Logout succeed
Logout succeed. See you again!

Permutation operators, entanglement entropy, and the XXZ spin chain in the limit Δ-> -1 PDF
Preview Permutation operators, entanglement entropy, and the XXZ spin chain in the limit Δ-> -1
Permutation operators, entanglement entropy, and the XXZ spin chain in the limit ∆ 1+ → − Olalla A. Castro-Alvaredo• and Benjamin Doyon◦ • Centre for Mathematical Science, City University London, Northampton Square, London EC1V 0HB, UK ◦ Department of Mathematics, King’s College London, Strand, London WC2R 2LS, UK 1 In this paper we develop a new approach to the investigation of the bi-partite entanglement 1 entropy in integrable quantum spin chains. Our method employs the well-known replica trick, 0 thus taking a replica version of the spin chain model as starting point. At each site i of this new 2 modelweconstructanoperator whichactsasacyclicpermutationamongthenreplicasofthe n Ti a model. Infinite products of i give rise to local operators, precursors of branch-point twist fields T J of quantum field theory. The entanglement entropy is then expressed in terms of correlation 3 functions of such operators. Employing this approach we investigate the von Neumann and 2 R´enyi entropies of a particularly interesting quantum state occurring as a limit (in a compact ] convergence topology) of the antiferromagnetic XXZ quantum spin chain. We find that, for h t large sizes, the entropy scales logarithmically, but not conformally. - p e h [ 3 v 6 0 7 4 . 1 1 0 1 : v i X r a •[email protected] ◦[email protected] 1 Introduction Entanglement is a fundamental property of quantum systems. Historically, there has been great interest in developing efficient theoretical measures of entanglement, one of which is known as the bi-partite entanglement entropy [1]. This entropy measures the amount of quantum entanglement, in some pure quantum state, between the degrees of freedom associated to two sets of independent observables whose union is complete on the Hilbert space. To make this definition more precise, let us consider a one-dimensional quantum spin chain such as the one depicted in Fig. 1 and let gs be the ground state of that chain. We will | i (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) (cid:0)(cid:1) ...s x s x s x ... x s x s ... i−1 i i+1 i+L−1 i+L A Figure 1: A region A of length L of a quantum spin chain subdivide the chain in two regions, A and its complement A¯. In the figure, region A is the block of L spins in red whereas A¯ is the rest of the chain, in blue. Associated to this quantum spin chain there is a Hilbert space which can be expressed as a tensor product of local Hilbert spaces associated to its sites. This can be written as a tensor product of the two Hilbert spaces associated to the regions A and A¯: = ¯. (1.1) H A⊗A The bi-partite entanglement entropy is the von Neumann entropy of the reduced density matrix ρ associated to A, that is: A S = Tr (ρ logρ ) , ρ = Tr ( gs gs ). (1.2) A − A A A A A¯ | ih | ItistheentropyoftheregionAwithrespecttotherestofthechain,regardedasitsenvironment. Another measure of entanglement that is widely studied in the literature is the R´enyi entropy [2], given by log(Tr (ρn)) SR´enyi(n) = A A , (1.3) A 1 n − whose n 1 limit gives the von Neumann entropy. → Thebi-partiteentanglemententropyofone-dimensional(integrable)quantumspinchainshas been extensively studied in the literature from different points of view. One may for instance consider a quantum spinchain divided in two parts, both of which are infinitely long. If thespin chainhasafinitegap,theentropysaturatestoaconstantvaluewhichdependsontheparameters of the model under consideration and can in some cases be computed analytically [3, 4, 5]. The methods used are based on the algebraic Bethe ansatz or on the corner transfer matrix. Anotherinteresting set-uparequantumspinchainswhichareinfinitelylongbutwheretheblock A is kept of finite length. In the critical regime, it has been found through a combination of numerical and analytical approaches (many of which can only be applied for integrable models) [7,8,9,10, 11, 12]that the entropy of a block diverges logarithmically with the size of the block, as expected from conformal field theory (CFT) considerations [13, 14, 15, 16]. The regions A and A¯ can take many different shapes and need not necessarily consist of connected blocks of spins. That is, we may also consider a situation in which both A and A¯ are made out of the union of several disjoint blocks of spins. The entropy of disconnected 1 regions has been the object of numerical and analytical study recently in the context of CFT [17, 18, 19, 20, 21] and quantum spin chains and lattice models [22, 23]. The goal of this paper is two-fold. First, we introduce the quantum chain precursors of branch-point twist fields of quantum field theory (QFT), and explain their use for the computa- tion of the bi-partite entanglement entropy. Branch-point twist fields wereintroduced in a series of recent works in order to compute the bi-partite entanglement entropy of 1+1-dimensional QFT [24, 25, 26, 27, 28]. Using the “replica trick,” one writes the entropy (1.2) as d S = lim Tr (ρn). (1.4) A −n→1dn A A Thequantity Tr (ρn), forinteger n,can beinterpreted as thepartition functionassociated to n A A copies or replicas of the model, branched in a particular way. In the context of 1+1-dimensional QFT, we found [24] that the partition function is proportional to the two-point function of a pair of branch-point twist fields , ˜: T T Tr (ρn) (r)˜(0) . (1.5) A A ∼ hT T i These twist fields are characterized by their exchange relations with any local field ϕ of the i-th i copy of the model∗ ϕ (y) (x) = Θ(x1 > y1) (x)ϕ (y)+Θ(x1 < y1) (x)ϕ (y) (1.6) i i+1 i T T T ϕ (y)˜(x) = Θ(x1 > y1) ˜(x)ϕ (y)+Θ(x1 < y1) ˜(x)ϕ (y) (1.7) i T T i−1 T i for i = 1,...,n and where we identify the indices n+i i. Hence, branch-point twist fields are ≡ local twist fields in the replica model associated with generating elements of its Z symmetry. n Locality plays a crucial role in evaluating their two-point function. Of course, in order to obtain the entanglement entropy, one performs a continuation to real n and the limit n 1 in the → resulting expression. In the context of quantum spin chains, it is possible to define cyclic permutation operators in terms of which the equivalent of the branch-point twist fields of QFT can be constructed. Correlation functions of such permutation operators yield the entanglement entropy of subsets of the chain. In this context, there is also a concept of locality associated to such permutation operators, although we will not make explicit use of it. We will rather show, through examples, thattheuseofcyclic permutationoperators providesaclear combinatoric methodforevaluating the entanglement entropy. Second, we use this tool in order to compute the von Neumann and R´enyi entanglement entropies of the state obtained in the limit ∆ 1+ of the infinite-length anisotropic XXZ → − quantum spin chain (∆ being the anisotropy parameter). The limit ∆ 1+ and some special → − entanglement features of the associated ground state have been previously considered in [6], where the concurrence was computed, albeit for the case of finite chains. In the case of infinite chains, there are subtleties involved in this limit. In order to properly address them, we provide a treatment of quantum states in infinite-length chains based on linear functionals on the space of finitely-supported operators. Using a completely natural compact convergence topology on linear functionals, we describethe limit ∆ 1+ as a proper quantum state in this framework. → − We interpret our results by writing the state as a “hybrid” between a factorisable ground state of the XXZ chain at ∆ = 1, and a state preserving the antiferromagnetic property of − ∗Here we employ the standard notation in Minkowski space-time: xν with ν = 0,1, with x0 being the time coordinate and x1 being theposition coordinate. 2 XXZ ground states in the range 1 < ∆ 1 (the z component of the total spin being zero). − ≤ We propose the existence of a new length scale, below which the spins behave as if they were in a ground state of the XXZ chain at ∆ = 1, and above which this antiferromagnetic property − holds. As ∆ 1+, this scale tends to infinity, and the entanglement entropy of finite blocks → − only measures the entanglement due to the antiferromagnetic condition. Recent results [5] show that the entanglement entropy between the semi-infinite halves of the infinite-length XYZ spin chain behaves, near to certain critical lines, in ways that are not explainedbytheusualCFTarguments. Althoughthecasesthatwestudydonotoverlapwiththe cases studied there, we obtain similar conclusions. The von Neumann and R´enyi entanglement entropies associated to finite blocks of sites in the ∆ 1+ limit-state behave, as the blocks → − become large, in a way that agrees with scale invariance, but not with conformal invariance. We suggest that some results of [5] may bedueto an interplay between the new length scale that we propose and the usual length scale associated to the mass gap. We hope that the relationship between our results and those of [5] will be made more precise in a future publication [29]. The paper is organized as follows: in Section 2 we introduce a new type of local operators which can be defined for a replica version of any quantum spin chain model. These are local cyclic replica permutation operators, and we provide an explicit expression for them in terms of elementary matrices. For completeness, we provide proofs of their main properties, including theiraction onquantumstates andtheirexchange relations withrespecttoother localoperators in the chain. We explain how the bi-partite entanglement entropy can be expressed in terms of correlation functions of such operators. In Section 3 we apply the results of Section 2 to the particular case of the spin-1 XXZ quantum spin chain and compute the von Neumann entropy 2 associated to oneor two spinsin the infinitechain. In Section 4we definethe notion of quantum stateininfinite-lengthspinchains. InSection5wefindexactformulaeforthevonNeumannand R´enyi entropies associated to the quantum state occurring in the limit ∆ 1+. We study the → − asymptoticbehavioroftheentropyforlargesubsystemsizeandfindthatitscaleslogarithmically but not conformally. We finish this section with a discussion and some speculation about the nature of this quantum state. We conclude the paper in Section 6. 2 Replica permutation operators and entanglement entropy in quantum chains Aquantumchain is aquantumsystem physically composed of anumberN of locally-interacting sites along a one-dimensional chain. Mathematically, two conditions are imposed. First, the Hilbert space is := N V where V = Cd represents the states of the individual site i, HN ⊗i=1 i i ∼ with the usual inner product (we may think of this as a spin chain of spin (d 1)/2)†. Second, the Hamiltonian H = N h , representing the interaction between the sit−es, is a sum over i=1 i local energy operators h , usually without explicit N dependence. Each h factorises to the i i P identity on all but a certain number (independent of N) of sites. This gives rise to a notion of “neighbourhood”: a site j is in a neighbourhood of a site i if h does not factorise to the i identity on site j. It is this notion of neighbourhood that tells us that the chain is actually one-dimensional, that provides a concept of distance (e.g. the minimal length of a sequence of sequentially intersecting neighbourhoods required to cover two given sites), that tells us about its most natural topology (e.g. a chain with boundaries, or a periodic chain), and that usually gives rise, in the large-N limit, to factorisation of correlation functions at large distances. This †It is not important for many of theconsiderations that all sites havethe same dimension; yet, for simplicity, in most of this paper we will specialise tod=2. 3 notion of neighbourhood is also at the source of the emergence of a local QFT in the scaling limit, when a quantum critical point exists. The notion of neighourhood extracted from the energy density can often be made to agree with the usual notion of neighbourhoods on a chain (and we will assume this throughout). In this perspective, it is natural to look for a quantum-chain precursors for our branch-point twist field defined in 1+1 dimensional QFT [24]. Recalling the exchange relations (1.6)-(1.7), it is clear that these will be certain permutation operators (elements of a linear representation of the permutation group), and like in the context of QFT, the entanglement entropy in quantum spin chains can be expressed in terms of correlation functions of these operators. We consider n independent copies, or replicas, of a quantum chain. The Hilbert space can be described by ⊗n = (n) := N n V = N V(n) where V = Cd and the vector HN ∼ HN ⊗i=1 ⊗α=1 α,i ⊗i=1 i α,i ∼ space at site i is V(n) := n V . It will be convenient to denote vectors belonging to V(n) i ⊗α=1 α,i i by s s ...s , s 1,2,...,d , where the “spin” s , α = 1,...,n belong to copy α of the 1 2 n i α α | i ∈ { } model at that particular site i. The precise permutation operators that we need, denoted , are local cyclic replica permu- i T tation operators, acting non-trivially only on site i in the n-copy spin chain, with i = 1,...,N. They act as follows: s s ...s = s s ...s s . (2.8) i 1 2 n i 2 3 n 1 i T | i | i For A 1,2,...,N a set of sites on the chain, we will also use the notation ⊂ { } := . (2.9) A i T T i∈A Y Following similar ideas as in QFT, the trace of the n-th power of the reduced density matrix ρ A associated to a state ψ is N | i ∈ H Tr (ρn) = Tr (ρn) A A B B 1 = φAφB ψ ψ φAφB φAφB ψ ψ φAφB φAφB ψ ψ φAφB ( ψ ψ )n h n n| ih | n n−1i···h 2 2| ih | 2 1 ih 1 1| ih | 1 ni h | i {|φXAαi∈A} {|φBαi∈B} n 1 = Ψ φAφB φAφB Ψ Ψ Ψ h | Ti | α αih α α| | i h | i iY∈A {|φXAαi∈A} αY=1 {|φBαi∈B} Ψ Ψ A = h |T | i, (2.10) Ψ Ψ h | i where Ψ = ψ ⊗n, and the sums are over orthonormal bases. Hence, the bi-partite R´enyi and | i | i von Neumann entanglement entropies of the block A can be evaluated as follows: 1 Ψ Ψ R´enyi A S (n)= log h |T | i . (2.11) A 1 n Ψ Ψ − (cid:18) h | i (cid:19) and d Ψ Ψ A S = lim h |T | i . (2.12) A −n→1dn Ψ Ψ (cid:18) h | i (cid:19) (Naturally, any other cyclic element of the permutation group could have been used, by permu- tation invariance). Asusual,ananalytic continuation innisunderstoodinthelatter expression. We will come back below to the full relationship between these permutation operators and QFT branch-point twist fields. 4 2.1 Expressions in terms of elementary matrices We now study the relation between these permutation operators and elementary matrices. This willbeusefulbecausecorrelation functionsofthelatter havetractableexpressionsinthecontext of integrable quantum chains. For simplicity, let us consider the case of a spin-1 chains, where 2 the spin variables s ,...,s above can only take two values (that is, d= 2). The generalisation 1 n to higher spins is straightforward and explained below. The 2 2 elementary matrices Eǫǫ′, for × ǫ,ǫ′ 1,2 , have matrix elements given by ∈ { } (Eǫǫ′) = δ δ . (2.13) kk′ ǫ,k ǫ′,k′ From these matrices, we form the operators Eǫǫ′, α = 1,...,n and i = 1,...,N, (2.14) α,i which act on site i and copy α of the quantum chain as the matrices Eǫǫ′, and everywhere else as the identity operator. In the simplest non-trivial situation, the two-copy model (n = 2), the permutation operator simplyexchangescopies1and2atsitei. Ithasawell-knownexpressionintermsofelementary i T matrices given by = E11E11 +E12E21 +E21E12 +E22E22. (2.15) Ti 1,i 2,i 1,i 2,i 1,i 2,i 1,i 2,i Itisarathereasy (although tedious)exercise togeneralize “by hand”thisresulttohighervalues of n, keeping spin-1. We show here just the results for n = 3 and n = 4, 2 = E11E11E11 +E12E21E22 +E21E12E11 +E22E22E22 + Ti 1,i 2,i 3,i 1,i 2,i 3,i 1,i 2,i 3,i 1,i 2,i 3,i E11E21E12 +E12E11E21 +E22E12E21 +E21E22E12, (2.16) 1,i 2,i 3,i 1 2,i 3,i 1,i 2,i 3,i 1,i 2,i 3,i = E11E11E11E11 +E21E12E11E11 +E11E21E12E11 +E21E22E12E11 + Ti 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i E11E11E21E12 +E21E22E22E12 +E21E12E21E12 +E11E21E22E12 + 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i E12E11E11E21 +E22E12E11E21 +E12E21E12E21 +E22E22E12E21 + 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i E12E21E22E22 +E22E12E21E22 +E12E11E21E22 +E22E22E22E22. (2.17) 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i 1,i 2,i 3,i 4,i Onceafewexplicitcaseshavebeenworkedoutthegeneralstructureofthepermutationoperator for generic n quickly starts to emerge. There are several features that we could have predicted from the start. For example, all the formulae above are sums of exactly 2n terms, which is also the number of distinct basis vectors s s ...s that can be constructed for a spin-1 model. | 1 2 nii 2 The permutation operator is a sum of 2n such terms since its action (2.8) is a one-to-one map between such basis vectors. In addition, all expressions are symmetric under the combined exchanges E11 E22 and E12 E21. ↔ ↔ One can characterize the precise 2n terms that will appear in the expression for the permu- tation operator through a set of four simple rules: Rules 2.1 The operator is the sum of each possible term, with coefficient 1, that is a product i of matrices Eǫα,ǫ′α, α =1,T...,n respecting the following rules: α,i 1. a matrix E11 can only be followed in the product by E11 or E21 , α,i α+1,i α+1,i 2. a matrix E22 can only be followed in the product by E22 or E12 , α,i α+1,i α+1,i 5 3. a matrix E12 can only be followed in the product by E21 or E11 , α,i α+1,i α+1,i 4. a matrix E21 can only be followed in the product by E12 or E22 α,i α+1,i α+1,i (with n+1 1 and where the rules apply cyclically in the product: the first factor follows the ≡ last factor). This restricts greatly the type of terms that will emerge. For example there will never be terms which involve both matrices E11 and E22 and no other type, although the terms E11E11 E11 1,i 2,i··· n,i andE22E22 E22 areallowed andalways appear,as wecanseeforn = 2,3,4 above. Similarly, 1,i 2,i··· n,i the number of matrices E12 and E21 in a given product is always the same. In fact, the rules prescribe the following simple structure for the elementary matrices at any given site along the n copies: strings of any number (including zero) of E11 and E22 are separated by E21 (in the junctions from E11 to E22) and by E12 (in the junctions from E22 to E11), with a condition of periodicity. This point of view will be very useful in explicit calculations below. The rules above immediately give an expression for the permutation operator of the form 2 = Eǫ2ǫ1Eǫ3ǫ2Eǫ4ǫ3 Eǫ1ǫn. (2.18) Ti 1,i 2,i 3,i ··· n,i ǫ1,.X..ǫn=1 This reveals the structure of the trace of some matrix. More precisely, if we introduce an auxiliary space V = C2 as well as the operators aux ∼ 2 E11 E21 T = Eǫǫ′ Eǫ′ǫ = α,i α,i , (2.19) α,i;aux aux α,i E12 E22 ǫ,ǫ′=1 (cid:18) α,i α,i (cid:19)aux X which acts non-trivially both on the auxiliary space, and at site i, copy α, then the permutation operator at site i can be written as the following trace n = Tr (T T T )= Tr T (2.20) i aux 1,i;aux 2,i;aux n,i;aux aux α,i;aux T ··· ! α=1 Y where the product is, by convention, ordered from left to right in order of increasing α. It is easy to obtain (2.15), (2.16) and (2.17) from (2.20) by setting n = 2,3 and 4, respectively. As it should be, reduces to the identity matrix for n= 1. i T We note that theoperator T is simply apermutation operator exchanging the auxiliary α,i;aux spacewiththespace(α,i). Theform(2.20)ofthecyclic permutationoperatorissomethingthat iswell-knowninthecontextofintegrablequantumspinchainssolvedbymeansofalgebraicBethe ansatz. In this context, the L-matrix is, at a certain value of the spectral parameter, simply a permutation operator exchanging an auxiliary space and the space associated to a given site of the quantum chain (see, e.g., [30]). The monodromy matrix is the trace of the product of L-matrices, exactly of the form (2.20), and is identified, at this special value of the spectral parameter, with the translation operator along the periodic chain. In our context, however, the operator that we obtain permutes the copies of a replica model at a given site, rather than the sites of the chain. Infact,thisconnectionbetweenourexpression(2.20)andthealgebraicBetheansatzbecomes veryexplicitifoneemploysthesolutionstotheinversescatteringproblemfoundin[31]toexpress the operators Eǫǫ′ in terms of the entries of the monodromy matrix. We suspect that this α,i relationship could be useful in the future for studying the properties of the replica permutation operator within the Bethe ansatz framework. 6 2.2 Exchange relations In the derivation above, it is clear that the Rules 2.1, the expression (2.18), and the trace expression (2.20) are equivalent. A careful analysis of the permutation action (2.8) would also give rise to the four rules stated. Here, for completeness, we will show explicitly that equation (2.8) is a consequence of (2.20). In order to do so, we will show that the main exchange property of replica permutation operators (the property that constitutes the starting point for the definition of twist fields in QFT) is satisfied by the operator (2.20). Given a 2 by 2 matrix , let be the operator on the quantum chain that acts as on α,i O O O site i, copy α, and as the identity operator everywhere else. Then, we have the following: Lemma 1 The operators defined by (2.20) satisfy the relations i T = (2.21) i α,i α−1,i i T O O T (with ) for all i = 1,...,N, all α= 1,...,n, and all . 0,i n,i O ≡ O O Proof. Thisrelationfollowsfromthetraceexpression(2.20)alongwithtwoidentities. Denoting by theoperatoractingnon-triviallyas ontheauxiliaryspaceandastheidentityoperator aux O O everywhere else, we only have to show that T = T , T = T . (2.22) α,i;aux α,i aux α,i;aux α,i;aux aux α,i α,i;aux O O O O The first identity can be derived as follows. With o o = 11 12 , (2.23) O o21 o22 (cid:18) (cid:19) we have E11 E21 0 E11 E21 Tα,i;auxOα,i = (cid:18) Eαα12,,ii Eαα22,,ii (cid:19)aux(cid:18) O0α,i Oα,i (cid:19)aux = (cid:18) Eαα12,,iiOOαα,,ii Eαα22,,iiOOαα,,ii (cid:19)aux o E11 +o E21 o E21 +o E22 = 11 α,i 12 α,i 11 α,i 12 α,i , (2.24) o E11 +o E12 o E21 +o E22 (cid:18) 21 α,i 22 α,i 21 α,i 22 α,i (cid:19)aux which is equal to o o E11 E21 T = 11 12 α,i α,i Oaux α,i;aux (cid:18) o21 o22 (cid:19)aux(cid:18) Eα12,i Eα22,i (cid:19)aux o E11 +o E21 o E21 +o E22 = 11 α,i 12 α,i 11 α,i 12 α,i . (2.25) o E11 +o E12 o E21 +o E22 (cid:18) 21 α,i 22 α,i 21 α,i 22 α,i (cid:19)aux The second relation of (2.22) follows in a similar way. The defining property (2.8) is essentially a consequence of (2.21). Lemma 2 The operators defined (2.20) satisfy the relations (2.8). i T Proof. We start by writing the quantum state of the spin-1, n-copy quantum spin chain at site 2 i in terms of elementary matrices Eǫ1ǫ2. Let 0 be a reference state at site i for which all spins α,i | ii of all n-copies are up (s = = s = ). Any other of the 2n possible spin configurations can 1 n ··· ↑ be generated by acting on this reference state with a combination of elementary matrices. For example, if we want to lower the spinof copy 1, we justhave to compute E21 0 , whereas acting 1,i| ii 7 with E11 will leave the state unchanged and the action of E22 and E12 gives zero. Therefore, a 1,i 1,i 1,i generic state is written as n s s ...s = Ejsα1 0 , j = 1 for s = and j = 2 for s = , (2.26) | 1 2 nii α,i | ii sα α ↑ sα α ↓ ! α=1 Y and from the expression (2.18), we have 0 = 0 since the only non-zero summand is the one i T | i | i where ǫ = 1 for all α. We now evaluate the action of the permutation operator on this state α by successively employing (2.21), n s ,s ,...,s = Ejsα1 0 Ti| 1 2 nii Ti α,i | ii ! α=1 Y n n = Ejsα1 0 = Ejsα1 0 = s ,...,s ,s . (2.27) α−1,i Ti| ii α−1,i | ii | 2 n 1ii ! ! α=1 α=1 Y Y This establishes (2.8). ˜ 2.3 The conjugate permutation operator T Other permutation operators, ˜ at each site i, take us from copy α to copy α 1. We can i T − simply obtain ˜ by reversing the order of the replicas, that is i T ˜ = Tr (T T T ), (2.28) i aux n,i;aux n−1,i;aux 1,i;aux T ··· or, alternatively, taking the trace, 2 ˜ = Eǫ2ǫ1Eǫ3ǫ2 Eǫ4ǫ3 Eǫ1ǫn, (2.29) Ti n,i n−1,i n−2,i··· 1,i ǫ1,.X..ǫn=1 Onemay check this explicitly by showing that ˜ = 1. This can bedoneby usingthefollowing i i T T property of the elementary matrices: Eǫ1,ǫ2Eǫ3ǫ4 = δ Eǫ1ǫ4. (2.30) α,i α,i ǫ2,ǫ3 α,i Employing the representations (2.18) and (2.29) for the permutation operators (including some extra matrices in the products for clarity) we have 2 ˜ = Eǫ2ǫ1Eǫ3ǫ2 Eǫ4ǫ3 Eǫn−1ǫn−2Eǫnǫn−1Eǫ1ǫn TiTi n,i n−1,i n−2,i··· 3,i 2,i 1,i ǫ1,.X..ǫn=1 2 Eǫ′2ǫ′1Eǫ′3ǫ′2Eǫ′4ǫ′3 Eǫ′n−1ǫ′n−2Eǫ′nǫ′n−1Eǫ′1ǫ′n × 1,i 2,i 3,i ··· n−2,i n−1,i n,i ǫ′,...ǫ′=1 1 Xn 2 2 = δ Eǫ2ǫ′nδ Eǫ3ǫ′n−1...δ Eǫnǫ′2δ Eǫ1ǫ′1 ǫ1,ǫ′1 n,i ǫ2ǫ′n n−1,i ǫn−1ǫ′3 2,i ǫnǫ′2 1,i ǫ1,.X..ǫn=1ǫ′1,.X..ǫ′n=1 2 = Eǫ2ǫ2Eǫ3ǫ3 Eǫ4ǫ4 ...Eǫn−1ǫn−1EǫnǫnEǫ1ǫ1 =1. (2.31) n,i n−1,i n−2,i 3,i 2,i 1,i ǫ1,.X..ǫn=1 The last equality follows from the fact that all matrices Eǫǫ are diagonal, so that each product α,i above is a diagonal matrix with a single non-vanishing entry 1. The sum over all such matrices (there are exactly 2n of them) is the identity. 8 2.4 Replica permutation operators for higher spin chains We can now generalize the results above to more general spin chains, with arbitrary spin repre- sentations living at each site of the chain. Indeed the exchange relations (2.21) which we have just proven can be employed as a starting point for finding a realization of the permutation operator which is valid for higher spin chains. It can be shown that, assuming a dimension-d representation lives at site i of the quantum spin chain, the permutation operator can be i T expressed exactly as in (2.20) with T given by α,i;aux E11 E21 Ed1 α,i α,i ··· α,i E12 E22 Ed2 Tα,i;aux = ...α,i α...,i ·.·.·. α...,i . (2.32) E1d E2d Edd α,i α,i ··· α,i aux It is not too difficult to show that all properties established in the previous section for spin-1 2 also hold for the general case. We will not dwell on such proofs here as in the remainder of this paper we will concentrate on the spin-1 case. 2 2.5 Local-unitary operators and twist fields Since the operator is real, we immediately find, from (2.20) and (2.28), that i T ˜ = †. Ti Ti Hence, isaunitaryoperator. Itisofcoursethelocalelementoftheunitaryoperatorassociated i T with the cyclic replica permutation symmetry of the n-copy Hamiltonian N N n H(n) = h(n) = h (2.33) i α,i i=1 i=1α=1 X XX (where h , for α = 1,...,n and i = 1,...,N, acts as h on N V , and as the identity on α,i i ⊗j=1 α,j N V α′ = α). More precisely, the unitary operator that is the product of over all sites ⊗j=1 α′,j ∀ 6 Ti i, i.e. = N , implements thecyclic replicapermutation of thechain, and commutes T{1,...,N} i=1Ti with the n-copy Hamiltonian. A unitary operator that can be written as a product of single-site Q unitary operators is sometimes called a local-unitary operator. In fact, the local-unitary operator commutes also with the energy density, {1,...,N} T (n) ,h = 0. (2.34) T{1,...,N} i h i In general, it is expected that any unitary operator associated to an internal symmetry, i.e. that is local-unitary, commutes not only with the Hamiltonian, but also with the energy density. To such an internal symmetry, one may then associate twist fields; e.g. in the case of , i T N T = = . i {i,i+1,...,N} i T T j=i Y A standard example is the twist field involved in the construction of fermion operators on the Isingspinchain. Quantum chain twist fieldsgive riseto theusualQFT twist fieldsin thescaling limit. Twist fields have the property of being local “in the bulk”: their commutators with the 9