loading

Logout succeed

Logout succeed. See you again!

ebook img

Protein Structure Analysis & Protein-Protein Interactions Much Ado About Structure PDF

pages48 Pages
release year2005
file size2.3 MB
languageEnglish

Preview Protein Structure Analysis & Protein-Protein Interactions Much Ado About Structure

Protein Structure Analysis & Protein-Protein Interactions David Wishart University of Alberta, Edmonton, Canada [email protected] Much Ado About Structure • Structure Function • Structure Mechanism • Structure Origins/Evolution • Structure-based Drug Design • Solving the Protein Folding Problem 1 Routes to 3D Structure • X-ray Crystallography (the best) • NMR Spectroscopy (close second) • Cryoelectron microsocopy (distant 3rd) • Homology Modelling (sometimes VG) • Threading (sometimes VG) X-ray Crystallography 2 X-ray Crystallography • Crystallization • Diffraction Apparatus • Diffraction Principles • Conversion of Diffraction Data to Electron Density • Resolution • Chain Tracing Diffraction Apparatus 3 Protein Crystal Diffraction Diffraction Pattern Converting Diffraction Data to Electron Density F T 4 Resolution 1.2 Å 2 Å 3 Å The Final Result ORIGX2 0.000000 1.000000 0.000000 0.00000 2TRX 147 ORIGX3 0.000000 0.000000 1.000000 0.00000 2TRX 148 SCALE1 0.011173 0.000000 0.004858 0.00000 2TRX 149 SCALE2 0.000000 0.019585 0.000000 0.00000 2TRX 150 SCALE3 0.000000 0.000000 0.018039 0.00000 2TRX 151 ATOM 1 N SER A 1 21.389 25.406 -4.628 1.00 23.22 2TRX 152 ATOM 2 CA SER A 1 21.628 26.691 -3.983 1.00 24.42 2TRX 153 ATOM 3 C SER A 1 20.937 26.944 -2.679 1.00 24.21 2TRX 154 ATOM 4 O SER A 1 21.072 28.079 -2.093 1.00 24.97 2TRX 155 ATOM 5 CB SER A 1 21.117 27.770 -5.002 1.00 28.27 2TRX 156 ATOM 6 OG SER A 1 22.276 27.925 -5.861 1.00 32.61 2TRX 157 ATOM 7 N ASP A 2 20.173 26.028 -2.163 1.00 21.39 2TRX 158 ATOM 8 CA ASP A 2 19.395 26.125 -0.949 1.00 21.57 2TRX 159 ATOM 9 C ASP A 2 20.264 26.214 0.297 1.00 20.89 2TRX 160 ATOM 10 O ASP A 2 19.760 26.575 1.371 1.00 21.49 2TRX 161 ATOM 11 CB ASP A 2 18.439 24.914 -0.856 1.00 22.14 2TRX 162 http://www- structure.llnl.gov/Xray/101index.html 5 NMR Spectroscopy Radio Wave Transceiver Principles of NMR N N hν S S Low Energy High Energy 6 Multidimensional NMR 1D 2D 3D MW ~ 500 MW ~ 10,000 MW ~ 30,000 The NMR Process • Obtain protein sequence • Collect TOCSY & NOESY data • Use chemical shift tables and known sequence to assign TOCSY spectrum • Use TOCSY to assign NOESY spectrum • Obtain inter and intra-residue distance information from NOESY data • Feed data to computer to solve structure 7 NMR Spectroscopy Chemical Shift Assignments NOE Intensities J-Couplings Distance Geometry Simulated Annealing The Final Result ORIGX2 0.000000 1.000000 0.000000 0.00000 2TRX 147 ORIGX3 0.000000 0.000000 1.000000 0.00000 2TRX 148 SCALE1 0.011173 0.000000 0.004858 0.00000 2TRX 149 SCALE2 0.000000 0.019585 0.000000 0.00000 2TRX 150 SCALE3 0.000000 0.000000 0.018039 0.00000 2TRX 151 ATOM 1 N SER A 1 21.389 25.406 -4.628 1.00 23.22 2TRX 152 ATOM 2 CA SER A 1 21.628 26.691 -3.983 1.00 24.42 2TRX 153 ATOM 3 C SER A 1 20.937 26.944 -2.679 1.00 24.21 2TRX 154 ATOM 4 O SER A 1 21.072 28.079 -2.093 1.00 24.97 2TRX 155 ATOM 5 CB SER A 1 21.117 27.770 -5.002 1.00 28.27 2TRX 156 ATOM 6 OG SER A 1 22.276 27.925 -5.861 1.00 32.61 2TRX 157 ATOM 7 N ASP A 2 20.173 26.028 -2.163 1.00 21.39 2TRX 158 ATOM 8 CA ASP A 2 19.395 26.125 -0.949 1.00 21.57 2TRX 159 ATOM 9 C ASP A 2 20.264 26.214 0.297 1.00 20.89 2TRX 160 ATOM 10 O ASP A 2 19.760 26.575 1.371 1.00 21.49 2TRX 161 ATOM 11 CB ASP A 2 18.439 24.914 -0.856 1.00 22.14 2TRX 162 8 X-ray Versus NMR X-ray NMR • Producing enough • Producing enough protein for trials labeled protein for • Crystallization time and collection effort • Sample “conditioning” • Crystal quality, stability • Size of protein and size control • Assignment process is • Finding isomorphous slow and error prone derivatives • Measuring NOE’s is • Chain tracing & checking slow and error prone Comparative (Homology) Modelling ACDEFGHIKLMNPQRST--FGHQWERT-----TYREWYEGHADS ASDEYAHLRILDPQRSTVAYAYE--KSFAPPGSFKWEYEAHADS MCDEYAHIRLMNPERSTVAGGHQWERT----GSFKEWYAAHADD 9 Homology Modelling • Offers a method to “Predict” the 3D structure of proteins for which it is not possible to obtain X-ray or NMR data • Can be used in understanding function, activity, specificity, etc. • Of interest to drug companies wishing to do structure-aided drug design • A keystone of Structural Proteomics Homology Modelling • Identify homologous sequences in PDB • Align query sequence with homologues • Find Structurally Conserved Regions (SCRs) • Identify Structurally Variable Regions (SVRs) • Generate coordinates for core region • Generate coordinates for loops • Add side chains (Check rotamer library) • Refine structure using energy minimization • Validate structure 10

See more

The list of books you might like