SR1 LTMIREVGEGAl TLSVCDTMGQRNAJ LAj ASI 53 INR_SR2 LTMVKEVGEGA1 -VLATIEDG- LSTCENVAQRNA) LGI ASI 53 INR_SR3 LTMIREVGEGAI -MLATVEDG- LSICEKVAQRNA1 LG9ASI B3 INR_AV MLATVEDG- LSICENLAQRN; 42 INR_SD -VLATIEDG- LSTCENVAQRN? 42 RTK GC IREVKQIGVGQI /LAEMTGLS; SNVASLPKGSMNA-DGVALVgjVigKLKPDVSDEVRQS KglKF 67 H I IGlR_HUMAN FNCHHVVRfflLGVVSQGQPTLV ; INSR_HUMAN :GFTCHHWRI UJVVSKGQPTL' IGF_RAT lEFNCHHVVRj LGTVSQGQPTLVI INSR_RAT IGFTCBHWR) LGWSKGQPTL INSR_MOUSE :GFTCHHWRJ LGWSKGQPMLV ILPR_BRALA fGVSKGQPTLV INSR_APLA EFHCHHVVia LGWSTGQPALVI INSR_AEDAE QFNTHHWR) LGTVSQGDPTLV INR_DROME ~FDTYHWR LGVCSRGQPAL- INR_SR1 KKFDSPYVMR MGLVSTENKPLV INR_SR2 YYMR FGLVSTVNKPLV INR_SR3 i hKFDSPYVMH MGLVSTVSKPLV INR_AV JCKFDSPYVMR MGLVSTVSKPL' ! INR_SD KFDCPYVMR FGLTSTVHKPL' RTK GC jSQLQHDSIVQJLAVCTHSKHPFIVji! IV IGlR HUMAN INSULIN RECEPTOR-LIKE TYROSINE KINASES IN SPONGES 203 taxa. The evolutionary rates expressed as A-.,.,-values implies that animals ofthe lowest metazoan phylum already vary between different proteins (Zuckerkandl and Pauling, contain growth factor receptors that allow them to react to 1965; Kimura, 1983; Li et at.. 1987). In a previous study, nutrient cues and also to neighboring, individual cells, with the galectin protein from the sponge G. cyJoniuin (Pfeiferet a complex intracellular signaling reaction. The InsR-ho- al., 1993b)wascalculatedtohave anestimatedevolutionary mologs, which are putative transmembrane receptors, pre- rate of 0.97 X 10~9 aa substitutions/site/year (Hirabayashi sumably allow the transduction of signals through the cel- and Kasai, 1993); avalue of 1.24 X 10""' was calculated for lular membrane. Usually signaling by RTKs involves the RTK from G. c\donium (Schacke etal.. 1994b) fromthe ligand-mediated receptor dimerization (Geer et al.. 1994), a same animal. process that has not yet been studied in Porifera. InsRs, Dating based on the molecular clock is inaccurate be- IGF-I-Rs, and InsR-related receptors or InsR-homologs of cause its rate often varies. Ifwe accept this insecurity, reject higher metazoan taxa do not contain, in their extracellular the estimated evolutionary rate from sponge genes, and loops, EGF-like domains, but rather cysteine-rich regions accept the one calculated from the time of protostome- (Geer et al.. 1994). This finding underlines again previous deuterostome divergence 700 MYA (Dayhoff 1978) we findings, that most polypeptides deduced from the cDNA can postulate the time ofseparation ofthe sponges from the sequences of sponges are assembled by an unusually large common metazoan ancestor, as follows. If we take the variety of modules. For one example, the putative sponge calculated k:.n-value for the human to D. melanogaste (0.46) aggregation receptor is composed of scavenger receptor as a reference for the protostome-deuterostome split,MtYheAn cysteine-rich domains as well as ofshort consensus repeats the hexactinellid sponge A. vastits branched off 1400 (Pancer et al., I997b; Blumbach et al.. 1998) in a structural (Aaa-value of0.92), followed by the demosponge S. doimin- complexity not known in higher Metazoa. crualpaha1n3u0s0 1(A2a0a0-vMalYueAMoYffoA0r.8t4y)pean1datnhde c2alUcaaar-evoaulsuespoofn0g.e80S). butFiroonmmathkeesevotlhureteionpoairnytsp.oiFnitrsto,f vitieews,tabthleishpersesethnattcmonotlrei-- and for type 3 1 100 (/taa-value of0.77). Recent fossil cules similartothe InsR-homologshave evolvedpriortothe data show (Li et al.. 1M99Y8)Athat sponges existed in much "Cambrian Explosion." Suga et al. (1997) suggested that their present form 580 (Fig. 4B). most ofthe PTK subfamilies, including InsRs, diverged by domain shufflings, together with gene duplications before Discussion the diploblast-triplobast split. As a result ofrecent findings We have shown that all three classes of the phylum that the Porifera already existed before this event (Li et al.. Porifera express molecules related to InsR; and these mol- 1998), we can assume that this class of key molecules, ecules display, in their extracellular domains, EGF-like involved in the complex network of intracellular signaling, sequences (as shown here for 5. raphanus). This finding could have been one major driving force that allowed the signature [specificforInsRsandrelatedsequences] (-classII [InsR])as well as theTKphosphorylationsite (P). The positions oftheprimers are indicated ([++++]) above the sequences. Identical ua residues in all 15 sequences are shown in white-on-black, and residues conserved in at least eight sequences are shaded. Vertebrates IG1R_HUMAN Human insulin-like growth factor 1 receptor precursor (XO4434) INSR.HUMAN Human InsR precursor (PO6213) INSR_MOUSE InsR precursor house mouse (Mus miiscithis; PI5208). IGF_RAT IGF-I-RI receptorprecursorrat (Rcittus non-egicits; A33837) INSR_RAT InsR precursor from rat (R. non'egicus: P15127) Cephalochordate ILPR.BRALA Insulin-like peptide receptor precursoramphioxus (Branchiostoma luiiccolutiint; O02466) Invertebrates INSR_AEDAE Insulin-like receptor precursor mosquito (At'Jvs ticgypti: QM3105) INR_DROME InsR homolog fruit fly (Drosophila melanogaster; U28136) INSR_APLA InsR the mollusc (Aplysia ctilifornica; 1587845) Sponges INR_SD Insulin-like receptor demosponge Suberites domuncula INR_SR1 Insulin-like receptorcalcareous sponge Sycon rupliiiiiux type I INR_SR2 Insulin-like receptorcalcareous sponge S. raplutniis type 2 INR_SR3 Insulin-like receptorcalcareous sponge S. raphanus type 3 INR_AV Insulin-like receptorhexactinellid sponge Aphrocallistes mstn.\ RTK_GC Receptor tyrosine kinase demosponge Geodia cnloniiun (X77528) 204 A. SKOROKHOD ET AL. INR_SR1 MVSIPGYMHYNLTATLPYPSDR DAVQSCTTDETFNFSITAGTYSCTLTNNSIIATSQRGG 60 INR_SR2 MHSGNILGIGYAETVYQTPLRNINVNVTVSIDGFEDYNFTVLYTIASTSCNGERNYTVTVAASHY 65 INK SR3 ECdomain f INR_SR1 : NVTVSWNRPVTCLVGDGGSSEDDDAVISNMIT--AL| 121 INR_SR2 : FSTRTVTYHTSIADGGDLNVLWNQSLESDa*DNQLP| QDESWYEKTSIERSrVGWHV 130 INR_SR3 : M^cgpDlRJLP iXJRSIAS^L 38 ECdomain EGF-like * EGF-like INR_SR1 L3RQT1P VSDMRRKTNIN--SLWHIBWIGVGFGAII 170 INR_SR2 YFSVN TTGCDTNMHESPNPDPDQYEYLALLSIAPLLAL 190 INR SR3 l3SYVN3VRRTTGVSSECRMAENGGRD--GPPRBALFAIJFSLLIVftV 100 A A A EGF-H ECdomain TM I IHR_SR1 EDPAWELVPDSLTijnjIEVGEGAFC 229 INR_SR2 EDPAWELVPDSLT?HgEVGEGAFG 255 INR SR3 EDPAWELVPOSLlfIfVlBgEVGEGAFG 165 TKdomain ATP IV [ V ] INR_SR1 294 INR_SR2 320 INR SR3 230 Vlb INR_SR1 359 INR_SR2 382 INR SR3 292 TKdomain Vlb VII VII VIII INR_SR1 VHRDLAARNCM,ssj .KIGDFGFTRDIYESDYYRKIi 424 INR_SR2 VHRDLAARNCM:KTi .KIGDFGFTRDIYESDYYRXJ 447 INR SR3 J<IGDFGFTRDIYESDYYRK1 357 INR_SR1 'AERPT : 4B9 INR~SR2 IPADRPT 512 : INR SR3 STGGQAH 422 : TKdomain XI INR_SR1 : FEKIVSMLDDSPYQDPLAGrLRFYSTFHYGRVVADVSKPILFRAMRIFIGQPTTLSLTLTOVARR : 554 INR_SR2 : FADrVRVLDDSPYQEPLWEQTSENQSSGEPPGDNNVFPVMVGDSSVSEQLLDIIISNHKSQEFPE : 577 INR SR3 IRRHCQSVGGLAVSRAIMATDIGEPVLWRASRGR-- 456 : : TKdomain \ INR_SR1 RDCIDCTAYSFEIRiFYFEVHDMLEYIDIWILLLVFTSLLARSTRSIKPHRAYASSYHHNDV 616 : INR_SR2 DHTSLKLRGRTENQGHNVSTWLWTNANDSYYPLPSHV : 614 INR SR3 Figure 2. Alignment ofthe deduced aa sequences ofthe InsR-like sequences from Sycon raphamis type 1 (INR_SR1). type2 (INR_SR2),andtype3 (INR_SR3).Thefoursegmentsofthesequencesaretheextracellular domains (EC domain); the transmembrane segments (TM); and the two intracellular domains, thejuxtamem- brane domain (JM domain) and the catalytic domain (TK domain). The TK domain is subdivided into the 12 subdomains (above the sequence) with the characteristic TK-specific active-site signature (Tyr-signature [ -]) and RTK class II signature (< class II) (below the sequence); in addition, the putative ATP- hinding-site (ATP) is marked. In the extracellulardomain, the conserved Cys residues (arrowhead) ofthe two EGF-likedomains(EGF-like)areindicated. Identicalaminoacidresiduesareshowninwhite-on-blacktype,and residues conserved in at least two sequences are shaded. other meuizoan phyla to arise. Second, the phylogenetic letic; the Hexactinellida have been calculated to be the analysescor.1 ,-'n that, basedon the autapomorphic character oldest class, followed by the Demospongia and finally by for Metazoa, llie RTKs, sponges as a taxon are monophy- the Calcarea. Third, EGF-like domains are already present INSULIN RECEPTOR-LIKE TYROSINE KINASES IN SPONGES 205 SRINR in sponges, where they were inserted into potential cell surface receptors and also into matrix molecules. type: 2 1 kb 2.3 Acknowledgments 2.2 1.6 This work was supported by grants from the Deutsche Forschungsgemeinschaft [Mii 348/12-1] and from the Inter- national Human Frontier Science Program [W. E. G. Mul- len RG-333/96-M]. Figure 3. Northern blot analyses to determine the sizes of the tran- scripts of the mRNA encoding the Sycon raphanus InsR-like molecules (SRINR) type I (SRINRI). type 2 (SRINR2). and type 3 (SRINR31 RNA Literature Cited was prepared from sponge tissueand 1 jugeach wassubjected toanalysis. Molecularmasses ofmarker RNAs. which were run in parallel, are given Blumbach, B., /. Pancer, B. Diehl-Seifert, R. Steffen, J. Munkner, I. on the right (in kilobytes). Miiller, and W. E. G. Miiller. 1998. The putative sponge aggrega- tionreceptor: isolationandcharacterizationofamoleculecomposedot scavengerreceptorcysteine-nch domains and shortconsensusrepeats. J. Cell. Sci. Ill: 2635-2644. Bork,P.,A.K.Downing.B. Kiefler,andI.D.Campbell. 1996. Struc- Fes/FER_SR ture and distribution of modules in extracellular proteins. Q. Rev. INR_SR1 Biophys. 29: 119-167. INR_SR3 Campbell, I. D., and P. Bork. 1993. Epidermal growth factor-like INR AV PORIFERA molecules. Can: Opin. Struct. Biol. 3: 385-392. INR_SR2 Cavalier-Smith.T.,M.T.E.P.Allsopp,E.E.Chao,N.Boury-Esnault. INR^SD andJ.Vacelet. 1996. Spongephylogeny,animalmonophyly.andthe INSR_AEDAE I INVERTEBRATA origin ofthe nervous system: 18S rRNA evidence. Can. J. Zoul. 74: INR DROME 2031-2045. ILPR BRALA CEPHALOCHORDATA Cetkovic, H., I. M. Miiller, W. E. G. Miiller, and V. Gamulin. 1998. IG1R HUMAN Characterization and phylogenetic analysis of a cDNA encoding the GF RAT Fes/FER related, non-receptor protein-tyrosine kinase in the marine r INSR HUMAN VERTEBRATA sponge Svcon raphanus. Gene 216: 7784. INSR^MOUSE Coutinho,C.C.,J.Seack,G.VandeVyver,R.Borojevic,andW.E.G. INSR_RAT Miiller. 1998. Origin of metazoan bodyplan: characterization and INSR_APLA INVERTEBRATA functional testingofthepromotorofthe homeobox geneEmH-3from the freshwater sponge Ep/mlana nuielleri in mouse 3T3 cells. Biol. Cliem. Hoppe-Seyler379: 1243-1251. B Dayhoff. M. O. 1978. Survey of new data and computer methods of highermetazoanphyla analysis. Pp. 1-8 inAt/as ofProtein Sequence andStructure. Vol. 5. suppl. 3. M. Dayhoff. ed. National Biomedical Research Foundation. Washington. DC. S.raSp.hadnoumsuncAu.lvaastus Dayhoff, M.O., R. M.Schwartz,and B. C. Orcutt. 1978. A modelof evolutionary change in protein. Pp. 345-352 in Atlas ofProtein Se- quence and Structure. Vol. 5. suppl. 3. M. Dayhoff, ed. National Biomedical Research Foundation, Washington, DC. Felsenstein,J. 1993. PHYLIP (Phylogeny Inference Package), ver. 3.5. University ofWashington, Seattle. Fernandez, R., D. Tabarini, N. Azpiazu, M. Frasch, and J. Schless- Catcarea 1.100MYA inger. 1995. The Drosophihi insulin receptor homologue: a gene Oemospongiae 1.300MYA essential for embryonic development encodes two receptor isoforms Hexactinellida 1.400MYA with different signaling potential. EMBOJ. 14: 101-112. Geer,P.v.d.,T. Hunter,and R.A. Lindberg. 1994. Receptorprotem- tryosine kinases and their signal transduction pathways. Annu. Rev. commonmetazoanancestor Cell Biol. 10: 251-337. Hanks, S. K.. and T. Hunter. 1995. The eukaryotic protein kinase Figure4. (A) Rootedphylogenetictreeofthecatalyticdomainsofthe superfamily: kinase (catalytic) domain structure and classification. sequences listed in Figure I. The numbers at the nodes refer to the levels FASEBJ. 9: 579-596. ofconfidence asdetermined by bootstrapanalysis.The scalebarindicates Hanks, S. K., M. A. Quin, and T. Hunter. 1988. The protein kinase anevolutionary distanceof0.1 aminoacid substitutionperposition in the family: conserved features and deduced phylogeny of the catalytic sequence. The catalytic domain of the Fes/FER nonreceptor TK domain domains. Science 241: 42-52. from Sycon raphanus (Fes/FER_SR. Y17051) was used as the outgroup Hardie, G., and S. Hanks. 1995. The Protein Kiinise FactsBnok: Pru- sequence. (B)Proposedbranchingorderofthethreeclassesofthe phylum tein-tymsinc Kimisfx. Academic Press, London. Porifera (Hexactinellida, Demospongiae. and Calcarea) from a common Hirabayashi. J., and K. Kasai. 1993. The family of metazoan metal- metazoan ancestor. The dates ofthe approximate times ofdivergence are independent /3-galactoside-binding lectins: structure, function and mo- indicated. lecularevolution. Glycobiology 3: 297-304. 206 A. SKOROKHOD ET AL Kiniura, M. 1983. The Neutral Theory of Molecular Evolution. Cam- polyubiquitincDNA from the marine sponge Geodiacydonium and its bridge University Press, Cambridge. preferential expression during reaggregation ofcells. J. CellSci. 106: Koziol, C., R. Borojevic, R. Stcffen, and W. E. G. Miiller. 1998. Sponges(Porifera) model systemstostudy the shift from immortal- to Richdle-Maurer, E.,G. Van deVyver,S. Visser,and C. C. Coutinho. senescent-somaticcells: thetelomeraseactivity insomaticcells.Mtch. 1998. Homeobox-containinggenes in freshwatersponges: character- Ageing Dev. 100: 107-120. ization,expression, and phylogeny. Prog. Mol. Subce/l. Biol. 19: 157- Kruse, M., I. M. Miiller, and W. E. G. Miiller. 1997. Early evolution 175. of metazoan serme/threonine and tyrosine kinases: identification of Rodrigo, A. G., P. R. Bergquist, P. L. Bergquist, and R. A. Reeves. selected kinases in marine sponges. Moi Biol. Evol. 14: 1326-1334. 1994. Are sponges animals? An investigation into the vagaries of Li,W. H.,M. Tanimura,and P. M. Sharp. 1987. Anevaluationofthe phylogenetic interference. Pp. 47-54 in Sponges in Time and Space, molecularclockhypothesisusingmammalian DNA sequences.J. Mol. R. W. M. v Soest, T. M. G. v. Kempen, and J. C. Braekman. eds. Evol. 25: 330-342. Balkema Press, Rotterdam. Li,C. W..J.Y.Chen,andT.E.Hua. 1998. Precambriansponges with Saitou, N., and M. Nei. 1987. The neighbour-joining method: a new cellular structures. Science 279: 879-882. methodforreconstructing phylogenetic trees. Mol. Biol. Evol 4:406- Miiller, W. E. G. 1995. Molecular phylogeny of Metazoa (animals): 425. monophyletic origin. Naturwissenschaften 82: 321-329. Scavo,L. M.,A. R. Shuldiner,J.Serrano, R. Dashner,J. Roth,and F. Miiller, W. E. G. 1997. Origin of metazoan adhesion molecules and de Pablo. 1991. Genes encoding receptors tor insulin and insulin adhesion receptors as deduced from their cDNA analyses from the growth factor 1 are expressed inXenopus oocytes and embryos. Proc. marine sponge Geodia cydonium. Cell Tissue Res. 289: 383-395. Nutl. Acad. Sci. USA 88: 6214-6218. Miiller, W. E. G. 1998. Origin of Metazoa: sponges as living fossils. Schacke, H., H. C. Schroder, V. Gamulin, B. Rinkevich, I. M. Muller, Naturwissenschaften 85: 11-25. and W. E. G. Miiller. 1994a. Molecular cloning of a receptor ty- Miiller,W. E.G.,andI.M. Mulln. 1999. Primordialendocrinology in rosine kinase from the marine sponge Geodia cydonium: a new mem- the lowest invertebrates: The Porifera. in Reproductive Biology of berofthereceptortyrosinekinaseclassIIfamily ininvertebrates.Mol. Invertebrates, A. Dorn, ed. J. Wiley & Sons. Chichester. In press. Memhr. Biol. 11: 101-107. Muller, W. E. G., and H. Schacke. 1996. Characterization of the Schacke, H., I. M. Muller, and VV. E. G. Muller. 1994b. Tyrosine receptor protein-tyrosine kmase gene from the marine sponge Geoditi kinase trom the marine sponge Geodia cydonium: the oldest member cvdoniiim. Prog. Mol. Suhcell. Biol. 17: 183-208. belonging to the receptortyrosine kinaseclass II family. Pp. 201-21 I Muller, W. E. G., I. M. Miiller, and V. Gamulin. 1994. On the in Use ofAquatic Invertebrates as Tools forMonitoring ofEnviron- monophyletic evolution ofthe Metazoa. Bra:. J. MeJ. Biol. Res. 27: mentalHazards, W. E.G. Muller,ed.GustavFischerVerlag,Stuttgart. 2083-2096. Seimiya, M., H. Ishiguro, K. Miura, Y. Watanahe, and Y. Kurosawa. Nicholas, K. B., and H. B. Nicholas, Jr. 1997. GeneDoc: a Toolfor 1994. Homeobox-containing genes in the most primitive Metazoa. EditingandAnnotating Multiple SeauenceAlignments. Distributed by the sponge. Ear. J. Biocliem. 221: 219-225. the author. Version 1.1.004. www.cris.co./~ketchupTgenedoc.shtml. Shier.P.,andV.M.Watt. 1989. Primarystructureofaputativereceptor Ottilif, S.. F. Raull, A. Barnekow, G. Hannig, and M. Schartl. 1992. for a hgand ofthe insulin family. J. Biol. Client. 264: 14605-14608. Multiple.v;v-relatedgenes, srkl-4, in the fresh waterspongeSpongilla Suga, H., K. Kuma, N. Iwabe, N. Nikoh, K. Ono, M. Koyanagi. D. lacustris. Oncogene 7: 1625-1630. Hoshiyama, and T. Miyata. 1997. Intermittent divergence of the Pan, T. C., T. Sasaki. R. Z. Zhang, R. Fassler, R. Timpl, and M. L. protein kinase family during animal evolution. FEESLett. 412: 540- Chu. 1993. Structure andexpression offibulin-2, anovel extracellu- 546. larmatrix proteinwith multipleEGF-likerepeatsandconsensusmotifs Thompson, J. D., D. G. Higgins, and T. J. Gibson. 1994. CLUSTAL forcalcium binding. J. Cell Biol. 123: 1269-1277. W: improving the sensitivity of progressive multiple sequence align- Pancer, Z., M. Kruse, I. Muller,and W. E. G. Muller. 1997a. ()n the ment through sequence weighting, position-specific gap penalties and origin of adhesion receptors of metazoa: cloning of the integrin a weight matrix choice. NucleicAcids Res. 22: 4673-4680. subunitcDNA from the spongeGeotliacvdonium. Mol. Biol. Evol 14: Ullrich, A.,J. R. Bell, E. Y. Chen, R. Herrera, I,. M. Tetruzzelli, T.J. 391-398. Dull. A. Gray, L. Coussens, Y. C. Liao, M.Tsubokawa,A. Mason, Pancer, Z., J. Miinkner, I. Miiller, and W. E. G. Muller. 1997h. A P. H. Seeburg, C. Grunt'eld, O. M. Rosen, and J. Ramachandran. novel member ofan ancient superfamily: sponge (Geodia cydonium, 1985. Human insulin receptor and its relationship to the tyrosine Porifera)putativeproteinthat featuresscavengerreceptorcysteine-rich kinase family ofoncogenes. Nature 313: 756-761. repeats. Gene 193: 211-2IS. Ullrich, A., A. Gray, A. W. Tarn, T. Yang-Feng, M. Tsubokawa, C. PC/GENE,DataBanksCD-ROM. 1995. [EMBL.SwissProt]; Release Collins, VV. Henzel,T. Le Bon,S. Kathuria, E. Chen,S.Jacobs, U. 14.0. IntelhGenetics, Inc. Mountain View, CA. Francke, J. Ramachandran, and Y. Fujita-Yamagushi. 1986. In- Perovic, S., I. Prokic, A. Kraskn, I. M. Muller, and W. E. G. Muller. sulin-like growth factor I receptorprimary structure: comparison with 1999. Originofneuronal receptors in Metazoa: cloningofametabo- insulin receptorsuggests structural determinants that define functional tropic glutamate-like receptor from the marine sponge Geodia cydo- specificity. EMBOJ. 5: 2503-2512. nnnn Cell Tissue Re.-,. 296: 395-404, Valentine,J. W. 1994. The Cambrian explosion. Pp. 401-412 in Ear/v Pfeifer, K., M. Haasemann. V. Gamulin, H. Bretting, F. Fuhrenholz, LifeonEarth, S. Bengtson,ed. ColumbiaUniversity Press, New York. and W. E. G. Muller. 1993a. S-type lectins occur also in inverte- Valentine,J.W.,D.H.Erwin,andD.Jablonski. 1996. Developmental brates:highconservationofthecarbohydraterecognitiondomaininthe evolution of metazoan bodyplan: the fossil evidence. Dev. Biol. 173: lectin genes from the marine sponge Geodia c\donniin. dlnohio/ogy 373-381. 3: 179-184. Zuckerkandl F., and L. Pauling. 1965. Evolutionary divergence and Pfeifer. K . W. Frank, H. C. Schroder, V. Gamulin, B. Rinkevich. R. convergence in proteins. Pp. 97-166 in Evolving Genes andProteins. Batel, 1. M. Muller. and W. E. G. Muller. 19931). Cloning ofthe V. Bryson and H. J. Vogel, eds. Academic Press, New York.

See more

The list of books you might like