loading

Logout succeed

Logout succeed. See you again!

ebook img

Rigorous Dynamics of Expectation-Propagation-Based Signal Recovery from Unitarily Invariant Measurements PDF

file size0.42 MB

Preview Rigorous Dynamics of Expectation-Propagation-Based Signal Recovery from Unitarily Invariant Measurements

IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 1 Rigorous Dynamics of Expectation-Propagation-Based Signal Recovery from Unitarily Invariant Measurements Keigo Takeuchi, Member, IEEE Abstract—Signal recovery from unitarily invariant measure- The origin of this approach dates back to the Thouless- 7 1 mentsis investigated inthispaper. A message-passing algorithm Anderson-Palmer (TAP) equation [5] in statistical physics. is formulated on the basis of expectation propagation (EP). A 0 Motivated by the TAP approach, Kabashima [6] proposed an rigorous analysis is presented for the dynamics of the algorithm 2 MPalgorithmbasedonapproximatebeliefpropagation(BP)in inthelargesystemlimit,wherebothinputandoutputdimensions r tend to infinitywhile thecompression rate is kept constant. The thecontextofcode-divisionmultiple-access(CDMA)systems p main result is the justification of state evolution (SE) equations with i.i.d. measurement matrices. When the compression rate A conjectured by Ma and Ping. This result implies that the EP- is largerthan the so-called BP threshold [7], the BP-based al- 5 basedalgorithmachievestheBayes-optimalperformancederived gorithm was numerically shown to achieve the Bayes-optimal by Takeda et al. in 2006 via a non-rigorous tool in statistical performance in the large system limit, which was originally physics, when the compression rate is larger than a threshold. T] Theproofisbasedonanextensionofaconventionalconditioning conjectured by Tanaka [8] via the replica method—a non- technique for the standard Gaussian matrix to the case of the rigorous tool in statistical physics, and proved in [9], [10] I . Haar matrix. for i.i.d. Gaussian measurements. However, Kabashima [6] s c Index Terms—Compressed sensing, expectation propagation, presented no rigorous analysis on the convergence property [ unitarilyinvariantmeasurements,stateevolution,Haarmatrices. of the BP-based algorithm. 2 In order to resolve lack of a rigorous proof, approximate v message-passing (AMP) was proposed in [11] and proved in 4 8 I. INTRODUCTION [12] to achieve the optimal performance for i.i.d. Gaussian measurements, when the compression rate is larger than the 2 A. Motivation 5 BP threshold. Spatially coupled measurement matrices are 0 CONSIDER the recovery problem of an N-dimensional required for achieving the optimal performance in the whole 1. signal vector x from a compressed noisy measurement regime [7], [13]–[15]. However, it is recognized that AMP 0 vector y ∈CM (M ≤N) [2], [3], fails to converge when the i.i.d. assumption of measurement 7 matrices is broken [16], unless damping [17] is employed. 1 y =Ax+w. (1) As solutions to this convergence issue, since Opper and : v In(1),A∈CM×N denotesaknownmeasurementmatrix.The Winther’s pioneering work [18, Appendix D], as well as Xi signalvectorxisanunknownsparse1 vectorthatiscomposed [19], several algorithms have been proposed on the basis of ofindependentandidenticallydistributed(i.i.d.)elements.The expectationpropagation(EP)[20],expectationconsistent(EC) r a noise vector w ∈ CM is independent of the other random approximations [18], [21], [22], S-transform [23], approxi- variables. The goal of compressed sensing is to recovery the mate BP [24], or turbo principle [25]–[28]. The EP-based sparse vector x from the knowledge about y and A, as well algorithm [20] is systematically derived from Minka’s EP as the statistics of all random variables. framework [29] by approximating the posterior distribution Abreakthroughforsignalrecoveryistoconstructmessage- of x with factorized Gaussian distributions. The EC-based passing (MP) that is Bayes-optimal in the large system limit, algorithms[18], [21], [22] are iterative algorithmsfor solving where the input and output dimensions N and M tend to a fixedpoint(FP) oftheECfreeenergy.Analgorithmin [23] infinitywhilethecompressionrateδ =M/N iskeptconstant. is derived via the S-transform of AHA. Rangan et al. [24] considered an EP-like approximation of the BP algorithm on Manuscript received April *, 2017. The author was in part supported by afactorgraphwithvector-valuednodes.Thealgorithms[25]– the Grant-in-Aid forExploratory Research (JSPSKAKENHIGrant Number [28] based on turboprincipleare derivedfroma few heuristic 15K13987),Japan.Thematerialinthispaperwillbepresentedinpartat2017 IEEE International Symposium on Information Theory, Aachen, Germany, assumptions. Interestingly, the algorithms in [18], [20], [22], Jun.2017[1]. [24],[27]areessentiallyequivalent,withtheexceptionof[21], K.TakeuchiiswiththeDepartmentofElectricalandElectronicInformation [23]. In this paper, these algorithms for signal recovery are Engineering,ToyohashiUniversityofTechnology,Aichi441-8580,Japan(e- mail:[email protected]). simply referred to as EP-based algorithms, since we follow 1 In this paper, a signal x ∈ R is called sparse if the Re´nyi information the EP-based derivation in [20]. dimension[4]ofxissmallerthan1.Ifxiszerowithprobability 1−p,the information dimensionisatmostp.Ifxisdiscrete, itiszero. Ma et al. [26], [27] derived state evolution (SE) equations 0000–0000/00$00.00 (cid:13)c 2017IEEE IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 2 of an EP-based algorithm under two heuristic assumptions. a Haar matrix are not independent. Using this asymptotic By investigating the properties of the SE equations, they similaritybetweenHaarandi.i.d.Gaussianmatrices,weprove conjecturedthat,forunitarilyinvariantmeasurementmatrices, the intuition. the FPs of the SE equations are the same as those of an asymptotic energy function that describes the Bayes-optimal C. Related Work performance in the large system limit, which were derived A similar paper[24]was postedonthearXiva fewmonths in [30] via the replica method. In other words, the EP-based before posting the first version [35] of this paper, of which algorithmwasconjecturedtoachievetheoptimalperformance a short paper will be presented in [1]. Interestingly, the in the large system limit, when the compression rate is larger two papers share the common proof strategy based on [12]. thanthe BPthreshold.Since thealgorithmattemptstosolvea However, there are a few differences between them. FPoftheECfreeenergy[18],itisconjecturedthattheFPsof First ofall, we considercomplex-valuedsystems, while the the EC free energy correspond to those of the Bayes-optimal posted paper [24] addressed real-valued systems. The main oneforunitarilyinvariantmeasurementmatrices.Thepurpose differenceisthataprobabilisticapproachisusedinthispaper, of this paper is to present a rigorousproof for the conjecture. while a deterministic approach based on pseudo-Lipschitz continuitywasconsideredin [24]. Thedeterministicapproach B. Proof Strategy only providesresults averaged over all elements of x. On the The proof strategy is based on a conditioning technique otherhand,theprobabilisticoneallowsustoobtaindecoupling usedin [12]. A challengingpartin theproofis toevaluatethe resultsforindividualelementsofthesignalvectorx—stronger distributionofanestimationerrorineachiterationconditioned than the averaged results. on estimation errors in all preceding iterations. Bayati and Montanari [12] evaluated the conditional distribution via the D. Contributions distribution of the measurement matrix A conditioned on The main contribution is the rigorous justification of the the estimation errors in all preceding iterations. When linear SE equationsfor the EP-based algorithm,conjecturedin [27]. detection is employed as part of MP, the conditional distri- Moreprecisely,wederiveSEequationsforindividualelements bution of A can be regarded as the posterior distribution of of the signalvectorin the large system limit. Thisimplies the A given linear, noiseless, and compressed observations of A, achievability of the Bayes-optimal performance conjectured determinedbytheestimationerrorsinallprecedingiterations. in [30], when the compression rate is larger than the BP Fori.i.d.Gaussianmeasurementmatrices,itiswellknownthat threshold, while the converse theorem is still open, i.e. there the posterior distribution is also Gaussian. The proof in [12] are no algorithms outperforming the EP-based algorithm in heavily relies on this well-known fact. the large system limit. In order to present our proof strategy, assume M = N, Thetechnicalnoveltyis in an extensionofthe conditioning and that A is a Haar matrix [31], [32], which is uniformly technique in [12] for i.i.d. Gaussian measurement matrices to distributedonthespaceofallpossibleN×N unitarymatrices. the case of Haar matrices. This paper presents a constructive Underappropriatecoordinaterotationsin the row andcolumn proof for the conditionaldistribution of a Haar matrix, which spaces of A, it is possible to show that the linear, noiseless, the correctness of the same result was proved in [24]. The and compressed observation of A is equivalent to observing proof strategy of the main theorem is applicable to any partoftheelementsinA.SinceanyHaarmatrixisbi-unitarily MP algorithm for signal recovery from unitarily invariant invariant [31], the distribution of A after the coordinate measurements, such as the AMP, unless the algorithm con- rotations is the same as the original one. Thus, evaluating tains nonlinear processing in the measurement vector y, e.g. the conditional distribution of A reduces to analyzing the quantization [28]. conditional distribution of a Haar matrix given part of its elements. This argument was implicitly used in [12]. E. Organization Evaluation of this conditional distribution is a technically The remainder of this paper is organized as follows: Af- challenging part in this paper, while this part is not required ter summarizing the notation used in this paper, Section II for i.i.d. Gaussian measurements. Intuitively, conditioning on presentsthedefinitionofunitarilyinvariantmatricesandafew a small partof the elementscan be ignored,since the number technicalresultsassociatedwith Haarmatrices. InSectionIII, of conditioned elements is O(N)— much smaller than the weintroduceassumptionsusedthroughoutthispaper,andthen numberof all elements N2 in the large system limit. In order formulateanEP-basedalgorithm.Themainresultispresented toprovethisintuition,weusecoordinaterotationstorevealthe in Section IV, and proved in Section V. Several technical statistical structure of the conditional Haar matrix. We know results are proved in appendices. that a Haar matrix has similar properties to an i.i.d. Gaussian matrix as N → ∞. In particular, a finite number of linear combinationsoftheelementsin aHaarmatrixwereprovedto F. Notation convergetowardjointlyGaussian-distributedrandomvariables ThepropercomplexGaussiandistributionwithmeanmand in the large system limit [33], [34]. Note that the classical covarianceΣ isdenotedbyCN(m,Σ).Forrandomvariables central limit theorem cannot be used, since the elements of X andY,thenotationX a=.s.Y meansthatX isalmostsurely a.s. a.s. a.s. equal to Y. Similarly, →, ≥, and ≤ indicates that →, ≥, IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 3 and≤ holdalmostsurely.The notationX ∼Y meansthatX Definition 1: A unitary random matrix U ∈U is called a n follows the same distribution as Y, while X →d Y is used to Haar matrix if U is uniformly distributed on Un. represent that X converges in distribution to Y. The notation AnimportantpropertyofaHaarmatrixisbi-unitaryinvari- X| indicatesthat we focuson the conditionaldistributionof ance [32]—used throughoutthis paper. Y X given Y. Definition 2: A random matrix M is called bi-unitarily The notation o(1) denotes a vector of which the Euclidean invariant if M ∼ UMV holds for all deterministic unitary normconvergesalmostsurely towardzeroin the large system matrices U and V. limit. For a vector v ∈ CN, we write the nth element of We first presentthe strong law of large numbersassociated v as v , in which the index n runs from 0 to N −1. For with a Haar matrix. The elements of a Haar matrix are not n k ∈ N, the family N = {N ⊂ {0,...,N −1} : |N| = k} independentofeach other,so thatwe utilizethe stronglaw of k of sets is composedof all possible subsets of the indices with large numbers for dependent random variables. cardinalityk.ForasubsetN ⊂{0,...,N−1},thevectorxN Theorem 1 (Lyons [36]): Let {Xi}∞i=1 denote a sequence consists of the elements {x : n∈N}. For a scalar function ofcomplexrandomvariableswithfinitesecondmoments,and n f :C→C, we introducea conventionin whichf(v) denotes define Sn = ni=1Xi. The strong law of large numbers for the vector obtained by the component-wise application of f Tn = (Sn − E[Sn])/n holds, i.e. limn→∞Tn a=.s. 0, if the P to v, i.e. [f(v)] =f(v ). following assumption holds: n n For a complex number z ∈ C and a matrix M ∈ CM×N, ∞ V[S ] thecomplexconjugate,transpose,andtheconjugatetranspose n <∞. (4) are denoted by z∗, MT, and MH. We write the (m,n)th n=1pn2 X element of M as Mmn. When M is Hermitian, λmin(M) Proof: See [36, Theorem 6]. represents the minimum eigenvalue of M. For M ≥ N, The following lemma is the strong law of large numbers UM×N denotesthespaceofallpossibleM×N matriceswith associated with a Haar matrix. orthonormalcolumns,whileUM×N forM <N representsthe Lemma 1: Suppose that V ∈ U is a Haar matrix. Let N space of all possible M×N matriceswith orthonormalrows. a ∈ CN and b ∈ CN denote random vectors that are When M = N holds, UM×N is written as UM, which is the independent of V and satisfy lim N−1kak2 a=.s. 1, N→∞ space of all possible M ×M unitary matrices. lim N−1kbk2 a=.s. 1, and lim N−1bHa a=.s. C. N→∞ N→∞ We write the singular-valuedecomposition(SVD)of M as Furthermore, we define a Hermitian matrix D ∈CN×N such M =Φ (Σ ,O)ΨH (2) that D is independent of V, and that N−1Tr(D2) is almost M M M surely convergentas N →∞. Then, for M ≤ N, with Φ ∈ U and Ψ ∈ U . Furthermore, M M M N 1 ΣM isanM×M positivesemi-definitediagonalmatrix.The lim bHVaa=.s.0, (5) unitary matrix Ψ is partitioned as Ψ = (Ψk ,Ψ⊥ ), in N→∞N M M M M which ΨkM ∈ UN×M is composed of the first M columns lim 1 bHVHDVaa=.s.C lim 1 Tr(D). (6) of Ψ , while Ψ⊥ ∈ U consists of the remaining N→∞N N→∞N M M N×(N−M) columns. For M >N, we write the SVD of M as Proof: See Appendix A. Σ We nextpresentthe centrallimit theorem associated with a M =ΦM OM ΨHM, (3) Haar matrix. (cid:18) (cid:19) Theorem 2 (Chatterjee and Meckes [34]): Let V ∈ U with ΦM ∈ UM and ΨM ∈ UN. Furthermore, ΣM is an denote a Haar matrix. For any k ∈ N, suppose that Nk N × N positive semi-definite diagonal matrix. The unitary matrices {W ∈ CN×N} are independent of V, and satisfy i matrix ΦM =(ΦkM,Φ⊥M) is partitioned in the same manner Tr(WiWHj ) = Nδi,j for all i,j = 1,...,k, in which as for M ≤N. δ denotes the Kronecker delta. Then, the vector a = i,j When M is full rank, the pseudo-inverse of M is de- (Tr(VW ),...,Tr(VW ))T converges in distribution to 1 k noted by M† = (MHM)−1MH ∈ CN×M for M > N. the standard complex Gaussian vector z ∼ CN(0,I ) as k Let Pk denote the orthogonal projection matrix onto the N →∞. M space spanned by the columns of M. We have Pk = Proof: See [34, Theorem 4.6]. M Φk (Φk )H = MM†. The projection matrix P⊥ onto Lemma 1 and Theorem 2, as well as Theorem 1, will be M M M the orthogonal complement is given by P⊥ = I −Pk . used in the proof of the main theorem. M M M For M ≤ N, we define M† = MH(MMH)−1, Pk = M Ψk (Ψk )H =M†M, and P⊥ =I −Pk . III. SYSTEMMODEL M M M N M A. Assumptions II. PRELIMINARY Assumptions on the measurement model (1) are presented. The purpose of this section is to present two technical Assumption 1: The signal vector x is composed of zero- results: the strong law of large numbers and the central limit meani.i.d.non-Gaussianelementswithunitvarianceandfinite theoremfor a Haarmatrix.The two resultscorrespondto [12, fourth moments. Lemma 2 (a) and (b)] for an i.i.d. Gaussian matrix. We start The i.i.d. assumption for x is implicitly used in the deriva- with the definition of a Haar matrix. tion of an EP-based algorithm. We require no additional IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 4 assumptions for the prior distribution of each element to due to Assumption 2, with prove the main theorem, whereas it is practically important 1 δλ to postulate some prior distribution indicating the sparsity of = dρ(λ), (13) γ(v) σ2+vλ x. Z Definition 3: A Hermitian random matrix M is called uni- where ρ(λ) denotes the asymptotic eigenvalue distribution of tarily invariant if M ∼ UMUH holds for any deterministic AAH in the large system limit. The coefficient γ keeps the t unitary matrix U. orthogonality between estimation errors in the two modules. Assumption2:ThemeasurementmatrixAhasthefollowing Ontheotherhand,moduleBcomputestheminimummean- properties: square error (MMSE) estimator and the MMSE of x n • AHA is unitarily invariant. • TheempiricaleigenvaluedistributionofAAH converges η˜t(xtn,A→B)=E[xn|xtn,A→B], (14) almost surely to a deterministic distribution ρ(λ) with a MMSE(vt )=E |x −η˜(xt )|2 , (15) finite fourth moment in the large system limit. A→B n t n,A→B We write the SVD of A as given the virtual additive w(cid:2)hite Gaussian noise(cid:3) (AWGN) A=U(Σ,O)VH, (7) observation, with U ∈ UM and V ∈ UN. Furthermore, Σ is an M ×M xtn,A→B =xn+znt, znt ∼CN(0,vAt→B). (16) positivesemi-definitediagonalmatrix.FromAssumption2,V From Assumption 1, note that the MMSE is independent of is a Haar matrix and independentof UΣ [32]. n. If a termination condition is satisfied, module B outputs Assumption 3: Let D ∈ CM×M denote any Hermitian η˜(xt ) as an estimate of x. Otherwise, module B feeds matrixsuchthatDisindependentofw,andthatN−1Tr(D2) t A→B the extrinsic mean xt+1 and variance vt+1 of x back to isalmostsurelyconvergentasN →∞.Then,thenoisevector B→A B→A module A, given by w satisfies lim 1 wHUDUHw a=.s. lim σ2Tr(D). (8) xtB+→1A =ηt(xtA→B), (17) M→∞M M→∞M 1 1 1 Assumption 3 implies that σ2 corresponds to the noise vt+1 = MMSE(vt ) − vt , (18) power σ2 a=.s. lim M−1kwk2 per element, by selecting B→A A→B A→B M→∞ D =IM.Assumption3issatisfiedifw isunitarilyinvariant, where the decision function ηt :C→C is defined as e.g. w ∼ CN(0,σ2I ), or if U is a Haar matrix and M η˜(x) x independent of D. η (x)=vt+1 t − . (19) t B→A MMSE(vt ) vt (cid:18) A→B A→B(cid:19) B. Expectation Propagation Remark 1: The decision function ηt(x) is zero for all x ∈ C if and only if x ∼ CN(0,1) holds. We have postulated We start with an MP algorithm proposed in [27]. Let the n Assumption 1 to let the decision function be non-constant. detectorpostulatethatthenoisevectorw in(1) isa circularly The followinglemma presentsan importantpropertyof the symmetric complex Gaussian (CSCG) random vector with decision function η in module B. covariance σ2I . This postulation needs not be consistent t M Lemma 2 (Ma and Ping [27]): Suppose that zt ∼ with the true distribution of w. n CN(0,vt ) is an independentCSCG random variable with As derived in Appendix B, the MP algorithm for this case A→B variance vt . Then, isbasedonEPandcomposedoftwomodules.Initerationt,a A→B firstmodule—calledmoduleA—calculatestheextrinsic mean limE (zt)∗η (x +ǫ+zt) =0, (20) xt andvariancev˜t of the signalvectorx fromxt ǫ→0 znt n t n n A→B A→B B→A and vt provided by the other module—called module B. (cid:2) (cid:3) B→A limE (zt)∗η˜(x +ǫ+zt) =MMSE(vt ). (21) z n t n n A→B xt =xt +γ Wt(y−Axt ), (9) ǫ→0 A→B B→A t B→A (cid:2) (cid:3) Proof: See Appendix C for the proof based on [27]. vAt→B =γt−vBt→A. (10) Lemma 2 will be used to prove the orthogonality between In the initial iteration t = 0, the prior mean x0 = 0 and estimation errors in the two modules. variance v0 =N−1E[kxk2]=1 are used. B→A Remark 2: As considered in [24], [27], we can replace the B→A decision function η with another suboptimal function that In (9), the linear minimum mean-square error (LMMSE) t filter Wt ∈CN×M is given by satisfies the properties in Lemma 2. Such a replacement may be important when the true prior distribution of the signal −1 Wt =AH σ2I +vt AAH . (11) elements is unknown. However, the replacement provides no M B→A influencesontheproofofthemaintheorem,withtheexception (cid:16) (cid:17) The normalization coefficient γ in (9) is defined as of the stability of the derived SE equations. Thus, we only t consider the optimal decision function η , without loss of 1 1 1 t = lim Tr(WtA)a=.s. (12) generality. γt M=δN→∞N γ(vBt→A) IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 5 C. Error Recursion TABLEI NOTATIONALCONVENTIONSFORt=0. AnerrorrecursionfortheEP-basedalgorithmisformulated to analyzethe convergenceproperty.Leth =x−xt and qt =x−xtB→A denote the estimation errotrs for theAe→xtBrinsic XQ00,0==O{,QB10},=XO0,1,M={0Q=1,OB,1H,M0=1|MO,1M=†0G=1(OB,1Q)}†0,=O, eswysetsitmoembattaemisnoitndheemleo(r1dr)ourlienrsteocAu(9ras)ni,odannBd, uressinpgectthiveelSyV. SDub(7st)itauntidng(1t7h)e, PΦ⊥V⊥M0100,t′==ININ,P−t⊥Q′,0Φ=⊥MI0N=,αI0N=,V00,,1β=0={V000,,11},V¯10,11=O. b =VHq , (22) t t 1 1 1 m =b −γ W˜ {(Σ,O)b +w˜}, (23) = − , (35) t t t t t mset+1 MMSE(mset ) mset B→A A→B A→B h =Vm , (24) t t with mse0 = 1, in which γ(·) and MMSE(·) are given B→A q =q −η (q −h ), (25) in (13) and (15), respectively. Then, the individual MSEs t+1 0 t 0 t mset and mset are equal to with w˜ =UHw. In (23), the linear filter W˜ is given by n,B→A n t mset =mset , (36) W˜ =(Σ,O)H σ2I +vt Σ2 −1. (26) n,B→A B→A t M B→A mset =MMSE(mset ) (37) n A→B Furthermore, we define η (cid:0)(·)=0 to obtain q(cid:1) =x. −1 0 In analyzing the convergence property, we focus on the in the large system limit for all n. distribution of the estimation error h conditioned on the Remark 3: In order to simplify the proof of Theorem 3, t preceding iteration history. Thus, it is useful to represent the the individual MSE for the extrinsic estimate in module A is error recursion in the matrix form. Define not analyzed in this paper. However, our proof strategy can beappliedto justifyingthattheindividualMSEformoduleA Qt =(q0,...,qt−1)∈CN×t, convergesto mset in the large system limit. A→B B =(b ,...,b )∈CN×t, Corollary 1: Define the MSEs averaged over the elements t 0 t−1 M =(m ,...,m )∈CN×t, of x as t 0 t−1 Ht =(h0,...,ht−1)∈CN×t. (27) amset = lim 1 E kq k2 , (38) B→A M=δN→∞N t The error recursion is represented as 1 (cid:2) (cid:3) amset = lim E kx−η˜(xt )k2 . (39) VHQt =Bt, (28) M=δN→∞N t A→B Then, the MSEs amset an(cid:2)d amset are equal t(cid:3)o mset Mt =Gt(Bt), (29) and MMSE(mset )Bi→nAthe large system limit, respectiBv→elyA, A→B VM =H , (30) which are defined in Theorem 3. t t Corollary 1 was originally conjectured in [27], and implies Q =F (H ,q ), (31) t+1 t t 0 that the EP-based algorithm predicts the exact dynamics of where the τth columns of G (B ) and F(H ,q ) are equal the extrinsic variances in the large system limit. Compare t t t 0 to the right-hand sides (RHSs) of (23) and (25) for t = τ, (10) and (18) to the SE equations. The FPs of the SE respectively. equations were proved in [27] to correspond to those of an asymptotic energy function that describes the Bayes-optimal IV. MAIN RESULT performance—derived in [30] via the replica method. Thus, the Bayes-optimal performance derived in [30] is achievable We define the individual mean-square error (MSE) for the whentheSEequationshaveauniqueFP,orequivalentlywhen extrinsic estimate in module B as the compression rate δ is larger than the BP threshold. mset a=.s. lim E[|q |2] (32) We shall introduce several notations to present a general n,B→A t,n M=δN→∞ theorem, of which a corollary is Theorem 3. The random inthelargesystemlimit.Furthermore,letmset denotethein- variables in the error recursions (28)–(31) are divided into n dividualMSE for the estimate (14) in the EP-basedalgorithm three groups: V, Θ={Σ,w˜}, and in the large system limit, given by mset = lim E |x −η˜(xt )|2 . (33) Xt,t′ = Qt+1,Bt′,Mt′,Ht BHt′Mt =QHt′Ht, n M=δN→∞ n t n,A→B nMt′ =Gt′(Bt′),Qt+(cid:12)(cid:12)1 =Ft(Ht,q0) , (40) The following theorem is the(cid:2)main result of this pa(cid:3)per,which (cid:12) for t′ = t or t′ = t+1, while we define X = {(cid:9)Q } and describes the rigorousdynamicsof the EP-based algorithm in 0,0 1 X = {Q ,B ,M |M = G (B )}. See Table I for the the large system limit. 0,1 1 1 1 1 1 1 notational conventions used in this paper. Theorem3(StateEvolution):DefinedeterministicSEequa- ThesetΘisfixedthroughoutthispaper.Thus,conditioning tions as on Θ is omitted. The set X describes the history of all t,t mset =γ mset −mset , (34) preceding iterations just before updating (22), while X A→B B→A B→A t,t+1 (cid:0) (cid:1) IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 6 1 creopnrdeisteionntsBthHte′Mhistto=ryQjuHt′sHt bteifsoarecounpsdtartaiinngti(m24p)o.sNinogteVth∈atUtNhe, M=lδiNm→∞NbHτ′mτ a=.s.0, (53) adnydnafmoilcloswosf fthroemerr(o2r8)reacnudrsi(o3n0s),.tIhneodridsterribtuotioinnvoesftitghaeteHathaer M=lδiNm→∞N1 mHτ′mτ a=.s.γτ,τ′ −ζτ,τ′, (54) maLtreitxmV⊥tco=ndiPtio⊥Mnetdmotn. SXitn,tc′eismanktal=yzemd.t − m⊥t is in the M=lδiNm→∞N1 hHτ′hτ a=.s.M=lδiNm→∞N1 mHτ′mτ, (55) 0sp.aFceurstphaenrmneodreb,ymthkte cisolruemprnesseonftMedta,swmehktav=e(mMktt)αHtm, w⊥t it=h M=lδiNm→∞N1 hHτqτ′′ a=.s.0, (56) qαktt′ ==qMt′†t−mqt⊥t′∈=CQt.tS′βimt′i,lawrliyth, wβet′d=efiQne†t′qqt⊥t′′ ∈=CPt′⊥Q.t′qt′ and with δλ(σ2+ζt,t′λ) For notational convenience, we define Q0 = O, B0 = O, γt,t′ =γtγt′ (σ2+vt λ)(σ2+vt′ λ)dρ(λ). M =O, H =O, M† =O, Q† =O, α =0, and β = Z B→A B→A 0 0 0 0 0 0 (57) 0. These definitions imply that P⊥ = I and P⊥ = I M0 N Q0 N (d) The individualMSEs (33) and (32) for the posterior and hold. extrinsic estimates (14) and (17) in module B coincide Theorem 4: The following properties hold for each itera- with the MMSE (15) and extrinsic variance (18) in the tion τ =0,1,...: large system limit, (a) Each element q in q has finite fourth moments. τ+1,n τ+1 mseτ a=.s.MMSE(vτ ), (58) More precisely, for all n n A→B lim E |qτ+1,n|4 <∞. (41) mseτn+,B1→A a=.s.vBτ+→1A. (59) M=δN→∞ Proof: See Section V. For all τ′ ≤τ +1, the fol(cid:2)lowing lim(cid:3)it exists: Ma and Ping [27, Assumption 1] postulated that (50) holds ζτ+1,τ′ a=.s.M=lδiNm→∞N1 qHτ′qτ+1. (42) fisortothoessterotnogfatollibnedijcuesstifiNed=. I{n0,fa.c.t.,,tNhe−p1ro}o.fThoef aTshseuomrepmtio4n For some constant C >0, implies that the assumption may not be correct, since it is impossible to let k =N in Theorem 2. However, the weaker liminf λ 1 MH M a>.s.C, (43) property (b) is sufficient to prove Theorem 3. M=δN→∞ min(cid:18)N τ+1 τ+1(cid:19) Proof of Theorem 3: From (10), (18), (34), and (35), as liminf λ 1 QH Q a>.s.C. (44) wellasfrommse0B→A =vB0→A =1,wenotethatmsetA→B = M=δN→∞ min(cid:18)N τ+2 τ+2(cid:19) vAt→B and msetB→A =vBt→A hold for all t. Thus, Theorem3 follows from (58) and (59). (b) Let {z ∼ CN(0,I )} denote a sequence of indepen- τ N dentstandardcomplexGaussianvectorsthatareindepen- V. PROOF OF THEOREM4 dent of V. Define A. Technical Lemmas b˜ =B β +M o(1)+B o(1)+µ1/2z , (45) τ τ τ τ τ τ τ We needto evaluatethe two distributionsp(m ,b |Θ,X ) t t t,t h˜ =H α +Q o(1)+H o(1)+ν1/2z (46) and p(q ,h |Θ,X ). The former distribution represents τ τ τ τ+1 τ τ τ t+1 t t,t+1 the error recursions (22) and (23) conditioned on the history with 1 of all preceding iterations, while the latter describes the error µ a=.s. lim kq⊥k2, (47) τ M=δN→∞N τ recursions(24) and (25). We follow the proof strategy in [12] toevaluatethetwodistributionsviatheconditionaldistribution 1 ντ a=.s.M=lδiNm→∞Nkm⊥τ k2. (48) p(V|Θ,Xt,t′) for t′ =t or t′ =t+1. See Section I-B for the main idea in analyzing the conditional distributions. Then, for any k ∈N Before analyzing the conditional distribution, we shall in- b | →d b˜ , (49) troduce several definitions used in the proof. For t′ > 0, we τ,N Θ,Xτ,τ τ,N partition V ∈U as N hτ,N|Θ,Xτ,τ+1 →d h˜τ,N (50) V0,t′ Vt,t′ Vt,t′ hold for all subsets N ∈Nk in the large system limit. V = V10011,t′!, V = V0t1,00t′ V0t1,11t′! (60) (c) Letω ∈CN denoteanyvectorthatis independentof V, and satisfies lim N−1kωk2 a=.s. 1. Suppose that D for t>0, with Vt,t′ ∈Ct′×t and Vt,t′ ∈C(N−t′)×(N−t). isanyN×N HerNm→it∞ianmatrixsuchthatD dependsonly We write the SV00Ds of Vt,t′ ∈C(N1−1t′)×t andM ∈CN×t 10 t on Σ, and that N−1Tr(D2) is almost surely convergent for t>0 as as N →∞. Then, for all τ′ ≤τ and τ′′ ≤τ +1 Σ M=lδiNm→∞N1 bHτω a=.s.0, (51) Vt1,0t′ =ΦVt1,0t′ VOt1,0t′!ΨHVt1,0t′, (61) Σ M=lδiNm→∞N1 bHτ′Dbτ a=.s.ζτ,τ′Nl→im∞N1 Tr(D), (52) Mt =ΦMt(cid:18) OMt(cid:19)ΨHMt, (62) IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 7 adsefidneefiΦne⊥Vd0,itn′ =SeIcNti−ont′ aI-nFd.ΦFo⊥Mr0n=otaItNio.naSlimciolanrvleyn,iwenecdee,fiwnee Φ⊥MtP⊥Vt0,1t′(Φ⊥Mt)H =P⊥Mt −PkP⊥MtBt′, (80) the SVDs 1o0f Vt0,1t′ ∈ Ct′×(N−t) and Qt′ ∈ CN×t′ for t′ > 0 Φ⊥Qt′P⊥Vt1,0t′(Φ⊥Qt′)H =P⊥Qt′ −PkP⊥Qt′Ht. (81) as Vt0,1t′ =ΦVt,t′(ΣVt,t′,O)ΨHVt,t′, (63) ThPerofoolfl:oSweiengAplepmenmdaixisE.used to prove the central limit 01 01 01 Σ theorem associated with the second term on the RHS of Qt′ =ΦQt′ OQt′ ΨHQt′. (64) (69). Note that the lemma is not required for i.i.d. Gaussian (cid:18) (cid:19) measurementmatrices, while evaluationof negligibleterms is The following lemma provides a useful representation of essentially the same as in [12, Lemma 2 (c)]. V ∈UN conditionedon Θ and Xt,t′, and correspondsto [12, Lemma 5: For t′ >t≥0 and N −t−t′ >0, suppose that Lemma 10]. V˜ ∈ UN−t−t′ is a Haar matrix and independent of V. Let Lemma 3: For t ≥ 0, t′ > 0, and N −t−t′ > 0, suppose a ∈CN−t−t′ denote a vector that are independent of V˜ and athnadttVh˜at∈boUthN−Qtt−′t∈′ iCsNa×Ht′aaarndmMatrtix∈aCndN×intdaerpeenfudlelnrtanokf Vfor, svaetcistofiressulcimhNth→at∞, fNor−a1nkyakk2∈a=.sN.,1.zSNup∼poCsNe t(h0a,tIzk)∈hColNdsisfoar t>0. Let all subsets N ∈N as N →∞. k Vt0,0t′ =(Q†t′ΦkQt′)HBHt′ΦkMt (65) • If the following properties hold: =(ΦkQt′)HHtM†tΦkMt, (66) Ml=imδNin→f∞λmin N1 MHt Mt a>.s.C, (82) V0t,1t′ =(Q†t′ΦkQt′)HBHt′Φ⊥Mt, (67) liminf λ 1(cid:18)BHP⊥ B (cid:19) a>.s.C (83) V1t,0t′ =(Φ⊥Qt′)HHtM†tΦkMt, (68) M=δN→∞ min(cid:18)N t Mt t(cid:19) for some constant C >0, then with V0,1 = bH/kq k. Then, the conditional distribution of V given01Θ and0Xt,t′0for t′ =t or t′ =t+1 satisfies Φ⊥MtΨ⊥Vt0,1tV˜Ha→d z+Mto(1)+P⊥MtBto(1). (84) V|Θ,Xt,t′ ∼V¯t,t′ +Φ⊥Qt′Φ⊥Vt1,0t′V˜(Φ⊥MtΨ⊥Vt0,1t′)H, (69) hliomldits. conditioned on a, Θ, and Xt,t in the large system where the conditional mean V¯t,t′ is given by V¯0,1 = • If the following properties hold: q bH/kq k2 for t=0, and by 0 0 0 Vt,t′ Vt,t′ Ml=imδNin→f∞λmin N1 QHt+1Qt+1 a>.s.C, (85) V¯t,t′ =ΦQt′ V0t1,00t′ V¯t10,11t′!ΦHMt (70) liminf λ 1(cid:18)HHP⊥ H (cid:19)a>.s.C (86) for t>0, with M=δN→∞ min(cid:18)N t Qt+1 t(cid:19) V¯t,t′ =−Vt,t′[(Vt,t′)†Vt,t′]H (71) for some constant C >0, then 11 10 01 00 =−[Vt0,0t′(Vt1,0t′)†]HVt0,1t′. (72) Φ⊥Qt+1Φ⊥Vt1,0t+1V˜a→d z+Qt+1o(1)+P⊥Qt+1Hto(1) (87) Proof: See Appendix D. holdsconditionedona,Θ,andX inthelargesystem t,t+1 We next present a lemma to evaluate the conditional mean limit. of V, which corresponds to [12, Lemma 12]. Proof: See Appendix F. Lemma 4: For t′ ≥t>0 and N −t−t′ >0, suppose that WearereadytoproveTheorem4.Theproofisbyinduction. both Qt′ ∈CN×t′ and Mt ∈CN×t are full rank. Let In the next subsection, we first prove the theorem for τ =0. ǫ =ΓH HHq⊥, (73) 1,t t,t t t B. Proof for τ =0 ǫ =∆H BH m⊥, (74) 2,t t,t+1 t+1 t Eqs.(49)forτ =0: Theconvergence(49)indistribution with for τ = 0 follows from (22), Theorem 2, q = x, and 0 Assumption 1. Γt,t′ =M†t −M†tBt′(BHt′P⊥MtBt′)−1BHt′P⊥Mt, (75) Eqs. (51)–(54) for τ = 0: The identity (51) for τ = 0 ∆t,t′ =Q†t′ −Q†t′Ht(HHt P⊥Qt′Ht)−1HHt P⊥Qt′. (76) fqoll=owxs,faronmd A(2ss2u)mapntdioLne1mimmapl1y.tShiamti(l5a2rl)y,ho(2ld2s),foLreτmm=a0.1, 0 Then, for all τ <t′ We next prove (53) for τ = 0. Let D = W˜ (Σ,O), with 0 V¯Ht,t′qτ =bτ, (77) Wa˜ssu0mgpivteionnbsyin(2T6h).eAorsesmum4p.tiTohnu2s,imuspinliges(1th2a)t,D(51s)a,tiasnfides(5th2e) V¯H q =B β +ǫ , (78) for τ =0 yields t,t t t t 1,t γ V¯t,t+1mt =Htαt+ǫ2,t, (79) M=lδiNm→∞ N0bH0W˜ 0{(Σ,O)b0+w˜}a=.s.ζ0,0. (88) IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 8 From (23), (52) with D =I for τ =0, and (88), we arrive is bounded. From (54) for τ = 0, the variance ν given in N 0 at (53) for τ =0. (48) coincides with v0 given by (10). Furthermore, the A→B Finally, let us prove (54) for τ = 0. Using (23) and (88), MMSE estimator η˜ (x˜0 ) is equal to the posterior mean 0 n,A→B as well as (51) and (52) for τ =0, we have E[x |x0 =x˜0 ] of x defined via (16). From these n n,A→B n,A→B n observations, we use Jensen’s inequality to obtain 1 mHm a→.s. γ02bHDb + γ02w˜HW˜ HW˜ w˜ −ζ (89) N 0 0 N 0 0 N 0 0 0,0 E |η˜ (x˜0 )|4 ≤E E |x |4|x0 =x˜0 0 n,A→B n n,A→B n,A→B in the large system limit, with =E[|x |4]<∞, (96) (cid:2) (cid:3) (cid:2) n(cid:2) (cid:3)(cid:3) Σ D = W˜ HW˜ (Σ,O), (90) because of Assumption 1. Thus, (41) holds for τ =0. O 0 0 (cid:18) (cid:19) Eq. (42) for τ =0: We shall prove the existence of the whichsatisfiestheassumptionsinTheorem4,becauseof(26) limit (42) for τ =0. We only consider the case τ′ =0, since andAssumption2.Applying(52)forτ =0andAssumption3 thecase τ′ =1canbeprovedinthesamemanner.Using(25) to (89), we obtain (54) for τ =0. yields Eq. (50) for τ =0: Applying Lemma 3 to (24) yields 1 kq k2 qHη (q −h ) qHq = 0 − 0 0 0 0 . (97) bHm N 0 1 N N h ∼ 0 0q +Φ⊥ V˜(Ψ⊥ )Hm , (91) 0 kq0k2 0 Q1 V001,1 0 Since the first term converges almost surely to 1 in the large system limit, it is sufficient to prove that the second term is conditioned on Θ and X . From (53) for τ = 0, we find 0,1 convergentin the large system limit. that the coefficient bHm /kq k2 in the first term converges 0 0 0 InordertoutilizeTheorem1,weuse(50)forτ =0tonote almost surely to zero in the large system limit. We define the variance ν0 in (46) as 1 V qHη (q −h ) → 1 V qHη (q −h˜ ) N 0 0 0 0 N 0 0 0 0 1 ν0 a=.s.M=lδiNm→∞NmH0P⊥V001,1m0. (92) (cid:2) (cid:3) =V q0∗h,0η0(x˜00,A→B) i (98) Lemma 5 implies that, for any k ∈ N, h given by (91) in the large system limit. We repe(cid:2)at the proof of (4(cid:3)1) to find 0,N convergesindistributiontoh˜ givenby(46)forallN ∈N the boundednessof (98). Thus, we can use Theorem1 to find 0,N k in the large system limit, when ν is defined by (92). 0 1 duIcnesotrode(r48to).cAopmpplyleintegtVhe0p,1ro=ofb,Hw/ekqshakllapnrdoPve⊥that=(92I) r−e- M=lδiNm→∞NqH0η0(q0−h0) (V001,1)H{V001,1(V001,1)H}−10V1001,1 t0o (920), and usVin001,g1 m⊥0N= a=.s.M=lδiNm→∞N1 E qH0η0(q0−h˜0) <∞. (99) m , (52), and (53) for τ =0, we have (48) for τ =0. Thus, h i 0 Thus, the limit (42) exists for τ′ =0 and τ =0. (50) holds for τ =0. Eq. (55) for τ =0: Let us prove (55) for τ =0. Using Eq. (56) for τ =0: We evaluate N−1hH0qτ′′. For τ′′ = 0, from (91) we have (91) and Lemma 1 yields 1 1 1 hHh a→.s. 1 |bH0m0|2 +ν (93) NhH0q0 ∼ NmH0b0 (100) N 0 0 N kq k2 0 0 conditionedonΘandX ,wherewehaveused(Φ⊥ )Hq = conditioned on Θ and X in the large system limit. From 0,1 Q1 0 0,1 0. From (53) for τ = 0, we find that N−1hHq converges (53)forτ =0,we findthatthefirsttermvanishesinthelarge 0 0 almost surely to zero in the large system limit. system limit. Since ν given by (48) is equal to the RHS of 0 We next evaluate N−1hHq . Using (25) yields (55) for τ =0 and τ′ =0, (55) holds for τ =0. 0 1 Eq. (41) for τ =0: We shall prove (41) for τ =0. For 1 1 1 hHq = hHq − hHη (q −h ) (101) any a≥0, b≥0, and a+b≤c, we utilize the fact that, for N 0 1 N 0 0 N 0 0 0 0 random variables X and Y, E[|X|a|Y|b] is bounded if both conditioned on Θ and X , where h is given by (91). We E[|X|c] and E[|Y|c] are bounded.The fact is trivialfor a=0 0,1 0 haveprovedthatthefirsttermconvergesalmostsurelytozero or b=0. Otherwise, using Ho¨lder’s inequality yields inthelargesystemlimit.Repeatingtheproofof(42)forτ =0, E[|X|a|Y|b]≤(E[|X|c])a/c E[|Y|bq] 1/q, (94) we use Theorem 1 to find that (101) reduces to with q = c/(c − a) > 0. Since the(cid:0) conditio(cid:1)n a + b ≤ c N1 hH0q1 a→.s.−N1 E h˜H0η0(q0−h˜0) (102) implies bq ≤ c, we find E[|X|a|Y|b] < ∞. Thus, from (25) h i and Assumption 1 it is sufficient to prove that E[|η (q − in the large system limit. 0 0,n h )|4]<∞ holds in the large system limit. In order to evaluate (102), we utilize Lemma 2. Since the 0,n variance ν in (46) is equal to v0 given by (10), we can Using (50) for τ =0, we have 0 A→B use Lemma 2 to obtain E |η (q −h )|4 →E |η (x˜0 )|4 (95) 0 0,n 0,n 0 n,A→B 1 o(1) hHq a→.s. E qHη (q −h˜ ) a→.s.0 (103) in the larg(cid:2)e system limit, wi(cid:3)th x˜0 (cid:2) = q −(cid:3)ν1/2z . N 0 1 N 0 0 0 0 n,A→B 0,0 0 0,0 h i From (19), the moment (95) is bounded if E[|η˜ (x˜0 )|4] in the large system limit. Thus, (56) holds for τ =0. 0 n,A→B IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 9 Eqs. (58) and (59) for τ =0: We use (50) for τ =0 to in the large system limit. Thus, (109) holds. find that the individual MSE (33) reduces to In orderto bound(108) with (109), we use the factthat the maximum eigenvalue of the projection matrix Pk is 1. mse0n = lim E |q0,n−η˜0(q0,n−h˜0,n)|2 , (104) Q1 M=δN→∞ 1 a.s. h i liminf kq⊥k2 ≥E |η (x˜0 )|2 which is equal to MMSE(vA0→B) given by (15), because of M=δN→∞N 1 0 0,A→B ν0L=etvA0us→Bproinve(4(65)9.)Tfhours,τ(5=8)0h.olAdsppfolyrinτg=(109.) to (25) for − lim 1(cid:2)N−1E E (cid:3)η (x˜0 ) 2 M=δN→∞N z0,n 0 n,A→B τq=0,=anvdB1→usAin{gq0(,1n8−),ηw˜0e(qh0a,nve−h0,n)} − vB1→Ah . (105) =E VnX=z00,0 hη(cid:12)(cid:12)0(x˜00,A(cid:2)→B) (cid:3)((cid:12)(cid:12)11i2) 1,n MMSE(vA0→B) vA0→B 0,n in the large system limit. Si(cid:8)nce η0(cid:2)(x˜00,A→B) is a(cid:3)(cid:9)non-constant random variable, the lower bound (112) is strictly positive. In the same manner as in the proof of (58), evaluating (32) Thus, (44) holds for τ =0. with (105) yields mse1 a=.s. (vB1→A)2 − (vB1→A)2, (106) C. Proof by Induction n,B→A MMSE(v0 ) v0 A→B A→B We have proved that Theorem 4 holds for τ =0. Next, we where we have used E[h∗ q ]= o(1)E[|q |2] →0 in the assume thatTheorem4 is correctforallτ <t, and provethat 0,n 0,n 0,n large system limit, obtained from (46) and (50) for τ =0, as Theorem 4 holds for τ =t. Note that we can use Lemmas 3 well as Lemma 2 and (58) for τ = 0. From (18) and (106), and 4, since the induction hypotheses (43) and (44) τ < t we arrive at (59) for τ =0. implythatMt and Qt′ arefullrankfort′ =t andt′ =t+1. Eqs. (43) and (44) for τ = 0: We only prove (44) for Eq.(49)forτ =t: Using (22), Lemma3, andLemma4 τ = 0, since (43) is trivial. If liminf N−1kq⊥k2 yields M=δN→∞ 1 converges almost surely to a strictly positive constant, (44) b ∼B β +ǫ +Φ⊥ Ψ⊥ V˜H(Φ⊥ Φ⊥ )Hq (113) holds for τ = 0 [12, Lemmas 8 and 9]. By definition, we t t t 1,t Mt Vt0,1t Qt Vt1,0t t have conditioned on Θ and X , with ǫ given by (73). t,t 1,t Letus proveǫ a=.s.o(1) in the largesystem limit. We use kq⊥k2 =qHP⊥ q =ηH(q −h )P⊥ η (q −h ), (107) 1,t 1 1 Q1 1 0 0 0 Q1 0 0 0 thesubmultiplicativepropertyoftheEuclideannormtoobtain where (25) has been used. Repeating the proof of (42) for kǫ k2 ≤kNΓ k2kN−1HHq⊥k2. (114) τ =0, we find 1,t t,t t t We first prove that N−1HHq⊥ convergesalmost surely to N1 kq⊥1k2 a→.s.E |η0(x˜00,A→B)|2 zero in the large system limitt. Bty definition, −N1 nX,n′Ehη0∗((cid:2)x˜0n,A→B)[PQk1](cid:3)nn′η0(x˜0n′,A→B)i (108) N1 HHt q⊥t = HNHt qt − HNHt Qt QHtNQt!−1 QNHt qt. (115) in the large system limit. The induction hypothesis (56) for τ < t implies that We next show that the second term on the RHS of (108) N−1HHq and N−1HHQ converge almost surely to t t t t reduces to zero in the large system limit. Furthermore, the induc- 1 N E η0∗(x˜0n,A→B)[PQk1]nn′η0(x˜0n′,A→B) kti(oNn−h1yQpHotQhes)e−s1N(4−21)QaHnqdk(4is4)bofuonrdeτd. T<hust, Nim−p1lHy Htqha⊥t nX,n′ h i convergestalmtost surelyttotzero in the large system limitt. t 1 →NE Ez0[η0H(x˜0A→B)]PQk1Ez0[η0(x˜0A→B)] (109) In order to complete the proof of ǫ1,t a=.s. o(1), we shall in thelargesynstem limit, with[x˜0 ] =x˜0 .oApplying prove that kNΓt,tk2 is bounded. Using (75) and M†tP⊥Mt = A→B n n,A→B O yields the Cauchy-Schwarz inequality to the terms with n= n′, we −1 −1 have MHM BHP⊥ B kNΓ k2 =Tr t t + t Mt t 1 N−1 2 t,t  N ! N ! [Pk ] |η (x˜0 )|2  a≤.s. E[N|η0nX(x=˜N000,A→QB1)n|4n]N0−1[nP,AQk→1]B2nn a→!.s.0 (110) ·BHtNMt MHtNMt!−2 MNHt Bt.(116) nX=0 The induction hypothesis (43) for τ < t implies that the  inthelargesystemlimit.Theconvergencetozerofollowsfrom first term into the trace is bounded in the large system limit. the boundedness of E[|η0(x˜00,A→B)|4] and the upper bound Furthermore, we use the induction hypotheses (43), (52), and N−1[Pk ]2 < Tr{(Pk )2} = Tr(Pk ) = 1. Similarly, (53) for τ <t to obtain n=0 Q nn Q Q 1 1 1 we find −1 −1 P N−1 2 lim BHt P⊥MtBt a=.s. lim QHt Qt , 1 [Pk ] E [η (x˜0 )] 2 a→.s.0 (111) M=δN→∞ N ! M=δN→∞ N ! N Q1 nn z0,n 0 n,A→B ! (117) n=0 X (cid:12) (cid:12) (cid:12) (cid:12) IEEETRANSACTIONSONINFORMATIONTHEORY,VOL.,NO., 10 1 bwehciacuhseimopflitehsethinedubcotuionndehdynpeosstheosfisk((N44−)1fBorHt τP⊥M<tBt.tT)−h1uks,, M=lδiNm→∞NTr(DPkP⊥MtBt)a=.s.0. (127) kNΓ k2 is bounded in the large system limit. Weonlyprove(127),since(126)canbeprovedinthesame t,t We have proved ǫ = o(1). We next use Lemma 5 to manner. Using the the Cauchy-Schwarz inequality yields 1,t evaluate the second term on the RHS of (113). It is possible to confirm that the last term on the RHS of (84) reduces to 1 Tr DPk 2 ≤ kDk2kPkP⊥MtBtk2. (128) P⊥ B o(1)=M o(1)+B o(1). (118) (cid:26)N (cid:18) P⊥MtBt(cid:19)(cid:27) N N Mt t t t From the assumptions in Theorem 4, N−1kDk2 is bounded Thus, we use (113) and Lemma 5 to find that (49) holds for asN →∞.Furthermore,kPk k2 =tholds.Fromthese τ =t, when µt in (45) is defined as P⊥MtBt observations, we arrive at (127). Thus, (52) holds. 1 µ a=.s. lim qHΦ⊥ P⊥ (Φ⊥ )Hq . (119) In order to prove (51) for τ = t, we repeat the same t M=δN→∞N t Qt Vt1,0t Qt t argument to obtain In order to complete the proof of (49), we shall prove that 1 1 (119) reducesto (47). FromLemma4, itis sufficientto prove M=lδiNm→∞NbHt ω a=.s.M=lδiNm→∞NβHt BHt ω a=.s.0 (129) lim 1 qHPk q a=.s.0. (120) conditionedonΘ andXt,t, where we have used the induction M=δN→∞N t P⊥QtHt t hypothesis (51) for τ <t. By definition, we have Letusprove(53)and(54)forτ =t.Using(12),(26),(51), and (52), we obtain qHt PkPN⊥QtHtqt = HNHt q⊥t !H HHt PN⊥QtHt!−1 HNHt q⊥t . M=lδiNm→∞NγtbHτ′W˜ t{(Σ,O)bt+w˜}a=.s.ζt,τ′. (130) (121) The property (53) follows from (23) and (130). We havealreadyprovedN−1HHq⊥ a→.s.0in thelargesystem Similarly, we use (23), (52), and (130) to obtain t t limit. Using the induction hypotheses (44), (55), and (56) for τ <t to evaluate HHt P⊥QtHt yields mHτN′mt a→.s.−ζt,τ′+γτN′γt {(Σ,O)bτ′ +w˜}H lim HHt P⊥QtHt −1 a→.s. lim MHt Mt −1, ·W˜ Hτ′W˜ t{(Σ,O)bt+w˜} (131) M=δN→∞ N ! M=δN→∞ N ! in the large system limit. Using (26), (51), (52), and Assump- (122) tion2,wefindthatthesecondtermreducesto(57)fort′ =τ′. which implies the boundednessof k(N−1HHt P⊥Q Ht)−1k in Thus, (54) holds for τ =t. t thelargesystemlimit,becauseoftheinductionhypothesis(43) Eq.(50) forτ =t: We shallprove(50)forτ =t. Using forτ <t. Fromthese observations,wehave(120).Thus,(49) (24) and Lemma 3 yields holds for τ =t. Eqs. (51)–(54) for τ =t: We first prove (52) for τ =t. ht ∼V¯t,t+1mt+Φ⊥Qt+1Φ⊥Vt1,0t+1V˜(Φ⊥MtΨ⊥Vt0,1t+1)Hmt We use (113), ǫ =o(1), and Lemma 1 to have (132) 1,t conditioned on Θ and X . Applying Lemma 4, we have t,t+1 1 1 M=lδiNm→∞NbHτ′Dbt a=.s.M=lδiNm→∞NbHτ′DBtβt (123) ht ∼Htαt+ǫ2,t+Φ⊥Qt+1Φ⊥Vt1,0t+1V˜(Φ⊥MtΨ⊥Vt0,1t+1)Hmt (133) conditioned on Θ and X for τ < t. Using the induction t,t hypothesis (52) for τ <t, qk =Q β , and qHq⊥ =0 yields conditioned on Θ and Xt,t+1, where ǫ2,t is given by (74). It t t t τ′ t is possible to prove ǫ =o(1) in the large system limit, by (52) for τ′ <τ =t. 2,t repeating the proof of ǫ =o(1). For τ′ =t, (113) and Lemma 1 imply 1,t Lemma 5 implies that h conditioned on Θ and X t,N t,t+1 N1 bHt Dbt a→.s.N1 βHt BHt DBtβt scyosntveemrgleismiint, dwihsternibνutioisndteofihn˜et,dNasgiven by (46) in the large µ t + tTr DΦ⊥ P⊥ (Φ⊥ )H (124) N Mt Vt0,1t Mt ν = lim 1 mHΦ⊥ P⊥ (Φ⊥ )Hm . (134) conditioned on Θ and X nin the large system limoit, with t M=δN→∞N t Mt Vt0,1t+1 Mt t t,t µ given by (47). The induction hypothesis (52) for τ < It is possible to provethat (134) reducesto (48), by repeating t t implies that the fist term converges almost surely to the evaluate of (119). Thus, (50) holds for τ =t. lim N−1kqkk2N−1Tr(D). Thus, we complete the Eq. (55) for τ =t: We next prove (55) for τ =t. From M=δN→∞ t proof of (52) for τ′ =τ =t, by proving (133), ǫ2,t =o(1), and Lemma 1, we have N1 Tr DΦ⊥MtP⊥Vt0,1t(Φ⊥Mt)H a→.s. N1 Tr(D) (125) M=lδiNm→∞N1 hHτ′ht a=.s.M=lδiNm→∞N1 hHτ′Htαt (135) in the largensystem limit. From (80o), it is sufficient to prove conditioned on Θ and Xt,t+1 for τ′ < t. Using the induction hypothesis (55) for τ < t, mk = M α , and mHm⊥ = 0 lim 1 Tr(DPk )a=.s.0, (126) yields (55) for τ′ <τ =t. t t t τ′ t M=δN→∞N Mt

See more

The list of books you might like