loading

Logout succeed

Logout succeed. See you again!

ebook img

Protein structure analysis, prediction and flexibility in the light of a structural alphabet PDF

pages92 Pages
release year2017
file size6.32 MB
languageEnglish

Preview Protein structure analysis, prediction and flexibility in the light of a structural alphabet

Protein structure analysis, prediction and flexibility in the light of a structural alphabet Alexandre de Brevern To cite this version: Alexandre de Brevern. Protein structure analysis, prediction and flexibility in the light of a structural alphabet. 1ère réunion du GT MASIM du GDR BIM, GDR BIM (CNRS), Nov 2017, Paris, France. ￿inserm-01636581￿ HAL Id: inserm-01636581 https://www.hal.inserm.fr/inserm-01636581 Submitted on 16 Nov 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Copyright GDR 3003 BIM – GT MASIM Thursday November 16th 2017 Paris, France Protein structure analysis, prediction and flexibility in the light of a structural alphabet. Alexandre G. de Brevern INSERM UMR_S 1134, Univ. Paris Diderot, Sorbonne Paris Cité, Univ de la Réunion, Univ Antilles INTS, GR-Ex DSIMB: a bioinformatics team 1.  The team 2.  Different web-db-tools of the team 3.  Protein structure analysis, prediction and flexibility in the light of a structural alphabet 2 DSIMB: a bioinformatics team 1.  The team Unit INSERM UMR_1134 – Red Blood Cell Integrated Biology (BIGR) http://www.u665.inserm.fr/lang/en Team n°2 - Structural Dynamics and Interactions of Biological Macromolecules (DSIMB) http://www.dsimb.inserm.fr @DSIMB_Lab 3 Other 3 teams are (wet) experimental ones. DSIMB: a bioinformatics team 1.  The team Localisation: National Institute for Blood Transfusion (PARIS) 4 DSIMB: a bioinformatics team 1.  The team Associated to University Paris Diderot, Sorbonne Paris Cité 5 DSIMB: a bioinformatics team 1.  The team Associated to University de la Réunion 6 DSIMB: a bioinformatics team 1.  The team Team 1 is associated to University Antilles 7 DSIMB: a bioinformatics team 1.  The team Pr. C. Etchebest (Pr. Univ Paris Diderot, HDR) Pr. F. Cadet (Pr. Univ Réunion, HDR) Dr. A.G. de Brevern (DR INSERM, HDR) Dr. J.-C. Gelly (Ass. Pr. Univ Paris Diderot, HDR) Dr. F. Gardebien (Ass. Pr. Univ Réunion, HDR) Dr. Ph. Chartron (Ass. Pr. Univ Réunion) 1 Ing Univ Réunion, 1 Ing Univ Paris Diderot, 1 Ing INSERM, 1 ATER - 7 PhD students 8 DSIMB: a bioinformatics team >ITB3_HUMAN Integrin beta-3 MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNN EVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVG FKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCG PGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQC VCHSSDFGKITGKYCECDDFSCVRYKGE.. sequence

See more

The list of books you might like