Logout succeed
Logout succeed. See you again!

Quasi-Static Evolution for the Armstrong–Frederick Hardening-Plasticity Model PDF
Preview Quasi-Static Evolution for the Armstrong–Frederick Hardening-Plasticity Model
G.A.FrancfortandU.Stefanelli(2013)“Quasi-StaticArmstrong–FrederickModel,” AppliedMathematicsResearcheXpress,Vol.2013,No.2,pp.297–344 AdvanceAccesspublicationFebruary7,2013 doi:10.1093/amrx/abt001 Quasi-Static Evolution for the Armstrong–Frederick Hardening-Plasticity Model D o Gilles A. Francfort1 and Ulisse Stefanelli2 wn lo a 1Universite´ Paris-Nord and Institut Universitaire de France, LAGA, Ave. de d J.-B. Cle´ment, 93430 - Villetaneuse, France and 2Istituto di Matematica fro m Applicata e Tecnologie Informatiche E. Magenes - CNR, v. Ferrata 1, h I-27100 Pavia, Italy ttps ://a c a Correspondencetobesentto:e-mail:[email protected] de m ic .o The Armstrong–Frederick model for nonlinear kinematic hardening is regarded as a u p .c benchmark model in contemporary elastoplasticity. This work presents an existence om /a result to an appropriately time-rescaled evolution for that model. To do so, we have to m rx resort to a regularization of the dependence of the convex of plasticity upon the back /a rtic stress. Such a regularization process seems to be the unfortunate price one has to pay le -a b forasuccessfulmathematicalanalysis. s tra c t/2 0 1 1 Introduction 3 /2 /2 9 The modeling and prediction of plastic effects has a long history. The first attempts 7/1 8 are usually traced back to the observations by Tresca [61] on the occurrence of yield 80 2 2 stresses in metal solidification and to the introduction by St Venant [6] of constitu- b y g tive equations in plane stress for rigid perfect plasticity. In turn, Le´vy [38], von Mises u e s [62] and, later, Prandtl [53] and Reuss [55] investigated the 3D setting. The variational t o n 0 description of perfect rigid elasto-plasticity, as we understand it today, was settled by 9 A vonMises[63]earlyonin1928.Afundamentaltenetofplasticityconsistsinassuming pril 2 the stress σ experienced by the body cannot exceed some given yield. Namely, one asks 0 1 9 that,throughouttheevolution,σ ∈K forsomegivenelasticdomain K,aconvexsubset ofMn×n(symmetricmatrices). sym ReceivedAugust13,2012;RevisedNovember14,2012;AcceptedDecember28,2012 (cid:3)c TheAuthor(s)2013.PublishedbyOxfordUniversityPress.Allrightsreserved.Forpermissions, pleasee-mail:[email protected]. 298 G.A.FrancfortandU.Stefanelli Afirstrefinementofthemodeltakeshardeningeffectsintoaccount.Hardening modifies the mechanical response of materials by encoding the history of the plastic deformation. It is commonly interpreted as the macroscopic manifestation of disloca- tionmigration.TheearliesteffortinthatdirectionisattributedtoPrandtl[54]although the current formulation of elasto-plasticity with linear kinematic hardening was set- tledatalaterstagewiththeworkofMelan[43]andPrager[52].Inanutshell,theyield criterion is modified and becomes σ −χ∈K. The additional stress χ is the so-called D o w back stress; in the linear case, it is assumed to be related to the plastic strain pof the nlo a materialbyχ˙ =Bp˙ where B isagivenhardeningtensor.Fromthatpointon,manymod- de d els have been put forth with a view to a more intricate phenomenology: viscous and fro m thermal effects, solid–solid phase changes, etc. The reader is referred to the classical h ttp s monographsbyHill[31],LemaitreandChaboche[37],Lubliner[40],Maugin[42]among ://a c others. a d e m Linear kinematic hardening shifts the elastic domain K proportionally to the ic .o backstress.Inparticular,itcannotcapturetheso-calledBauschingereffect,thatisthe u p .c observation that the plastic history of a body determines the resistance of the mate- o m /a rial to further plasticization. It is often the case that the elastic limit in compression m rx is lowered by a previous tensile loading and vice versa. The crucial relevance of this /a rtic effectinapplicationshastriggeredtheinterestfordevelopingsuitablynonlinearkine- le -a matic hardening models. Among these, we focus here on the classical contribution by bs tra ArmstrongandFrederick[2]wheretheideaistoaddanonlinearcorrectiontermtothe c t/2 0 rateequationfortheplasticstrainraterate.Inparticular,theflowruledrivingtheback 1 3 stressχ isaugmentedasχ˙ +|p˙|Fχ=Bp˙ where F isagiventensor.Suchamodification /2/2 9 entailstheboundednessofthebackstressχ,adesirablefeatureinmanyapplications. 7/1 8 8 But there is a drawback: the normality principle [31] driving the evolution turns out to 0 2 2 bestate-dependent. b y g Themathematicalanalysisofplasticevolutionproblemsoriginatesinthe1970s. ue s Well-posedness, regularity, and approximation of the displacement, stress, and plastic t o n 0 strainfieldsbecamethemainfocus.Earlyexistenceresultsintheviscousorhardening 9 A p casescanbefoundintheclassicalmonographbyDuvautandLions[21]andbyMoreau ril 2 0 [50].ThemoredifficultperfectlyplasticcaseisthentackledinSuquet[58,59]andJohn- 1 9 son[32,35](seealso[36]andthemonograph[60]).Onthenumericalside,finiteelement approximationsinplasticitywerepioneeredbyJohnson[33,34]. After a 20-year lull and inspired by the work of Ortiz and Repetto [51], the interestofthemathematicalcommunityinplasticitywasre-kindledinvariousworksof Mielketogetherwithmanycollaborators,see,forexample,[41]andreferencestherein. Quasi-StaticArmstrong–FrederickModel 299 As far as pure small strain elasto-plasticity is concerned, Dal Maso et al. [12] revisited the results of Suquet and Johnson in the setting of energetic formulations of rate-independentevolutions[27,44];seealsoafirstattemptin[22].Thatreformulation underlines the relevance of energy conservation and stability and paves the way for a direct use of variational—lower semicontinuity—techniques in this setting. In partic- ular, plastic evolution is obtained as the limit of sequences of time-discretized plas- tic flows, which in turn result from incremental minimization. In the specific context D o w of plasticity, the viewpoint espoused in [12] proved to be subsequently successful in nlo a the investigation of pressure-sensitive materials [17], brittle materials [19] and, in the de d setting of hardening, of shape memory alloys [3] and of softening [13, 14]. Moreover, fro m energetic formulations have been considered in the context of strain-gradient plastic- h ttp s ity[28,29],heterogeneousmaterials[25,26,56,57],homogenization[24,26,29,30,48], ://a c dimensional reduction [20, 39], and also used to derive small-strain plasticity from a a d e m modelatfinitestrainin[47]. ic .o Absent a standard, state-independent, normality postulate, energetic formu- u p .c lations are also relevant in spite of their variational bias. Dal Maso et al. [15, 16, 18] o m /a investigate the energetic solvability of the so-called Cam-Clay model for plasticization m rx in soils. There, the model features an explicit dependence of the elastic domain upon /a rtic an adequate internal variable. More recently, Babadjian et al. [4] focus directly on le -a nonassociative models of Mohr–Coulomb or Drucker–Prager type. The first step of the bs tra analysisconsistsinareformulationoftheoriginalplasticmodelasaquasi-variational c t/2 0 evolutioninequality[5].Weshallfollowthesamepathbelow,seeSection2. 1 3 /2 TheavailablemathematicalcontributionstotheArmstrong–Fredericknonlinear /2 9 7 kinematic hardening model are few. Brokate and Krejcˇı´ [8–10] consider the well- /1 8 8 posedness of the constitutive model. The ODE tensorial material relation is proved to 0 2 2 admit unique solutions both in the stress-controlled and the strain-controlled case. b y g These papers observe that the Armstrong–Frederick model—and, more generally, the ue s Mro´z and the Chaboche models—can be reformulated as a system of an ODE, together t o n 0 with a hysteretic relation. However, such a reformulation entails a coordinate change 9 A p whichdoesnotpairwellwiththeequilibriumrelation.Theonlyavailable3Dresultfor ril 2 0 the Armstrong–Frederick model available so far is by Chełmin´ski [11]: well-posedness 1 9 of a suitable viscous regularization of the original problem is discussed. However, the obtainedaprioriestimatesarenotsufficienttopasstothelimitastheviscositygoesto zerointhenonlinearsettingoftheoriginalproblem. This paper considers the Armstrong–Frederick model in its full 3D setting. The constitutive relation is coupled with the system resulting from quasi-static 300 G.A.FrancfortandU.Stefanelli equilibrium. At first, we recast the model in an equivalent quasi-variational form (Section 2). This results in a dissipation pseudo-potential that explicitly depends on the back stress. Then, we operate a viscous regularization of the model (Section 3) in the spirit of [11, 59]. The existence of the visco-plastic regularization, an interesting result per se, is obtained through a stable and convergent time-discretization proce- dure(cf.[11]).WethendefinitelydepartfromtheapproachofChełminski[11]inpassing tothethenonviscouslimit(Section4).Inparticular,weestablishthequasi-staticlimit D o w with respect to some properly rescaled time by following an approach first advocated nlo a by Efendiev and Mielke [23], see also the recent literature [45, 46]. That rescaling has de d alreadybeenappliedintheplasticitycontextin[4,15,16]. fro m Our result is the first existence result for a the quasi-static rate-independent h ttp s plastic evolution driven by an Armstrong–Frederick-type model with nonlinear kine- ://a c matic hardening. Note however that passing to the 0-viscosity limit forces us to focus a d e m on a mollification of the constitutive equation by means of a convolution kernel, see ic .o Section 2. This modification is needed to secure the crucial lower-semicontinuity of u p .c thedissipationpseudo-potential.Theanalysisofthede-mollifiedArmstrong–Frederick o m /a modelseemstobeoutofreachfornow. m rx Westressthatourregularizationbyconvolutioncanbeexpectedtohaveamod- /a rtic erate impact on the effective material behavior as it acts in space only and may be le -a assumedtobeverylocalized.Assuch,weclaimthatitisaworthycompromisetoward bs tra a better understanding of the Armstrong–Frederick model. We comment on this and c t/2 0 otherregularizationsintheshortconclusion(Section5). 1 3 /2 /2 9 7 /1 8 2 Descriptionofthemodel 8 0 2 2 Thissectionisdevotedtorecallthebasicfeaturesofthemodel,aswellastotheneces- by g u sarybackgroundmathematicalmaterial. e s t o n 0 9 A 2.1 Notation p ril 2 We denote by Mn×n the space of 2-tensors in Rn (n=1,2,3) and by Mn×n and Mn×n 01 sym dev 9 the subspaces of symmetric and symmetric-deviatoric tensors. The space Mn×n is sym naturally endowed with the scalar product a:b=a b (summation convention) and ij ij the corresponding norm |a|2:=a:a for all a, b∈Mn×n. Moreover, Mn×n is orthogonally sym sym decomposed as Mn×n=Mn×n⊕R1 where R1 is the subspace spanned by the identity sym dev 2 2 2-tensor. In particular, for all a∈Mn×n, we let a=a +tr(a)1 /n. The symbols ⊗ and (cid:6) sym D 2 Quasi-StaticArmstrong–FrederickModel 301 standforthetensorproductandthesymmetrizedtensorproduct,respectively.Namely, (u⊗v) =uv and(u(cid:6)v) =(uv +u v )/2forallu, v∈Rn. ij i j ij i j j i Given a Banach space E and a convex functional ϕ:E→(∞,∞], we let D(ϕ)={x∈E : ϕ(x)<∞} denote its effective domain and ∂ϕ:E→E∗ (dual) be its sub- differential(possiblymultivalued)definedas y∈∂ϕ(x) ⇐⇒ x∈D(ϕ) and (cid:12)y,w−x(cid:13)≤ϕ(w)−ϕ(x) ∀w∈E. D o w Here,thesymbol(cid:12)·,·(cid:13)correspondstothedualitypairingbetweenE∗andE.Forinstance, nlo a giventhenonempty,convex,andclosedset K⊂E,itsindicatorfunction I :E→[0,∞] de K d definedas ⎧ from IK(x)=⎨⎩∞0,, exl∈seK, https://a c a d isconvex,proper,lowersemicontinuousanditssubdifferentialis em ic .o y∈∂IK(x) ⇐⇒ x∈K and (cid:12)y,w−x(cid:13)≤0 ∀w∈K. up.c o m In other words, ∂I ={0} in the interior of K, ∂I ={rλ} at ∂K where r≥0 and λ is an /a K K m outward normal to ∂K (possibly one of the many, due to nonsmoothness), and ∂IK =∅ rx/a outside K. rtic le -a b s tra 2.2 Theoriginalmodelrevisited c t/2 0 The context is that of small strains. Let Ω⊂Rn be a bounded open set occupied by a 13 /2 homogeneous elasto-plastic material. We denote by u:Ω→Rn the displacement field /29 7 and by Eu:=(Du+DuT)/2 thestrain tensor. As is usual insmalldeformations plastic- /18 8 0 ity,thestraintensorisadditively decomposedas 22 b y Eu=e+ p, gu e s t o wheree∈Msny×mnand p∈Mnd×evn,respectively,standfortheelasticandplasticstrains.This n 09 ispartofwhatwillbereferredtoaskinematiccompatibility.Theconstitutiveequation A p whichrelatesthe(Cauchy)stresstensorσ totheelasticparteofthelinearizedstrainis ril 2 0 1 alsoassumedtobelinear,thatis, 9 σ =Ae where A is the Hooke elasticity tensor. In the isotropic case, A=K(1 ⊗1 )+2G 2 2 (1 −1 ⊗1 /n)where K, G>0arethebulkandtheshearmodulusand1 istheiden- 4 2 2 m tity m-tensor in Rn. At equilibrium, and if no volume forces are applied to the sample, 302 G.A.FrancfortandU.Stefanelli thestresssatisfies divσ =0 inΩ. IntheArmstrong–Frederickmodel,anadditionalkinematichardeningvariableα∈Mn×n dev is also introduced. The back stress χ∈Mn×nis then related to that variable and to the dev plasticstrainthrough χ=B(p−α), D o w where B isasuitablepositive-definitesymmetricfourth-ordertensor.Wewillcall p−α n lo a thebackstrain. de d Wethenintroducetheinternalenergy fro m h W(e,p−α):= 1Ae:e+ 1B(p−α):(p−α). ttp 2 2 s://a Viewing Wasafunctionof Eu,p,andα italsoreadsas ca d e m Wˆ(Eu,p,α)=W(Eu− p,p−α). ic.o u p The thermodynamic force −∂∂Wpˆ =σD −χ associated with p is constrained to .com remaininacompactconvexsubset K ofthesetMn×n: /am dev rx /a σD −χ∈K:={τ ∈Mnd×evn: f(τ)≤0}, rticle -a where f:Mn×n→Ristheyieldfunction.Weassumethat bs dev tra c t/2 f isconvexandLipschitz, 0 1 3 − f0:= f(0)<0 and f(0)=min{f(τ);τ ∈Mnd×evn}, (2.1) /2/2 9 fˆ:= f + f ispositively1-homogeneous. 7/1 0 8 8 0 2 Inparticular,0∈intK. 2 b y At each point τ on ∂K we define N (τ) to be the unit exterior normal cone to K g K u e atthatpoint,thatis, st o n 0 NK(τ):={ν∈Mnd×evn:|ν|=1andν:(η−τ)≤0, ∀η∈K}. (2.2) 9 A p Now,thethermodynamicforceassociatedwithα is ril 20 1 9 ∂Wˆ − =χ. ∂α The Armstrong–Frederick hardening model is characterized by the following flowrule: [p˙|α˙]∈A(σ ,χ), D Quasi-StaticArmstrong–FrederickModel 303 where (cid:5) (cid:6) (cid:7) (cid:8) (cid:9) A(σD,χ):= λ ν(cid:7)(cid:7)(cid:7)ν:(σD −χ)B−1Fχ :ν∈NK(σD −χ)andλ≥0; λ=0if f(σD −χ)<0 . f 0 Fromhereonward,thenotation[α|β]standsforthegeneric2-vectoroftensors in Mn×n. The tensor F is an additional positive-definite fourth-order tensor which we dev will consider to be equal to B in the remainder of the paper, and this without loss of D o generality. w n Inallfairness,theclassicalArmstrong–Frederick modelisusuallyrestrictedto loa d e the Von Mises setting in which case f(τ)=|τ|− f . The previous flow rule can then be d 0 fro rephrasedinthefollowingform: m h ∂f ttps p˙=|p˙|∂τ(σD −χ), ://a (2.3) c a d χ˙ +|p˙|Bχ=Bp˙, e m ic .o whichisthatmostoftenencounteredintheliterature. u p .c Ourgoalistoobtainaquadruplet(u(x,t),e(x,t),p(x,t),α(x,t))suchthat om /a m Eu(x,t)=e(x,t)+ p(x,t)kinematiccompatibility; rx/a σ(x,t)=Ae(x,t), χ(x,t)=B(p(x,t)−α(x,t))constitutiverelations; rticle -a divσ(x,t)=0equilibrium; bs tra c σD(x,t)−χ(x,t)∈K stressconstraint; t/2 0 1 [p˙|α˙](x,t)∈A(σD(x,t),χ(x,t))flowrule; 3/2 /2 9 7 togetherwiththeDirichletboundaryconditionu=w on∂Ω.Weknowfrompriorworks /1 8 8 0 on plasticity that the boundary condition will not always be satisfied because plastic 2 2 b strainsmaydevelopattheboundary,sothat,asseenlater,wewillhavetoreplacethat y g u conditionby e s t o p(x,t)=(w−u)(x,t)(cid:6)ν on∂Ω, n 0 9 A p whereν standsfortheunitnormalto∂Ω. ril 2 0 The resulting model has resisted any incorporation attempt within a standard 1 9 generalizedthermodynamicalframework.Toourknowledge,therearenoexistencethe- oremsforsuchanevolution.Weproposetoremedythis,albeitonaslightlyregularized formoftheevolution. Inspired by prior work on nonassociative elasto-plasticity [4], we propose to rewrite the stress constraint and the flow rule in an “equivalent” way. This is done 304 G.A.FrancfortandU.Stefanelli D o w n lo a d e d fro m Fig.1. Theset K(χ)for f(τ)=|τ|− f0.ThehorizontalaxisrepresentsMnd×evn. http s ://a throughtheintroduction,foranyχ∈Mnd×evn,oftheset cade m K(χ):={[τ |η]∈Mn×n×Mn×n: f(τ)+ 1η:η≤ 1χ:χ}; (2.4) ic.o dev dev 2 2 u p .c see Figure 1. In particular, recalling that we have set B=F for the sake of notational om /a symplicity,wehavethefollowing: m rx /a rtic Lemma2.1. Thefollowingholdstrue: le -a b s (a) σD −χ∈K ⇐⇒ [σD −χ|χ]∈K(χ); trac (b) σ −χ∈∂K ⇐⇒ [σ −χ|χ]∈∂K(χ); t/2 D D 0 1 (c) [p˙|α˙]∈A(σD,χ) ⇐⇒ [p˙|α˙]∈∂IK(χ)[σD −χ|χ]. (cid:2) 3/2 /2 9 7 /1 Proof. We have that σD −χ∈K iff f(σD −χ)≤0iff f(σD −χ)+χ2/2≤0+χ2/2≤ 880 χ2/2iff[σ −χ|χ]∈K(χ). 22 D b y Similarly, we can prove that σD −χ∈∂K iff f(σD −χ)=0iff f(σD −χ)+χ2/2= gu e χ2/2iff[σD −χ|χ]∈∂K(χ). st o The third equivalence is a bit less immediate. Note that K(χ) is equivalently n 0 9 definedas Ap K(χ)={[τ |η]∈Mn×n×Mn×n: fˆ(τ)+ 1η:η≤ 1χ:χ + f }. ril 2 dev dev 2 2 0 01 9 Then,[p˙|α˙]∈∂IK(χ)[σD −χ|χ]iff p˙:(τ −(σ −χ))+α˙ :(η−χ)≤0, ∀[τ |η]∈K(χ). (2.5) D In particular, taking successively τ =σ −χ and η=χ in (2.5), we get that p˙=λν, D ν∈N (σ −χ)andα˙ =λ(cid:19)χ withλ,λ(cid:19)≥0. K D Quasi-StaticArmstrong–FrederickModel 305 Now, consider τ =(1−s)(σ −χ)|s|(cid:20)1 and seek η such that [τ |η]∈∂K(χ). D A simple computation that uses the one-homogeneous character of fˆ leads to η= (cid:10) 1+2 s f χ.Insertingthat[τ |η]into(2.5)yields χ:χ 0 s(−λν:(σ −χ)+λ(cid:19)f )+o(s)≤0, D 0 henceλ(cid:19)=λν:(σD−χ). (cid:3) f0 D o w n The transformation devised through Lemma 2.1 highlights the dependence of lo a d the flow rule from the state variable χ, thus leading to a so-called quasi-variational ed fro inequality. m h Unfortunately, as will become clear later, this reformulation does not provide ttp s a suitable functional framework for the analysis, most notably because the duality ://a c a product between the stresses and the plastic strains cannot be successfully defined d e m in the absence of an L∞-bound on σ . But such a bound seems unattainable, unless an ic D .o L∞-bound is derived for χ, in which case it becomes trivial since σ −χ∈K. We do not up .c o knowhowtoobtainsuchaboundwhenstartingwiththedefinition(2.4)of K(χ). m /a m To achieve such a bound, we modify Definition 2.4 and incorporate an a priori rx boundonχ inthatdefinition.Weset /artic le K (χ):={[τ |η]∈Mn×n×Mn×n: f(τ)+ 1|η|2≤ 1T (|χ|2)}, (2.6) -ab M dev dev 2 2 M stra c where T (r):=min{|r|,M}. Of course, the previously noted equivalence between the t/2 M 0 1 original for√mulation and the formulation with KM(χ)does not hold any longer, at least 3/2/2 when |χ|> M. We will demonstrate at the end of the paper that a proper choice of M 9 7 /1 actually ensures that the constraint |χ|≤M is not saturated, at least for small times, 88 0 providedthattheinitialconditiononχ isso(seeProposition4.14). 22 b y Notethat,inviewofthelastitemin(2.1), g u e (cid:11) s [τ |η]∈KM(χ)⇒|η|≤ M−2f(0)=:M(cid:19). (2.7) t on 0 9 We next define the dissipation potential H :(Mn×n)3→R as the support func- Ap tionof KM(χ),thatis, M dev ril 201 9 H (χ,[p|α])= max τ : p+η:α, M [τ|η]∈KM(χ) which, for a fixed χ, is convex, sub-additive, and positively 1-homogeneous in (p,α). Further, [p˙|α˙]∈∂IKM(χ)([σD −χ|χ])isequivalentto[σD −χ|χ]∈∂HM(χ,[p˙|α˙]), 306 G.A.FrancfortandU.Stefanelli where ∂H (χ,[p˙|α˙]) denotes the subdifferential of H (χ,[·|·]) at [p˙|α˙]. We note that, M M given the displacement t(cid:22)→u(t), the flow rule for the internal variables [p|α] can be rewrittenintheso-called Biotformas ∂[p˙,α˙]D([p|α],[p˙|α˙])+∂[p,α]Wˆ(Eu(t),[p|α])(cid:23)0 where the state-dependent dissipation function D is defined as D([p|α],[p˙|α˙])= H (χ,[p|α])=H (B(p−α),[p˙|α˙]). Eventually, we are led to investigating the following D M M o w problem: nlo a d Eu(x,t)=e(x,t)+ p(x,t), ed fro p(x,t)=(w−u)(x,t)(cid:6)ν(x) on∂Ω, m h σ(x,t)=Ae(x,t), χ(x,t)=B(p(x,t)−α(x,t)), (2.8) ttps ://a divσ(x,t)=0, ca d e m [σD −χ|χ](x,t)∈∂HM(χ(x,t),[p˙(x,t)|α˙(x,t)]). ic .o u Notethat,since∂HM(χ,[p˙|α˙])⊂KM(χ),thelastinclusionin(2.8)aboveentailsthestress p.c o constraint[σ −χ|χ]∈K (χ)aswell. m D M /a m rx /a 2.3 Propertiesofthedissipationpotential rtic le Wenowstateandproveafewusefulpropertiesofthesets K (χ)andofthedissipation -ab M s tra potential HM. ct/2 0 1 3 Lemma2.2(Growthpropertiesof H ). There exist 0<κ<κ(cid:19) <∞ with κ(cid:19) that may /2 M M M /2 9 dependon M suchthat 7 /1 8 8 B(Mn×n)2(0,κ)⊂KM(χ)⊂B(Mn×n)2(0,κM(cid:19) ) (2.9) 022 dev dev b y or,equivalently, gu e κ|[p|α]|≤HM(χ,[p|α])≤κM(cid:19) |[p|α]| (2.10) st on 0 forevery(χ,p,α)∈(Mnd×evn)3. (cid:2) 9 A p ril 2 Proof. Since f(0)<0, the continuity of f implies that f(τ)+ 1|η|2<0< 1T (|χ|2), for 01 2 2 M 9 [τ |η]∈B(Mn×n)2(0,κ)forsomesmallenoughκ.Further,inviewofthecontinuityof f and dev of(2.7),theotherinclusionisobvious.Relation(2.10)followsbyconvexduality. (cid:3) Lemma2.3(Continuity properties of H ). The map H is continuous over M M (Mn×n)3. (cid:2) dev