loading

Logout succeed

Logout succeed. See you again!

ebook img

Reactivity of N-(3-hydroxyacyl) amino acids and influence of their corresponding homoserine ... PDF

pages245 Pages
release year2017
file size19.5 MB
languageEnglish

Preview Reactivity of N-(3-hydroxyacyl) amino acids and influence of their corresponding homoserine ...

MembersoftheJury Prof.Dr.ir.WimSoetaert(Chairman) DepartmentofBiotechnology FacultyofBioscienceEngineering,GhentUniversity Prof.Dr.StefanBräse InstitutfürOrganischeChemie KarlsruherInstitutfürTechnologie(KIT) Dr.MarcOngena GemblouxAgro-BioTech-BioindustriesUnit UniversitédeLiège Prof.Dr.ir.IngeVanBogaert DepartmentofBiotechnology FacultyofBioscienceEngineering,GhentUniversity Prof.Dr.ir.MatthiasD’hooghe DepartmentofGreenChemistryandTechnology FacultyofBioscienceEngineering,GhentUniversity Promoters Prof.Dr.ir.SvenMangelinckx DepartmentofGreenChemistryandTechnology FacultyofBioscienceEngineering,GhentUniversity Em.Prof.Dr.ir.NorbertDeKimpe DepartmentofGreenChemistryandTechnology FacultyofBioscienceEngineering,GhentUniversity Prof.Dr.ir.ChrisStevens DepartmentofGreenChemistryandTechnology FacultyofBioscienceEngineering,GhentUniversity DeanoftheFaculty Prof.Dr.ir.MarcVanMeirvenne RectoroftheUniversity Prof.Dr.ir.RikVandeWalle ir. Ewout Ruysbergh Reactivity of N-(3-hydroxyacyl)amino acids and influence of their corresponding homoserine lactones on cyclic lipopeptide production Thesis submitted in fulfillment of the requirements for the degree of Doctor (PhD) in Applied Biological Sciences: Chemistry and Bioprocess Technology Dutchtranslationofthetitle:‘ReactiviteitvanN-(3-hydroxyacyl)aminozurenendeinvloedvan deovereenkomstigehomoserinelactonenopdeproductievancyclischelipopeptiden’ To be cited as: Ruysbergh, E. ‘Reactivity of N-(3-hydroxyacyl)amino acids and influence of their corresponding homoserine lactones on cyclic lipopeptide production’, PhD dissertation, GhentUniversity,2018. ThisresearchwasfundedbytheBijzonderonderzoeksfonds(BOF,UGent). Coverillustration:swarmingbehaviordisplayedbyaPseudomonassp.CMR12amutantstrain. ISBNnumber:978-94-6357-069-5 The author and the promoters give the authorisation to consult and to copy parts of this work forpersonaluseonly.Everyotheruseissubjecttothecopyrightlaws.Permissiontoreproduce anymaterialcontainedinthisworkshouldbeobtainedfromtheauthor. Theauthor: Thepromoters: ir.EwoutRuysbergh Prof.Dr.ir.S.Mangelinckx Em.Prof.Dr.ir.N.DeKimpe Prof.Dr.ir.C.Stevens Woord vooraf Eindelijk, ein-delijk, ein-de-lijk, ben ik aanbeland bij het laatste deeltje van dit doctoraat dat nog op papier gezet moet worden. Het laatste maar vermoedelijk ook het meest gelezen deel. Beginnen doe ik met een huizenhoog (en dus op waarheid berust) cliché: een doctoraat schrijf jenietalleen.Datwasookbijmijniethetgeval,daaromzouikgraageenaantalmensenwillen bedanken. In de eerste plaats wil ik mijn promotoren bedanken, om me te gidsen doorheen de wereld der organischechemie.Prof.ChrisStevens,bedanktomindebrestespringentoenikoppapiereen promotorloos doctoraatsweesje was. Prof. Norbert De Kimpe, bedankt om mijn schrijfsels ook tijdens uw emeritaat snel en grondig te blijven nalezen. Ik hoop dat onze correspondentie uw filatelistische collectie mooi heeft uitgebreid. Prof. Sven Mangelinckx, als ik vastzat met een synthetisch probleem of geen goede invalshoek vond om bepaalde resultaten neer te schrijven kon ik steeds bij u terecht. Meermaals viel mijn mond open van verbazing wanneer u mijn antwoord op een opmerking van een reviewer toch nog net dat tikkeltje beter kon formuleren. Sven,bedanktomooknamijnshortcutrichtingindustriemetochsteedsteblijvensteunen. Ialsowouldliketothankthemembersoftheexaminationcommittee:Prof.Dr.ir.WimSoetaert, Prof.Dr.StefanBräse,Dr.MarcOngena,Prof.Dr.ir.IngeVanBogaertandProf.Dr.ir.Matthias D’hooghe for the critical reading of this thesis and the interesting discussions we had, both about chemical and biological topics. Your remarks helped me to improve the quality of this work. Daarnaast wil ik alle doctoraatsstudenten, postdocs, ATP-leden en thesisstudenten bedanken voor de bijzonder leuke sfeer die er heerst in het labo. Ook de congressen in Spa en Blanken- berge waren steeds dik in orde, met de avatarverkleedpartij als absoluut hoogtepunt. Iedereen bij naam noemen zonder iemand te vergeten is bijna onmogelijk maar ik zou toch een aantal mensenspecifiekwillenbedanken. Vooreerst mijn collega’s van ‘het vierde’ waar ik het merendeel van mijn syntheseloopbaan doorbracht. Gert, Nils, Pieter, Frederik, Sofie, Marine, Tamara, Koen, Elena & Iris, bedankt voor leuke atmosfeer en het delen van jullie chemische kennis. Gert en Koen, naast de vele miseries bij het kaarten tijdens de pauze om drie uur, mocht ik met jullie (en Bart) de vreugde delen de faculteitsquiz (meermaals) te winnen en alzo de SynBioC-eer hoog te houden. Iris, we vonden al snel een goed evenwicht over het verdelen van de roerplaten in de trekkast en hetglaswerk.OokonzerotavaporHelmutwerdgoedverzorgdengekuist.Zelfstoenikbesloot de binnenkant van onze trekkast te coaten met jouw product bleef je (relatief) kalm. Gelukkig benjetoenniettegenmijnschuifgelopen.Ikhadmealvastgeenbeterelabobuurvrouwkunnen wensen! Michail, (cid:15)υχαριστω, thank you for being my guide during my first steps in the wonderful world of quorum sensing. I still have fond memories of our Sterre biotesting parties during my master thesis and often think with a smile about your different theories such as the bicycle theory(aren’ttheyinfacthypothesesratherthantheories,asIhaveonlyseenindicationsbutno realproofsofar?).ΠOAKAPA! Elena, my sovjet comrade, thank you for the nice lessons in Russian during the flashing of our precious compounds. When I’m stuck in Russia, I’m now able to tell people that I’m hungry, that I’m thirsty and that they are beautiful. I’m convinced that this will help me a lot! I hope that my lessons in Dutch helped you during your stay in Belgium. During our lunches in the kitchen, I really enjoyed our conversations about amino acid chemistry, mother Russia, global politics, hot yoga and traveling. I really hope I’ll be able to visit Moscow someday with you as myguide. Hang ‘I DIE’ Dao Thi, I still remember when you told me that you liked to work in the garden and I said ‘what a nice coincidence, I have a garden’. I admire the precision and pace at which you were able to remove weeds from between the carrots and your special care for the onions. I hope the gardening was a nice alternation from the lab work. Lena & Marine, bedankt voor het advies op chemische maar vooral andere gebieden. De vele voetbal- en badmintonpartijtjes waren zeer ontspannend! Lena, bedankt voor het veelvuldig gebruik van je N-methylmorfoline enookeenspecialedankuwelommijnlaatsteHRMS-stalenonderjouwhoedetenemen. De Boedapestbende, Iris, Sigrid, Sofie, Nicola en Stijn, wil ik bedanken voor het zeer ontspan- nendreisje.Ikdenknietdatikooitnogeenzoete,‘fruity’wittewijnzalkunnendrinkenzonder aandezetripterugtedenken. Ans, jou wil ik uit de grond van mijn hart bedanken voor de bijstand in praktische zaken, en zeker naar het einde toe, me zeer snel van antwoord te dienen als ik niet echt goed wist hoe iets geregeld moest worden. Els, bedankt voor de practicum- en printassistentie, en het doet me iedere keer plezier om te zien hoeveel het bananenscheutje dat ik je ooit gaf al gegroeid is dankzij jouw goede zorgen. Pieter, bedankt om met jouw technische kennis vele praktische laboproblemenvandebaantehelpen,hoedrukjehetookhad,eenrotavaporwassnelgefikst. Naast synthese, voerde ik ook heel wat bioassays uit. Nam, thank you for teaching me how to perform swarming and plant assays. I really liked the moments we were making dilutions and plating several mutant strains side by side and our curiosity when we took the plates out of the incubator. Feyi, thank you for your kind advice and as well assistance during some of the final experiments. Prof. Höfte, bedankt voor de interessante discussies in verband met mijn resultaten. Je leerde me dat micro-organismen soms wel degelijk een eigen willetje hebben en een onverwacht resultaat niet noodzakelijk een slecht resultaat is. Je enthousiasme werkt aanstekelijk! Mijn buromies, Stijn (Brabie), Matthias (Moenski) en Koen (... Koen) zou ik willen bedanken voor de met voorsprong tofste bureau van de B-blok (en omstreken). Omringd door boeiende literatuur en met een prachtuitzicht op de coupure hebben we vele chemische onderwerpen vol passiebediscussieerd.Enmisschienookenkelenietzochemische,heelafentoedan.Koenook bedankt om met je arendsoog nog enkele fouten uit mijn schrijfsels te halen. Dat we echt wel hetzelfdetypehumorhebbenbleekmeermaalsuitjetoevoegselstijdenshetcorrigeren. Ook mijn labo- en procescollega’s en in het bijzonder mijn eilandgenoten van op Oleon wil ik bedanken voor de leuke sfeer, waardoor ik ’s avonds altijd goedgezind thuiskwam om vervol- gensaandetweede(doctoraats)shifttebeginnen. Daarnaast wil ik ook de vaste cinecrew, Lino, Thibaut, Thomas en Nicolas, bedanken voor de ontspannende vrijdagavonden toen ik die nodig had. Recent heb ik wel enkele keren verstek moeten geven maar vanaf 2018 ben ik terug trouw van de partij! Amber, mijn petekindje, in 2017 kon ik je doctoraatsgewijs niet zoveel zien als ik wou, maar ik kijk er naar om de schade intehalenenhetolifantendansjeteleren.Ikwilookmijnstudiegenoten,debioboyz,bedanken voor de vele ontspannende momenten tijdens onze studies buiten (maar ook tijdens) de lessen. Leen, Melissa, Jorik, Mike, Inge en de rest van the gang, iedere keer als we afspreken is het er weer boenk op, dat doet me altijd plezier. Jorik, amigo, haal je beste tennis maar boven want die (re)match moet er nu toch eens van komen. Of een komiek, dat kan ook natuurlijk, zolang ermaareenburgerrestaurantindebuurtis. Mijn ouders wil ik bedanken voor hun onvoorwaardelijke steun, al mijn hele leven lang. Be- dankt om van kinds af aan mijn nieuwsgierigheid en honger naar (wetenschappelijke) kennis steeds te voeden en me te helpen de persoon te worden die ik nu ben. Ook een speciale dank aan mijn grootouders, om me te steunen in wat ik ook doe. De kaars die jullie hebben laten brandentijdensmijninterneverdediginggafmeeenextraduwtjeinderug!Mijnbroers,Ruben en Arne, wil ik bedanken voor alle ontspannende momenten en ook al had ik vorig jaar niet bijsterveeltijd,ikweetdatjullieeraltijdvoormijzijn.Ookeenwelgemeendebedanktaanalle (schoon)familieenvrienden,diemijdoordikendunsteunden. En tot slot, Inge, tijd voor jouw paragraaf. We hebben al veel meegemaakt op onze reizen samen: met de tent door weer (regen regen regen) en wind (ook die was er zeker) over de Hardangervidda, bear proof koken in Canada en de VS (Wat! Kaas? Kaas, in onze tent?!), met de auto door (en tegen) kleine straatjes in Kroatië, vast met de jeep in de sneeuw in IJsland, in Namibiëoverdagomsingeldwordendoorolifantenen’snachtsdandemelkwegzien,zwemmen vlakbij watervallen en ara’s in Costa rica maar niet veel later dan stuiterend en slippend met de auto over een quadweg (‘shortcut’), ... Maar ook dichter bij huis: de eerste oogst van ons tuintje, het wel en wee van onze kipjes, het trekken van de gasleiding, standvastige wespen, ... Kortom, we hadden al veel gekke beesten gezien, maar een doctoraat dat had ons pad nog niet gekruist. Je hebt me van start tot finish hierin gesteund. Ieder dipje werd moeiteloos uitgewist doorjestralendeglimlach.Bedanktomdedraadoptenemenwaarikstekenlietvallenenbegrip te hebben voor mijn periode van social lockdown, zeker naar het einde toe (wat zeggen ze nu ook weer over die laatste loodjes?). Inge, je zorgt er iedere dag opnieuw voor dat ik de beste versie van mezelf ben. Ik wist al dat we een geweldig team waren maar dat is nog maar eens gebleken. 2017 Was het jaar van het doctoraat, maar de volgende jaren zijn voor ons. Honsie, ikziejegraag! EwoutRuysbergh 18januari2018 Tableofcontents Table of contents Listofabbreviations v PhDabstract 1 1 Introductionandgoals 3 2 Literatureoverview 9 2.1 Quorumsensing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 2.1.1 N-Acyl-L-homoserinelactone(AHL)regulatedquorumsensing . . . . 9 2.1.2 Quorumquenching . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 2.1.2.1 Abioticdegradation . . . . . . . . . . . . . . . . . . . . . . 12 2.1.2.2 Enzymaticdegradation . . . . . . . . . . . . . . . . . . . . 13 2.1.3 Interkingdomsignaling . . . . . . . . . . . . . . . . . . . . . . . . . . 15 2.1.3.1 EffectofAHLsonplants . . . . . . . . . . . . . . . . . . . 16 2.1.3.2 EffectofplantsonQSsignaling . . . . . . . . . . . . . . . . 21 2.2 Cycliclipopeptides . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 2.2.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 2.2.2 Classification . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 2.2.2.1 PseudomonasCLPs . . . . . . . . . . . . . . . . . . . . . . 24 2.2.2.2 BacillusCLPs . . . . . . . . . . . . . . . . . . . . . . . . . 30 2.2.2.3 RelevantCLPsproducedbyothermicroorganisms . . . . . . 33 2.2.3 Biosynthesis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 2.2.3.1 Adenylation(A)domain . . . . . . . . . . . . . . . . . . . . 34 2.2.3.2 Thiolation(T)orpeptidylcarrierprotein(PCP)domain . . . 35 2.2.3.3 Condensation(C)domain . . . . . . . . . . . . . . . . . . . 36 2.2.3.4 Thioesterase(TE)domain . . . . . . . . . . . . . . . . . . . 37 2.2.3.5 Editingdomains . . . . . . . . . . . . . . . . . . . . . . . . 38 2.2.3.6 Fattyacidintroduction . . . . . . . . . . . . . . . . . . . . . 39 2.2.3.7 Comparisonribosomal-non-ribosomalpeptidesynthesis . . 40 2.2.4 RegulationofCLPproduction . . . . . . . . . . . . . . . . . . . . . . 40 2.2.4.1 RegulationofCLPproductioninPseudomonas . . . . . . . 41 i Tableofcontents 2.2.4.2 RegulationofCLPproductioninotherbacteria . . . . . . . . 43 2.2.5 Naturalfunctions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 2.2.6 CommercialapplicationsofbacterialCLPs . . . . . . . . . . . . . . . 46 2.3 Concludingremarks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 3 Resultsanddiscussion 51 3.1 Synthesisandanalysisofstableisotope-labelledN-acyl-L-homoserinelactones 51 3.1.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 3.1.2 SynthesisofunlabelledAHLs . . . . . . . . . . . . . . . . . . . . . . 53 3.1.3 SynthesisofamonodeuteratedHO-AHL . . . . . . . . . . . . . . . . 55 3.1.4 SynthesisofdideuteratedAHLs . . . . . . . . . . . . . . . . . . . . . 56 3.1.5 GC-MSanalysisofdeuteratedAHLs . . . . . . . . . . . . . . . . . . 62 3.1.6 SynthesisofdeuteratedAHL-degradationproducts . . . . . . . . . . . 66 3.1.7 Conclusion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 3.2 Evaluation of the chemical reactivity of N-(3-hydroxyacyl)-L-homoserine lac- tonesandderivatives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 3.2.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 3.2.2 RearrangementofN-(3-hydroxyacyl)-L-homoserinelactones . . . . . . 71 3.2.3 RearrangementofN-(3-hydroxynonanoyl)-L-serine . . . . . . . . . . . 72 3.2.4 CyclizationofN-(3-hydroxyacyl)aminoacids . . . . . . . . . . . . . . 75 3.2.5 CyclizationofN-(3-hydroxyacyl)aminoacidswithadeprotectablegroup atnitrogen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 3.2.6 Applicationofphotoremovableprotectinggroups(PPGs) . . . . . . . . 85 3.2.7 PPG-protectedN-(3-hydroxyacyl)-L-homoserinelactones . . . . . . . 92 3.2.8 Post-cyclizationmodification . . . . . . . . . . . . . . . . . . . . . . . 94 3.2.9 Pseudo-prolines(ΨPro) . . . . . . . . . . . . . . . . . . . . . . . . . 95 3.2.10 Conclusion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 3.3 Theinfluenceofquorumsensingsignalmoleculesonplantsandfungi . . . . . 109 3.3.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 3.3.2 EvaluatingtheeffectofAHLsonthegrowthoflettuce . . . . . . . . . 112 3.3.3 Evaluating the effect of AHLs and TA on the growth of Arabidopsis thaliana . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 114 3.3.4 EvaluatingtheeffectofAHLsandTAonthegrowthoffungi . . . . . . 116 3.3.5 Conclusions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117 ii

See more

The list of books you might like