loading

Logout succeed

Logout succeed. See you again!

ebook img

peptides as antifungal, antibacterial and immunomodulatory agents PDF

pages17 Pages
release year2016
file size0.61 MB
languageEnglish

Preview peptides as antifungal, antibacterial and immunomodulatory agents

WORLD JOURNAL OF PHARMACY AND PHARMACEUTICAL SCIENCES Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences SJIF Impact Factor 6.041 Volume 5, Issue 9, 591-607 Review Article ISSN 2278 – 4357 PEPTIDES AS ANTIFUNGAL, ANTIBACTERIAL AND IMMUNOMODULATORY AGENTS Ruchi Omar, Sweta Sharma and Arpita Yadav* Department of Chemistry University Institute of Engineering and Technology Chhatrapati Shahuji Maharaj University Kanpur 208024, India. ABSTRACT Article Received on 02 August 2016, The review article discusses the importance of developing non Revised on -----------------, conventional antibacterial or antimicrobial agents. The article describes Accepted on 06 August 2016 DOI: 10.20959/wjpps20169-7561 the sources and important properties of some naturally occurring peptides derived from flora and fauna. It also provides a glimpse of the volume of structural information available on these peptides that can *Corresponding Author Dr. Arpita Yadav be exploited for molecular modeling and docking studies to reveal their Department of Chemistry mechanistic aspects. The increased usage of antibiotics in modern University Institute of society and spread of immunosuppressive diseases like AIDS are day- Engineering and by-day increasing the demand for safe, natural antibacterials/ Technology Chhatrapati antifungals. It is important to understand why these peptides could not Shahuji Maharaj University Kanpur emerge as standalone therapeutic agents. Apart from medicinal use 208024, India. these peptides can effectively contribute to agriculture and food industry. KEYWORDS: Antimicrobial peptides, antifungal, arginine rich, anti HIV, natural, cysteine- rich. INTRODUCTION Serious concerns, side effects associated with the use of conventional azole antifungal agents, increasing cases of acquired drug resistance and growing needs for safe antifungals have induced the search of natural, safe antifungals and antimicrobial agents. A number of antimicrobial peptides (AMPs) derived from natural sources, flora and fauna both, thus came into existence with the expectations of being safe therapeutic agents. In this review article we discuss the sources, properties and challenges related to therapeutic use of these peptides. www.wjpps.com Vol 5, Issue 9, 2016. 591 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Why are non conventional therapeutic agents needed? Human suffer from different mycosis like athletes foot, ringworm, candidiasis, severe systemic infections etc. [1] To treat these different types of mycosis antifungal agents come in different preparations like creams, sprays, oral tablets etc. containing azole compounds like ketoconazole, clotrimazole. Few azoles and other compounds like terbinafine, fluconazole may be taken orally to treat severe internal infections[2,3]. Amphotericin, flucytosine, itraconazole, micafungin (c.f. fig.1) are administered intravenously[4,5] Antifungals are required not just for those suffering from any type of mycosis but also for people with poor immune system, for example, those undergoing chemotherapy for AIDS are at a greater risk of developing internal fungal infection and are prescribed regular antifungal medications[6] Regular antifungal medication if not safe may lead to severe health issues. Many are under the impression that antibiotics may be used to treat fungal infections. However, antibiotics increase the risk of developing fungal infections by depleting harmless bacteria from our skin surface.[7,8] Topical preparations of antifungal agents usually cause little side effects but oral. 1b. Intravenously administered antifungal drugs Fig. 1 Structures of some conventional antifungal drugs www.wjpps.com Vol 5, Issue 9, 2016. 592 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Antifungals frequently cause nausea, headache, diarrhea etc.[9] The intravenously administered antifungals are given only when the need outweighs the risk involved.[10] Sources of non conventional antifungals A number of AMPs have been isolated from natural flora and fauna, out of which some have been isolated, characterized and synthesized for therapeutic use.[11-15] Only some AMPs have been designated as antifungals. Chitinases are compounds derived from microbes, insects, animals or plants with varying antifungal spectrum. A chitinase derived from chinese Baozhu (Pyrus ussuriensis Maxim.) recently[16] exhibited significant antifungal activity. Myticin C and related peptides derived from Mussels (Mytiles spp.)[17] have been suggested for use in cosmetics and food products to kill fungal pathogens. Anabaenolysins are lipopeptides derived from cyanobacteria possessing antifungal activity. When studied by Shishido et al[18] these lipopeptides demonstrated weak activity due to their hydrophobicity but on mixing with hydrophilic cyclodextrins their solubility and efficacy were significantly enhanced. An antifungal peptide has also been derived from gastropod Patella rustica found on seashore in Ghana.[19] Scolopendin is a microbial derived antifungal that has been considered safe for human use.[20] Some strains of lactic acid bacteria exhibit antifungal activity.[21,22] Such natural Lactobacillus strains can be used in food preservation. Small peptides derived from ambhibian skin[23] and spider venom[24] have been shown to possess antibacterial and immunomodulatory properties. These studies indicate the important role of AMPs in human health. Structural and mechanistic aspects of antimicrobial/ antifungal peptides As metioned in previous section, several AMPs have been isolated and characterized. Model structures for some of these peptides have been proposed based on solution NMR data. The databank, ID’s, sources of peptides have been collected in table 1[25-71] for easy reference. Only the latest structure from each family has been mentioned here. Established sequences for some of these AMPs are given in table 2. It is easy to note that the sequences largely resemble cell permeable peptides being highly cationic or cysteine-rich or tryptophan-rich. It is also obvious from table 1 that so far there is no standard nomenclature or naming procedure for these antimicrobial peptides. Most of the names have however been kept taking initials from their scientific names and indicating the numeral of peptide isolated from the www.wjpps.com Vol 5, Issue 9, 2016. 593 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences species. However, the proposed model structures indicate significant variety as can be seen from figs. 2 and 3. The cysteine-rich peptides tend to be cyclic due to the presence of disulphide linkages. The fact that they all act as antifungal/ antibacterial suggests the possibility of more than one active mechanisms of action. Despite the advantages of these peptides their mechanistic aspects have not been explored due to the difficulties in handling them experimentally as well as theoretically, that is with reference to their proteolytic suspectibility and conformational flexibility. The conventional antifungals, on the other hand, have been predicted to act by interfering ergosterol biosynthesis.[72,73] Reduced ergosterol levels weaken fungal cell wall [74] resulting in eventual oozing out of vital contents of fungal cell. This mechanistic aspect is quite understandable for azole compounds as ergosterol biosynthesis is catalyzed by 14α- demethylase enzyme, cocatalyzed by heme protein which is known to possess strong affinity for imidazole type compounds [75]. The mode of action of antifungal peptides still remains in its infancy. However, it is almost certain that after proper mechanistic elucidation at least some may be tuned for the benefit of mankind. A recent study has reported and compared several characteristics of these peptides like cytotoxicity, protease activity etc.[76] www.wjpps.com Vol 5, Issue 9, 2016. 594 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Fig. 2 Structures of some cationic AMPs Fig. 3 Structures of some cysteine-rich AMPs www.wjpps.com Vol 5, Issue 9, 2016. 595 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Table 1. Structural information on some AMPs No. of amino Reference PDB ID Content Source of peptide acids in peptide no. Flora derived AMPs Amaranthus caudatus 1MMC 1H NMR study of the solution structure of Ac-AMP2 30 25 (Love-lies-bleeding) 2ERI Solution structure of Circulin B Chassalia parviflora 31 26 Helical hairpin structure of a novel antimicrobial Echinochloa crus-galli 2L2R peptide EcAMP1 from seeds of barnyard grass 37 27 (Water grass) (Echinochloa crus-galli) Solution structure of the antifungal defensin DEF4 Medicago truncatula 2LR3 (MTR-89070770) from Medicago truncatula (barrel 47 28 (Barrel medick) clover) 2MN1 Solution structure of Kalata B1[W23WW] Oldenlandia affinis 30 29 Solution structure of PAFP-S, an antifungal peptide Phytolacca americana 1DKC 38 30 from the seeds of Phytolacca americana (Pokeweed) NMR Solution structure of Pisum sativum defensin-1 1JKZ Pisum sativum (Pea) 46 31 (Psd1) Hevein-type antifungal peptide with a unique 10- 2LB7 Triticum kiharae (Wheat) 44 32 cysteine motif Fauna derived AMPs Solution structure of the antimicrobial 18-residue 1KFP Acanthoscurria gomesiana(Spider) 18 33 gomensin Solution structure of Alo-3: a new knottin-type Acrocinus longimanus 1Q3J antifungal peptide from the insect Acrocinus 36 34 (Harlequin beetle) longimanus Androctonus australis 1CZ6 Solution structure of Androctonin 25 35 (Desert Scorpian) NMR structure of antifungal defensin ARD1 from Archaeoprepona demophon 1OZZ 44 36 Archaeoprepona demophon (Banded king showmaker) 2KET Solution Structure of BMAP-27 Bos Taurus (Cattle) 18 37 1LFC NMR structure of Bovine Lactoferricin (LfcinB) Bos taurus (Cattle) 25 38 The solution NMR structure of Maximin-4 in SDS Bombina maxima 2MHW 27 39 micelles (Yunnan firebelly toad) Structure of an indolicidin peptide derivative with 1QXQ Bos taurus (Cattle) 13 40 higher charge Solution structure of an potent antifungal peptide Cm- Cenchritis muricatus 2MP9 12 41 p5 derived from C. muricatus. (Sea snail) The solution structure of DEFA-1, a highly potent 2MXQ Equus caballus (Horse) 34 42 antimicrobial peptide from the horse Solution structure of the Tachykinin peptide 1N6T Gallus gallus (Red junglefowl) 10 43 Neurokinin A Gastrophysa atrocyanea 2E2F Solution structure of DSP 40 44 (Leaf beetle) 2OYV Neurotensin in DPC micelles Homo sapiens (Human) 13 45 1MA2 Tachyplesin-1 wildtype peptide NMR Structure (Horseshoe crab) 17 46 Three-Dimensional structure of antimicrobial peptide 1CIX (Horseshoe crab) 44 47 tachystatin A isolated from horseshoe crab NMR Solution structure & model membrane interaction studies of the peptide Hylin A1 from the Hypsiboas albopunctatus (Spotted 2N0O 18 48 Arboreal South American Frog Hypsiboas tree frog) albopunctatus 1M4E Solution Structure of Hepcidin-20 Homo sapiens (Human) 20 49 SP-B C-Terminal(residues 59-80) peptide in DPC 2M1T Homo sapiens (Human) 22 50 micelles Solution structure of the antimicrobial peptide Human 2LXZ Homo sapiens (Human) 32 51 Defensin-5 Litopenaeus vannamei 2N30 Structure of Ace-PvHct-NH2 23 52 (Whiteleg shrimp) www.wjpps.com Vol 5, Issue 9, 2016. 596 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Limulus polyphemus 1RKK Polyphemusin-1 NMR Solution structure 18 53 (Atlantic horseshoe crab) NMR Structure of a novel antimicrobial peptide, 2G9P Lachesana tarabaevi (Ant spider) 26 54 latarcin-2a, from spider (Lachesana tarabaevi) venom 2MBD Lasiocepsin Lasioglossum laticeps (Bees) 27 55 2LLD The insect defensin Lucifensin from Lucilia sericata Lucilia sericata (Green bottle fly) 40 56 Solution structure & activity of the four disulphide Mytilus galloprovincialis 1FJN 39 57 bond Mediterranean mussel defensin MGD-1 (Mediterranean mussel) 1E4R Solution structure of the Mouse Defensin mBD-8 Mus musculus(House mouse) 35 58 Solution structure and cell selectivity of Piscidin-1 2OJM Morone saxatilis (Rock fish) 22 59 and its analogues Oryctes rhinoceros 1IYC Solution Structure of antifungal peptide, scarabaecin 36 60 (Asiatic rhinoceros beetle) Solution Structure of the antimicrobial peptide (Aba 2M2X Papio Anubis (Olive baboon) 18 61 3,5,7,12,14,16) BTD-2 Phyllomedusa tarsius 2JQ1 Phylloseptin-3 19 62 (Tarsier leaf frog) Solution structure of termicin, an antimicrobial 1MM0 Pseudacanthotermes spiniger 36 63 peptide from the termite Pseudacanthotermes spiniger 1ZRV Solution structure of spinigerin in H20/TFE 50% Pseudacanthotermes spiniger 25 64 NMR Solution Structure of the Dermaseptin Phyllomedusa sauvagii 2DCX 13 65 antimicrobial peptide analog NC-12-K4S4(1-13)a (Waxy monkey tree frog) Solution structure of papiliocin isolated from the 2LA2 Papilio xuthus (Asian swallowtail ) 37 66 swallowtail butterfly, Papilo xuthus 1G92 Solution structure of Poneratoxin Paraponera clavata (Bullet ant) 25 67 High resolution NMR Solution structure of the theta- Rhesus macaque 2LYF 18 68 defensin RTD-1 (Old world monkeys) 2I1D DPC micelle-bound NMR Structure of Tritrp-1 Sus scrofa (Wild boar) 13 69 High–resolution NMR Structure of the protegrin-2 2MUH Sus scrofa (Wild boar) 16 70 docked to DPC micelles 2MAG NMR Structure of Magainin-2 in DPC Micelles Xenopus laevis (African clawed frog) 23 71 Table 2. Sequences for some AMPs Peptide Sequence Ac-AMP2 VGECVRGRCPSGMCCSQFGYCGKGPKYCGR Circulin B CGESCVFIPCISTLLGCSCKNKVCYRNGVIP EcAMP1 GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRR Defensin DEF4 RTCESQSHKFKGPCASDHNCASVCQTERFSGGRCRGFRRRCFCTTHC Kalata B1 GLPVCGETCVGGTCNTPGCTCSWWPVCTRN PAFP-S AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR Pisum sativum defensin-1 (Psd1) KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC Hevein-type Antifungal peptide AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC Gomensin ECRRLCYKQRCVTYCRGR Alo-3 CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK Androctonin RSVCRQIKICRRRGGCYYKCTNRPY ARD1 DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET BMAP27 GRFKRFRKKFKKLFKKLS Bovine Lactoferricin (LfcinB) FKCRRWQWRMKKLGAPSITCVRRAF Maximin-4 GIGGVLLSAGKAALKGLAKVLAEKYAN Indolicidin ILKKWPWWPWRRK Cm-p5 SRSELIVHQRLF DEFA1 SCTCRRAWICRWGERHSGKCIDQKGSTYRLCCRR Tachykinin peptide Neurokinin A HKTDSFVGLM DSP AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN Neurotensin ELYENKPRRPYIL Tachyplesin 1 KWCFRVCYRGICYRRCR Tachystatin A YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY Hylin A1 IFGAILPLALGALKNLIK www.wjpps.com Vol 5, Issue 9, 2016. 597 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences Hepcidin ICIFCCGCCHRSKCGMCCKT SP-B DTLLGRILPQLVCRLVLRCSID Human defensin 5 ATCYCRTGRCATRESLSGVCEISGRLYRLCCR Ace-PvHCt-NH2 FEDLPNFGHIQVKVFNHGEHIHH Polyphemusin 1 RRWCFRVCYRGFCYRKCR Latarcin 2a GLFGKLIKKFGRKAISYAVKKARGKH Lasiocepsin GLPRKILCAIAKKKGKCKGPLKLVCKC Lucifensin ATCDLLSGTGVKHSACAAHCLLRGNRGGYCNGRAICVCRN MGD-1 GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG mBD-8 NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK Piscidin 1 FFHHIFRGIVHVGKTIHRLVTG Scarabaecin ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS BTD-2 GVARAVARRGVARAVARR Phylloseptin-3 FLSLIPHAINAVSALANHG Termicin ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG Spinigerin HVDKKVADKVLLLKQLRIMRLLTRL Dermaseptin ALWKTLLKKVLKA Papiliocin RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK Poneratoxin FLPLLILGSLLMTPPVIQAIHDAQR RTD-1 GFCRCLCRRGVCRCICTR Tritrpticin VRRFPWWWPFLRR Protegrin-2 RGGRLCYCRRRFCVCV Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS Antiviral and anti-HIV activity of natural AMPs Some recent studies have shown inhibition of enzymes involved in replication of HIV virus and immunomodulatory properties of small AMPs[77,78]. Topical preparation of AMPs derived from amphibian skin were shown to inhibit transmission of HIV infections of T cells and vaginal epithelial cell lines[23]. Latarcins [24] have been tested for their anti HIV activity. They may also be co-administered with commercial antibiotics like kanamycin. These recent findings indicate that these small AMPs have immunomodulatory properties. Above literature indicates the importance of AMPs in different fields as compared to conventional drugs. At the same time it is also evident that little computational work has been done due to their conformational flexibility which increases the complexity of modeling studies multifold. Antifungals/ antibacterials in agriculture, food industry and animal husbandry While discussing antifungal or antibacterial properties of any compound it is imperative to discuss its utility in agriculture and animal husbandry, as both industries consume large amounts of antifungals. Use of antifungals in these industries is also indirectly linked to human health. Day by day increased usage of fungicides to curb new resistant strains of fungi crosses the limits of safe levels increasing human indirect exposure. Similarly, the routine usage of coccidiostats in animal feed to avoid coccidiosis in animals has raised concerns over www.wjpps.com Vol 5, Issue 9, 2016. 598 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences exacerbation of coronary diseases in human. Commonly used coccidiostats like monensin, salinomycin, lasalocid are known to be toxic to human.[79] Spoilage of food products is of great concern in food industry.[80] Some strains of Lactobacillus used in fermented food products themselves act as antifungal agents.[21,22] Use of such auto protective cultures is becoming latest trend in food preservation .[81,82] In a recent study high throughput screening assay were designed to rapidly test thousands of Lactobacillus isolates for their antifungal activities.[83] Recent research attempts have thus been motivated towards enhanced utilization of naturally occurring AMPs as antifungal agents as opposed to synthetic antifungals. Some natural AMPs were however found to be cytotoxic against mammalian cells [84] causing hemolysis of human erythrocytes. Cosmetic industry is also witnessing a drift towards enhanced usage of natural products as it requires significant amount of antifungals. Future directives This review article emphasizes the need to study mechanistic aspects of AMPs as antifungal agents which would perhaps be more feasible utilizing molecular modeling and docking studies. Mechanistic elucidation will help us understand how to reduce the cytotoxicity problems. The conformational flexibility and the size of peptides involved makes the exploration highly challenging but with advances in modeling techniques and computational facilities it may be achievable. Day by day increasing cases of antibiotic resistance and HIV infections instigate research in this direction and may help curb some pressing medical demands by synergistic approaches. Molecular modeling and docking work in this direction is underway in our laboratory. ACKNOWLEDGMENTS A. Yadav and S. Sharma gratefully acknowledge financial support from Science and Engineering Research Board (SERB) (SR/S1/OC-82/2012), New Delhi. Infrastructural support from Chhatrapati ShahuJi Maharaj University, Kanpur is also gratefully acknowledged. REFERENCES 1. Pappas, P.G.; Kauffman, C.A.; Andes, D.; Benjamin, D.K. Jr.; Calandra, T.F.; Edwards, J.E. Jr.; Filler, J.F.; Kullberg, B.J.; Zeichner-Ostrosky, L.; Reboli, A.C.; Rex, J.H.; Walsh, www.wjpps.com Vol 5, Issue 9, 2016. 599 Yadav et al. World Journal of Pharmacy and Pharmaceutical Sciences T.J.; Sobel, J.D.; Clinical practice guidelines for the management of candidiasis : 2009 Update by the infectious diseases society of America, Clin. Infect. Dis., 2009; 48(5): 503. 2. FDA limits usage of Nizoral (ketoconazole) oral tablets due to potentially fatal liver injury and risk of drug interactions and adrenal gland problems, http://www.fda.gov/Drugs/Drug Safety/ucm362415.htm, 2013. 3. Lowes, R.; FDA, EMA come down hard on oral Ketoconazole, Medscape Medical News, http://www.medscape.com/view article/808484, 2013. 4. Charlies, C.; Hart, E.; Lefort, A.; Ribaud, P.; Dromer, F.; Denning, D.W.; and Lortholary, O.; Fluconazole for the management of invasive candidiasis: Where do we stand after 15 years ?, J. Antimicrob. Chemother., 2006; 57(3): 384. 5. Chandrasekar, P.H.; Sobel, J.D.; Micafungin: a new echinocandin, Clin. Infect. Dis., 2006; 42(8): 1171. 6. Holmberg, K.; Meyer, R.D.; Fungal infections in patients with AIDS and AIDS-related complex, Scandinavian J. Infect. Dis., 1986; 18(3): 179. 7. James, W.D.; Berger, T.G. and Elston, D.M. in Andrew’s Diseases of the skin: Clinical dermatology, Saunders, 2006; ISBN 0-7216-2921-0. 8. Schiefer, H.G.; Mycoses of the urogenital tract, Mycoses, 1997; 40 (Suppl.2): 33. 9. Wilson, D.; Drew, R. and Perfect, J.; Azole antifungals: 35 years of invasive fungal infection management, Expert. Rev. Anti Infect. Therapy, 2015; 13(6): 787. 10. Rajmane, V.S.; Rajmane, T.S.; Mohite, T.S.; Raje, V.V.; Study of candida blood stream: Infections in surgical intensive care unit patients and susceptibility profile of the isolates, J. Krishna Institute of Medical Sciences University, 2015; 4(3): 82. 11. Salzet, M.; Vizioli, J.; Antimicrobial peptides from animals: Focus on invertebrates, Trends Pharmacol. Sci., 2002; 23: 494. 12. Som, A.; Vemparala, S.; Ivanov, I.; Tew, G.N.; Synthetic mimics of antimicrobial peptides, Biopolymers, 2008; 90: 83. 13. Yoo, W.G.; Lee, J.H.; Shin, Y.; Shim, J.Y.; Jung, M.; Kang, B.C.; Oh, J.; Seong, J.; Lee, H.K.; Kong, H.S.; Song. K.D.; Yun, E.Y.; Kim, I.W.; Kwon, Y. N.; Lee, D.G.; Hwang, U.W.; Park, J.; Hwang. J.S.; Antimicrobial peptides in the centipede Scolopendra subspinipes mutilans, Funct. Integr. Genomics, 2014; 14: 275. 14. Choi, H.; Hwang, J.S.; Lee, D.G.; Antifungal effect and pore-forming action of lactoferricin B like peptide derived from centipede Scolopendra subspinipes mutilans, Biochem. Biophys. Acta, 2013; 1828: 2745. www.wjpps.com Vol 5, Issue 9, 2016. 600

See more

The list of books you might like