loading

Logout succeed

Logout succeed. See you again!

ebook img

Saccharomyces cerevisiae Bat1 and Bat2 Ancestral-Like Kluyveromyces lactis Orthologous Enzyme PDF

pages13 Pages
release year2011
file size0.74 MB
languageEnglish

Preview Saccharomyces cerevisiae Bat1 and Bat2 Ancestral-Like Kluyveromyces lactis Orthologous Enzyme

SaccharomycescerevisiaeBat1 and Bat2 Aminotransferases Have Functionally Diverged from the Ancestral-Like KluyveromyceslactisOrthologous Enzyme Maritrini Colo´n1, Fabiola Herna´ndez1, Karla Lo´pez1, He´ctor Quezada2, James Gonza´lez1, Geovani Lo´pez1, Cristina Aranda1, Alicia Gonza´lez1* 1DepartamentodeBioqu´ımicayBiolog´ıaEstructural,InstitutodeFisiolog´ıaCelular,UniversidadNacionalAuto´nomadeMe´xico,Me´xicoCity,Me´xico,2Departamentode Bioqu´ımica,InstitutoNacionaldeCardiolog´ıa,Me´xicoCity,Me´xico Abstract Background:Geneduplicationisakeyevolutionarymechanismprovidingmaterialforthegenerationofgeneswithnewor modified functions. The fate of duplicated gene copies has been amply discussed and several models have been put forward to account for duplicate conservation. The specialization model considers that duplication of a bifunctional ancestralgenecouldresultinthepreservationofbothcopiesthroughsubfunctionalization,resultinginthedistributionof thetwoancestralfunctionsbetweenthegeneduplicates.Hereweinvestigatewhetherthepresumedbifunctionalcharacter displayed by the single branched chain amino acid aminotransferase present in K. lactis has been distributed in the two paralogous genespresent in S.cerevisiae, andwhether thisconservation hasimpacted S. cerevisiae metabolism. PrincipalFindings:OurresultsshowthattheKlBat1orthologousBCATisabifunctionalenzyme,whichparticipatesinthe biosynthesisandcatabolismofbranchedchainaminoacids(BCAAs).ThisdualrolehasbeendistributedinS.cerevisiaeBat1 and Bat2 paralogous proteins, supporting the specialization model posed to explain the evolution of gene duplications. BAT1ishighlyexpressedunderbiosyntheticconditions,whileBAT2expressionishighestundercatabolicconditions.Bat1 andBat2differentialrelocalizationhasfavoredtheirphysiologicalfunction,sincebiosyntheticprecursorsaregeneratedin themitochondria(Bat1),whilecatabolicsubstratesareaccumulatedinthecytosol(Bat2).Underrespiratoryconditions,in thepresenceofammoniumandBCAAsthebat1Dbat2Ddoublemutantshowsimpairedgrowth,indicatingthatBat1and Bat2couldplayredundantroles.InK.lactiswildtypegrowthisindependentofBCAAdegradation,sinceaKlbat1Dmutant grows underthiscondition. Conclusions:OurstudyshowsthatBAT1andBAT2differentialexpressionandsubcellularrelocalizationhasresultedinthe distributionofthebiosyntheticandcatabolicrolesoftheancestralBCATintwoisozymesimprovingBCAAsmetabolismand constituting an adaptationto facultativemetabolism. Citation:Colo´nM,Herna´ndezF,Lo´pezK,QuezadaH,Gonza´lezJ,etal.(2011)SaccharomycescerevisiaeBat1andBat2AminotransferasesHaveFunctionally DivergedfromtheAncestral-LikeKluyveromyceslactisOrthologousEnzyme.PLoSONE6(1):e16099.doi:10.1371/journal.pone.0016099 Editor:GeraldineButler,UniversityCollegeDublin,Ireland ReceivedOctober20,2010;AcceptedDecember6,2010;PublishedJanuary18,2011 Copyright: (cid:2) 2011 Colo´n et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricteduse,distribution,andreproductioninanymedium,providedtheoriginalauthorandsourcearecredited. Funding:ThisstudywasfundedbyDireccio´nGeneraldeAsuntosdelPersonalAcade´mico,UNAM,grantIN210706-3andN2042093(http://dgapa.unam.mx); ConsejoNacionaldeCienciayTecnolog´ıa(CONACYT),grant49970(http://www.conacyt.gob.mx/Paginas/default.aspx);InstitutodeCienciayTecnolog´ıadel DistritoFederal,Me´xico,grantPIFUTP08-1654(http://www.icyt.df.gob.mx)andMacroproyectodeTecnolog´ıasdelaInformacio´nyLaComputacio´n,UNAM(http:// www.mtuic.unam.mx).MCwasrecipientofaPhDFellowshipfromCONACYT.Thefundershadnoroleinstudydesign,datacollectionandanalysis,decisionto publish,orpreparationofthemanuscript. CompetingInterests:Theauthorshavedeclaredthatnocompetinginterestsexist. *E-mail:[email protected] Introduction acid biosynthesis has led to functional diversification such that retentionofbothcopiesisneededtofulfillthefunctioncarriedout It is accepted that Saccharomyces cerevisiae genome arose from by the original gene [4–6], thus supporting the duplication- completeduplicationofeightancestralchromosomes;functionally degeneration-complementationmodelproposedbyForceetal.[7]. normal ploidy was recovered due to the massive loss of 90% of The specialization or escape from adaptive conflict posed by duplicatedgenes.Analysisofthecompleteyeastgenomesequence Hughes[8]considersthatiftheoriginalgenewasperformingtwo identified several interchromosomal duplicated regions [1,2] functions, that could not be independently improved, after whichconstitutethemolecularevidenceofanancientduplication duplication each gene copy could be driven by positive selection of the entire yeast genome [3]. Gene duplication and the toimproveoneofthetwofunctions.Aminotransferasesconstitute subsequentdivergenceofparalogouspairsplayanimportantrole an interesting model to study diversification of paralogous genes intheevolutionofnovelgenefunctions.Severalmodelshavebeen carrying out two functions, both of which are needed to warrant proposed to account for the emergence, maintenance and metaboliteprovision,andwhichcannotbedifferentiallyimproved, evolution of gene copies. It has been shown that diversification since aminotransferases constitute biosynthetic and catabolic ofparalogousgeneswhoseproductsarestrictlyinvolvedinamino pathways whose opposed action relies on a single catalytic site. PLoSONE | www.plosone.org 1 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization Furthermore, metabolite provision through the action of amino- Resultspresentedinthispapersupportthespecializationmodel transferases,isnecessarywhenyeastisgrownineitherfermentable posed by Hughes [8], showing that i) K. lactis KlBAT1 codifies a or non-fermentable carbon sources and thus, functional diversi- presumed mitochondrial localized BCAT, which participates in ficationofaminotransferase-encodingparalogousgenescouldplay both,thebiosynthesisandcatabolismofBCAAs,whichisunable a fundamental roleintheadaptation tofacultative metabolism. tocomplementS.cerevisiaebat2Dmutants,andthatii)inS.cerevisiae In the yeast Saccharomyces cerevisiae, the last step in the biosynthetic and catabolic roles have been distributed in two biosynthesisandthefirststepinthecatabolismofbranchedchain paralogous genes. Bat1 is preferentially involved in BCAAs amino acids (BCAAs), is achieved through the action of the biosynthesis, while Bat2 function is determinant for BCAAs branched chain aminotransferases (BCATs) encoded by the catabolism,indicatingfunctionaldiversification.Thespecialization paralogouspairBAT1andBAT2,whichformpartofaduplicated has been afforded through differential subcellular localization of chromosomalblockgeneratedfromtheWholeGenomeDuplica- the encoded products and divergent gene expression patterns, tion(WGD)event[2,3](http://www.gen.tcd.ie/,khwolfe/yeast/ which is reflected in enzyme activity under various physiological nova/index.html). AnadditionalinspectionusingtheYeastGene conditions. Order Browser (http://wolfe.gen.tcd.ie/ygob/) also suggests that BAT1/BAT2couldbeinaduplicatedblock.Thisevidencepoints Results totheoriginoftheBAT1-BAT2duplicatedgenepairaspartofthe WGD duplication event rather than to an isolated gene The ancestor-like branched chain aminotransferase duplication phenomenon. These enzymes catalyze the transfer of KlBat1 is a bifunctional biosynthetic and catabolic amino groups between the amino acids valine, leucine and enzyme isoleucine and their corresponding a-ketoacids, the biosynthetic A Klbat1D mutant incubated on glucose and ammonium, precursorsoffuselalcohols,whichinfluencethearomaandflavor displayed valine, isoleucine and leucine (VIL) auxotrophy of yeast derived fermentation products such as beer and bread (Table 1). Wild type growth was only attained when the three [9,10],andwhichhavebeenrecentlyfoundtoregulatetranslation BCAAs were simultaneously added to the growth medium. The initiation byinhibiting eIF2B[11]. Klbat1D mutant did not grow when branched chain amino acids The lineage which gave rise to Kluyveromyces lactis (K. lactis) were supplemented as sole nitrogen sources (Table 1), showing diverged before the WGD event, therefore, K. lactis genome does that this enzyme is also involved in BCAAs catabolism. These not harbor theduplication blocks present in S. cerevisiae [3].In K. results indicate that no redundant pathways are involved in VIL lactisthegeneKlBAT1constitutes,theuniqueorthologueoftheS. biosynthesis and catabolism. As expected, Klbat1D transformants cerevisiae BAT1 and BAT2 paralogous gene pair encoding a carryingtheKlBAT1geneonacentromericplasmiddisplayedwild branched chain aminotransferase (KlBat1). We have undertaken typephenotypewhengrownoneitherammonium-glucoseorVIL- thestudyofthefunctionalroleplayedbyKlBat1,Bat1andBat2,in glucose(Table1),indicatingthatKlBat1isabifunctionalenzyme, ordertounderstandwhethertheroleplayedbytheancestral-type whichparticipates inVIL biosynthesis andcatabolism. enzyme has been conserved in Bat1 and Bat2 resulting in redundant function or whether it has been distributed between In S. cerevisiae, biosynthetic and catabolic roles of the these twoenzymes resulting indiversification. branched chain aminotransferases have been KlBat1 encoded protein is constituted by 407 amino acid differentially distributed in the BAT1 and BAT2-encoded residues and as well as Bat1 it bears an amino terminal signal peptidewhichcoulddirectitsmitochondriallocalization.Itshares isozymes 82% amino acid identity with Bat1 and 79% with Bat2. BAT1 Single and double bat1D and bat2D mutants were constructed. encodes a 393 amino acid residues mitochondrial protein, while As Table 2 and Figure 1A, CEN show, a double bat1D bat2D thecytosolicBat2iscomposedof376residues;thesetwoenzymes mutantdisplayedVILauxotrophywhenincubatedonglucoseand show 81% identity. Previous results from other laboratories have shown that on glucose-containing media, BAT1 single deletion Table1.Klbat1Dmutants areimpaired inVIL biosynthesis impaired neither cell growth nor fusel alcohol production; andcatabolism. however,drasticeffectsinfuselalcoholproductionwereobserved in a bat2D deletion mutant. Deletion of both genes resulted in branchedchainaminoacidauxotrophy,severegrowthretardation Relativegrowtha(%) and diminished fusel alcohol production [12]. The fact that the enzymes involved in the biosynthesis of the BCAAs are Glucose mitochondrially located has led to the notion that in S. cerevisiae, Strain NH4+ NH4+VILb VIL thebiosyntheticprocessismainlycarriedoutinthemitochondria. KlWT 100 100 100 However, the fact that Bat1 and Bat2 are located in both compartments indicates that the last step in BCAAs biosynthesis CLA34(Klbat1D) 0 96 0 can be carried out in either the mitochondria or the cytoplasm. KlWT(pKD1) 100 100 100 Furthermore,fortheleucinebiosyntheticpathway,Leu1andLeu2 KlWT(pKD1KlBAT1) 100 100 100 have been only found in cytosol [13,14] indicating that the CLA34(pKD1) 0 N.D.c 0 conversion of a-ketoisovalerate to a-isocaproate the immediate CLA34(pkD1KlBAT1) 100 N.D. 100 precursor of leucine is carried out in the cytoplasm and further transported to the mitochondria so that the last step in leucine aValuesareshownrelativetogrowthrateofthewildtypestrain(0.12h21and biosynthesis can be carried out in either the mitochondria or the 0.13h21onNH4+andaminoacids,respectively);andrepresentthemeans cytoplasm,throughtheactionofeitherBat1orBat2.Noanalysis fromthreeindependentexperiments(variationwasalways#10%). bAminoacidsweresupplementedataconcentrationof150mg/l,100mg/lor has been undertaken to determine the compartment in which 30mg/lofvaline(V),leucine(L)orisoleucine(I)respectively. BCAAs catabolism is carried out and the physiological role of cN.D.notdetermined. differential Bat1and Bat2localization hasnot been analyzed. doi:10.1371/journal.pone.0016099.t001 PLoSONE | www.plosone.org 2 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization ammonium; wild type growth was attained when this strain was complementation failed with plasmids carrying BAT1 (Figure 1B, grown in the presence of the three BCAAs (Table 2). BAT1 and CEN vs. CEN BAT1 and CEN BAT2). Since on glucose- BAT2 were independently cloned on centromeric plasmids and ammonium-VIL the double and single bat2D mutants showed usedtotransformthebat1Dbat2Dmutant.Transformantscarrying growthrateswhichwereequivalenttothosedisplayedbythewild BAT1recoveredVILprototrophy(Figure1A,CENBAT1),while type strain, it can be concluded that in glucose VIL catabolism those carrying BAT2 showed a bradytrophyc phenotype fulfills nitrogenrequirements. (Figure1A,CENBAT2),indicatingthatBat1hadamoreefficient These results indicate that Bat2 has a prominent role in VIL biosynthetic role than that exerted by Bat2. When cultured on catabolism,whileBat1catabolicroleisonlyevidencedinabat2D ammonium-glucose,thesinglebat1Dmutantshowedasignificant- genetic background. The fact that as Figure 2 shows, Bat1 ly decreased growth rate (69%), as compared to the wild type mitochondrial localization isconserved inthepresence of VIL as strain however, it attained wild type growth rates by the sole sole nitrogen source indicates that Bat1 catabolic character is additionofvalinetothegrowthmedium(94%)(Table2),orwhen exerted in this compartment. It could be proposed that under complemented with a centromeric plasmid harboring BAT1 these conditions VIL accumulation in the mitochondria, would (Figure 1A, CEN vs. CEN BAT1). BAT2 did not complement enhance Bat1catabolic character. bat1D growth deficiency (Figure 1A, CEN BAT2). These results AbovepresentedresultsindicatethatinawildtypestrainBat1 indicate that Bat1 activity is indispensable to fulfill valine displays a biosynthetic character while Bat2 has a prominent requirement and that Bat2 is unable to fully replace Bat1, catabolic role. suggestingfunctionaldiversification.Accordingly,thesinglebat2D mutantgrewaswellasthewildtypeonammonium-glucose,with KlBAT1 does not complement bat2D mutant strains orwithoutaminoacids(Table2),confirmingthatBat1completely ToanalyzewhethertheKlBat1enzymewasabletoreplaceBat1 fulfilledbiosyntheticneeds.SinceithasbeenproposedthatBat2is orBat2inS.cerevisiae,amonocopyplasmidharboringtheKlBAT1 cytosolic, while Bat1 is mitochondrially located [9] it could be genewasindependentlytransformedinbothsinglemutantsbat1D consideredthatthevalinepoolgeneratedthroughBat2mightnot and bat2D and in the double mutant bat1D bat2D. Constructions beefficientlytransportedtothemitochondria.Inordertoconfirm werepreparedinordertopromoteKlBAT1expressionfromeither in vivo enzyme localization, Bat1-yECitrine and Bat2-yECitrine its own promoter or by the heterologous BAT1 or BAT2 tagged strains were constructed as described in Materials and promoters.Whengrownonammonium-glucosethebat1Dmutant Methods and subcellular localization was analyzed by confocal harboring KlBAT1 on a monocopy plasmid attained wild type microscopy.AsFigure2shows,Bat1wasfoundtobelocalizedin growth regardless of the promoter used to drive its expression mitochondria, while Bat2 was cytosolic, confirming previous observations [9]. It could thus be proposed that as mentioned (Figure 1A). In the case of the bat1D bat2D double mutant, the above, the valine pool synthesized through Bat2 is not efficiently presence of KlBAT1 only restored 72% of wild type growth transported to the mitochondria or that valine synthesis through (Figure 1A); indicating that KlBat1 could only partially substitute Bat2 is scarce leading to the observed valine braditrophy of a simultaneous lack of Bat1 and Bat2. When growing on VIL- bat1Dmutant. glucoseneitherthebat2Dnorthedoublemutantattainedwildtype ToanalyzetheroleofBat1andBat2onVILcatabolism,bat1D growthwhenKlBAT1expressionwasdrivenfromtheBAT1,BAT2 bat2Ddoublemutantandsinglemutantsweregrownonglucosein or KlBAT1 promoters (Figure 1B), although higher growth rates the presence of the three BCAAs as sole nitrogen source. Under were attained with PBAT2-KlBAT1 or PKlBAT1-KlBAT1, suggesting theseconditions,thewildtypestrainandthebat1Dmutantshowed thatapromoter-dependenteffectcouldenhanceKlBAT1capacity highergrowth rates thanthose observed inthedouble andbat2D to complement lack of Bat2. It could be possible that either the mutants indicating a catabolic role for Bat2 (Table 2 and KlBat1heterologousenzymehaspeculiarkineticpropertiesthatdo Figure 1B, CEN). On VIL-glucose bat2D mutant was only able not allow full bat2D complementation, or that the differential to achieve 70% of the growth rate displayed by the wild type subcellular localization of KlBat1 and Bat2, could hamper bat2D strain, suggesting that Bat2-dependent VIL catabolism was complementation, since as mentioned earlier, Bat2 is a cytosolic required for wild type growth, and that Bat1 was unable to enzyme and although localization of KlBat1 has not been compensatelackofBat2(Table2;Figure1B,CEN).Accordingly, experimentally determined, an in silico analysis using Mitoprot singlebat2Danddoublemutantsrecoveredwildtypegrowthwhen and SignalP databases suggests that KlBat1 is located in the transformed with a centromeric plasmid harboring BAT2, mitochondria. Table2.InS.cerevisiaebat1DmutantisimpairedinVILbiosynthesis,whileabat2DmutantismainlyimpairedinVILcatabolism. Relativegrowtha(%) Glucose Strain NH4+ NH4+Vb NH4+I NH4+L NH4+VIL V I L VIL CLA1-2(WT) 100 100 100 100 100 100 100 100 100 CLA31(bat1D) 69 94 65 65 100 97 88 78 100 CLA32(bat2D) 100 95 93 100 100 61 52 78 70 CLA33(bat1Dbat2D) 0 0 0 0 91 0 0 0 0 aValuesareshownrelativetogrowthrateofthewildtypestrain(0.20h21and0.11h21onNH4+andaminoacids,respectively);andrepresentthemeansfromthree independentexperiments(variationwasalways#10%). bAminoacidsweresupplementedataconcentrationof150mg/l,100mg/lor30mg/lofvaline(V),leucine(L)orisoleucine(I)respectively. doi:10.1371/journal.pone.0016099.t002 PLoSONE | www.plosone.org 3 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization PLoSONE | www.plosone.org 4 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization Figure1.GrowthphenotypeofsingleanddoublemutantscomplementedwithplasmidsharboringBAT1,BAT2orKlBAT1.Wildtype, bat1D,bat2Dandbat1Dbat2Dstrainsweregrownonammonium-glucose(A)orVIL-glucose(B).Valuesareshownrelativetogrowthrateofthewild typestrain(0.20h21and0.13h21onammonium-glucoseandVILglucoserespectively)andrepresentthemeanofthreeindependentexperiments 6S.D.Cellswerecomplementedwithacentromericplasmid(CEN)harboringBAT1(CENBAT1),BAT2(CENBAT2)ortheK.lactisorthologousgene KlBAT1whoseexpressionwasdrivenbyitsownpromoter(CENP -KlBAT1)orbyBAT1(CENP -KlBAT1)orBAT2(CENP -KlBAT1)promoters. KlBAT1 BAT1 BAT2 doi:10.1371/journal.pone.0016099.g001 KlBAT1 has a biosynthetic-like expression profile indicatingthatthequalityofthenitrogensourcehadnoeffecton Total RNA was prepared from K. lactis wild type strain grown KlBAT1 expression (Figure 3A). However, expression was onglucoseascarbonsourcewithvariousnitrogensources.Itwas repressed in total RNA samples obtained from cultures grown in found that KlBAT1 expression profile was that expected for a the presence of VIL as sole nitrogen source, or when combined biosynthetic enzyme. Steady state mRNA levels were similar in withadditionalnitrogensourcessuchasammoniumorGABA,as total RNA samples obtained from cultures grown on either comparedtothatfoundintheabsenceofVIL(Figure3A).Worth repressive(glutamine)ornon-repressivenitrogensources(GABA), of mention is the fact that VIL repression was not observed in Figure 2. Bat1 is mitochondrially located, while Bat2 is cytoplasmic. Fluorescence images showing the subcellular localization of the paralogousproteinsBat1andBat2.Samplesweretakenfromexponentiallygrownculturesoftaggedmutantsgrownonglucose-ammonium(A,B)or onglucose-VIL(C,D).MitochondriallocalizationofBat1,thesignaloftheBat1-yECitrinefusionco-localizeswithmitotrackersignal(A,C).Cytoplasmic localizationoftheBat2-yECitrinefusion(B,D). doi:10.1371/journal.pone.0016099.g002 PLoSONE | www.plosone.org 5 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization glutamine, suggesting that this amino acid could hinder VIL respectively. However,since onlythedouble bat1Dbat2Disa full transport, thus resulting in a low intracellular accumulation of VILauxotrophunabletoutilizeVILassolenitrogensource,itcan these aminoacids. be concluded that the biosynthetic and catabolic roles of these enzymes is partially redundant. Highest activities were detected BAT1 and BAT2 show divergent expression profiles when a-KIC (leucine) was provided as substrate, as compared to ToanalyzewhethertheapparentdivergenceinBat1andBat2 that for a-KIV (valine) or a-KMV (isoleucine), indicating metabolicroles,wascorrelatedwiththeexpressionprofileoftheir differential kineticproperties for the various substrates that could encoding genes, Northern analysis was carried out. It was found reflect differential substrate affinity. that as well as KlBAT1, BAT1 was mainly expressed on ammonium-glucoseexponentialcultures(biosyntheticconditions), BAT1 and BAT2 show differential expression profiles and and repressed in the presence of VIL. BAT1 expression was not enzymatic activity under respiratory conditions influenced by the quality of the nitrogen source, and VIL The collection of single and double bat1D and bat2D mutants repression was observed on either repressive or non-repressive was grown on ethanol as carbon source and ammonium as nitrogensources(Figure3Band3C).Conversely,BAT2showeda nitrogensource.Underthiscondition,growthofthedoublebat1D classiccatabolicexpressionprofile;respondingtothequalityofthe bat2Dmutantwascompletelyimpaired,eveninthepresenceofthe nitrogen source; down-regulated in the presence of repressive threeaminoacids,indicatingthatVILcatabolismiscompellingfor nitrogen sources (glutamine) and derepressed in secondary non- growth in the presence of non-fermentable carbon sources, even repressive nitrogen sources such as GABA (Figure 3B and 3C). on ammonium as nitrogen source (Table 3). Conversely, Klbat1D BAT2 expression was twelve-fold increased when total RNA was mutant was able to sustain growth in media supplemented with obtainedfromculturesinwhichVILwasprovidedassolenitrogen VIL-ammonium-ethanol, indicating that as opposed to that source (catabolic conditions), as compared to that found when observedinS.cerevisiae,VILcatabolismisnotnecessarytoachieve RNA was prepared from on ammonium-glucose cultures growth in the presence of ethanol as sole carbon source and (Figure 4). BAT2 expression was also induced in a bat1D genetic ammoniumasnitrogensource,underscoringthefactthatK.lactis background. Under derepressed conditions (GABA), the addition has a more efficient ethanol catabolism [15]. Accordingly, the of the three branched chain amino acids, had a positive effect K. lactis wild type strain achieved a higher growth rate than that further inducing BAT2 expression (Figure 3B). attainedbytheS.cerevisiaewildtypeCLA1-2strainwhengrownon ethanolassolecarbonsource(0.21vs.0.12 h21).Onammonium- KlBat1 enzymatic activity displays a biosynthetic ethanol, the bat2D mutant and the wild type strain, showed equivalent growth rates, while bat1D showed a slightly decreased character growth rate as compared to the wild type strain, which was KlBat1 activity was determined in extracts obtained from alleviatedinthepresenceofthethreeaminoacids,thusconfirming cultures grown under biosynthetic and catabolic conditions Bat1biosyntheticrole.Asexpected,singlemutantsandwildtype (Figure 5A). Activity was similar in extracts obtained from strainshowedequivalentgrowthratesinthepresenceofthethree ammonium-glucose with or without VIL (Figure 1A), indicating aminoacids.Whenethanolwasprovidedasthesolecarbonsource that the observed repression of KlBAT1 expression on VIL- andthebranchedaminoacidsassolenitrogensourceneitherthe ammonium did not result in decreased enzymatic activity. When S.cerevisiaewildtypestrainnorthesingleordoublemutantsgrew, a-ketoisovalerate(a-KIV)wasusedassubstrate,activitywasnearly indicatingthattheseaminoacidsarepoorlycatabolizedandthus two-fold higher to that found with a-ketoisocaproate (a-KIC), unable to allow growth under these conditions (Table 3). indicating differential kinetic properties for these substrates. Conversely, on VIL-ethanol, K. lactis wild type and the Klbat1D Lowest activity was detected on a-ketomethylvalerate (a-KMV). mutant complemented with the centromeric plasmid harboring In extracts obtained from VIL-glucose (catabolic conditions), theKlBAT1 genewithitsnativepromotersequence,wereableto KlBat1 activity was at least ten-fold lower than that observed on sustaingrowth, confirmingKlBat1catabolic character(Table 3). ammonium-glucose (biosynthetic conditions), confirming KlBAT1 Northern analysis performed with extracts obtained from expression profile (Figure 5A) and indicating that KlBat1 has a ammonium-ethanol grown cultures, showed that BAT1 and pronounced biosyntheticcharacter. BAT2 displayed opposed expression profiles; BAT1 expression wasfive-foldrepressed,whilethatofBAT2wastwo-foldincreased Bat1 and Bat2 enzymatic activity is consistent with BAT1 on ethanol as compared to those found on glucose. KlBAT1 and BAT2 expression profile showed a similar expression pattern to that of BAT1, since its BCAT enzymatic activity was determined in extracts obtained expression was decreased on ethanol as compared to glucose from the wild type and the single bat1D and bat2D mutants. As (Figure 6Aand6B). Figure 5A shows, activity determined on ammonium-glucose In extracts prepared from ammonium-ethanol, Bat1 activity (biosyntheticconditions)washigherinthebat2D(BAT1)mutant,as (bat2D) decreased when either one of the three a-ketoacids were compared to that found in the bat1D (BAT2) mutant strain, used as substrates, as compared to that found on glucose although in the presence of VIL-ammonium Bat1 activity ammonium, while that of Bat2 (bat1D) was nearly two-fold decreased, it was however higher than that observed for Bat2. increased as compared to that found on glucose (Figure 5A and Conversely, in the presence of VIL as sole nitrogen source 5B).Theseresultssuggestthatunderrespiratoryconditions,Bat1- (catabolic conditions)Bat2activitywas higherthan that observed dependent a-ketoacid utilization would be diminished; avoiding for Bat1. These results are in agreement with expression profile increasedcarbonfluxbeingchanneledtoVILbiosynthesis,while observed for either BAT1 or BAT2, which indicate that BAT1 enhanced Bat2 activity would increase VIL utilization, favoring expressionisVILrepressedwhilethatofBAT2isinducedinVIL S. cerevisiae capacity to grow under respiratory conditions. On as sole nitrogen source (Figure 4). These results support the ammonium ethanol VIL, Bat1 activity was equivalent to that propositionthatBCATbiosyntheticandcatabolicroleshavebeen found without VIL, and Bat2 activity was two or three-fold distributed between the two paralogous enzymes. Bat1 and Bat2 increased as compared to ammonium ethanol (Figure 5B), thus have diverged acquiring a biosynthetic or catabolic character, underVIL-ammonium-ethanol,Bat1andBat2showedequivalent PLoSONE | www.plosone.org 6 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization Figure3.SaccharomycescerevisiaeBAT1andKlBAT1expressionisrepressedbyVIL.NorthernanalysiswascarriedoutontotalRNAobtained fromK.lactis155(wildtype)andCLA34(Klbat1D)strains(A),andS.cerevisiaestrainCLA1-2(wildtypeB,C).Strainsweregrownon2%glucosewith eithervaline(V)(150mg/l),leucine(L)(100mg/l),isoleucine(I)(30mg/l),c-aminobutiricacid(GABA7mM),c-aminobutiricacid+VIL(GABAVIL),VIL (valine+isoleucine+leucine), NH (40mM NH SO), NH VIL (40mM NH SO+VIL), glutamine (GLN 7mM), glutamine+VIL (GLN VIL), as nitrogen 4 4 2 4 4 2 sources.FiltersweresequentiallyprobedwiththeBAT1,BAT2,KlBAT1-specificPCRproductsdescribedinexperimentalproceduresandaBamH1- HindIII1500bpACT1DNAoranSCR400bpPCRfragmentasloadingcontrols.NumbersindicaterelativeexpressionascomparedtoWTgrownon ammonium-glucose.Fourbiologicalreplicateswerecarriedout,representativeresultsareshown. doi:10.1371/journal.pone.0016099.g003 PLoSONE | www.plosone.org 7 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization Figure4.S.cerevisiaeBAT1andBAT2displaydivergentexpressionprofile.NorthernanalysiswascarriedoutontotalRNAobtainedfrom S.cerevisiaestrainsCLA1-2(wildtype),CLA31(bat1DBAT2)andCLA32(BAT1bat2D).Strainsweregrownon2%glucosewitheither40mMNH SO , 4 2 VIL(150mg/l,100mg/lor30mg/lofvaline(V),leucine(L)orisoleucine(I)respectivelyorNH SO +VILasnitrogensources.Filtersweresequentially 4 2 probedwitha1500bpBAT1fragment,a1450bpBAT2andaBamH1-HindIII1500bpACT1DNAfragmentasloadingcontrol.Numbersindicate relative expression as compared to: Lane 1 the WT grown on glucose VIL, Lane 2 WT grown on glucose NH . Four biological replicates were 4 performed,andrepresentativeresultsareshown. doi:10.1371/journal.pone.0016099.g004 enzymatic activities, indicating that both enzymes could equally Under respiro-fermentative conditions BAT1 and BAT2 diver- contributetoVILcatabolism,infactasTable3shows,growthrate gent expression has contributed to emphasize the biosynthetic ofeitherbat1Dorbat2Dissimilar,andgrowthisonlyimpairedin function of Bat1 and the catabolic function of Bat2. The the double mutant. It can be concluded that under respiratory observation that BAT1 expression is four-fold higher than that of conditions, Bat1 and Bat2 play partially biosynthetic redundant BAT2whencellsaregrownonglucoseammonia,andthatBAT2 roles, andredundant catabolic roles. expression is twelve-fold increased in the presence of a non- Aswell asforBat1,KlBat1activitywasthree-fold decreasedin repressive nitrogen source and further enhanced when VIL is extracts prepared from ammonium-ethanol grown cultures, as present as sole nitrogen source as compared to that found on compared to those found on ammonium-glucose (Figure 5A and ammonium, supports this proposition. Expression differences 5B) in agreement with the expression profile, and as well as for impact BCAT activity, in the presence of ammonium-glucose Bat1,additionofVILtoammonium-ethanolgrowthmediumdid Bat1 activity is higher than that of Bat2 improving Bat1 not affect activity, suggesting that under respiratory conditions, biosynthetic capacity. Conversely, in the presence of glucose as biosynthesisisdecreasedandcatabolismistriggered,thusfavoring carbon source and VIL as sole nitrogen source, Bat2 activity is an equilibrated consumption andsynthesisof a-ketoacids. enhanced, thus favoring its catabolic role. Bat1 has a limited catabolic character, which is most evident in the double bat1D Discussion bat2D mutant, which is completely unable to utilize VIL as nitrogen source. The fact that bat1D is a valine braditroph This study addresses the question of whether the biosynthetic indicates that Bat2 valine biosynthetic capacity is limited or that and catabolic roles played by the ancestral-like KlBAT1 encoded thecytosolicvalinepoolisunabletoenterthemitochondria,and aminotransferase present in K. lactis, have been distributed in thus Bat1 constitutes a committed step to synthesize the valine the paralogous BAT1 and BAT2 orthologous genes present in mitochondrial pool. These observations underscore the role of S. cerevisiae and whether this subfunctionalization has improved differential localization in Bat2 and Bat1 divergence and put branchedchainaminoacidmetabolismconstitutinganadaptation forward the possibility that restricted biosynthesis or transport of tofacultative metabolism. thecytosolic generatedvaline pooltothemitochondriacould act as positive selection determining BAT1 retention and Bat1 BAT1 and BAT2 divergent expression profiles and mitochondrial localization. differentialsubcellularlocalizationcontributetoBat1and Bat2 functional diversification BAT1 and BAT2 retention constitutes an adaptation to Presented results show that the KlBAT1 orthologue codifies a facultative metabolism bifunctional enzyme able to carry out BCAAs biosynthesis and BAT1 expression is higher under fermento-respiratory condi- catabolismandthatthiscapacityhasbeendistributedintheBAT1 tionsascomparedtothatdetectedunderrespiratorymetabolism, and BAT2S.cerevisiae paralogous pair. while BAT2 expression is increased under respiratory conditions. PLoSONE | www.plosone.org 8 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization Figure5.Branchedchainaminotransferaseactivity.S.cerevisiaewildtype,bat1D,bat2DandK.lactiswt(KlWT)strainsweregrownonglucose (A)orethanol(B)ascarbonsourceandammoniumorVILasnitrogensources.Aminotransferaseactivitywasdetermined incellfreeextractsas indicated in Materials and methods using a-ketoisovalerate (a-KIV), a-ketoisocaproate (a-KIC) or a-ketomethylvalerate (a-KMV) as substrates. Transaminaseactivityisreportedasnmolmg/lmin21.Valuesarepresentedasmeanfromatleastthreemeasurements6S.D. doi:10.1371/journal.pone.0016099.g005 Reduced BAT1 expression under respiratory conditions could diateflowthroughthetricarboxyliccycledoesnothamperenergy contributetodecreasedmetaboliteflowtoaminoacidbiosynthesis provision, constituting an adaptationtofacultative metabolism. favoring energy yielding pathways. Conversely, increased Bat1 Underfermentativeorrespiratoryconditions,Klbat1Dmutantis activity under fermento-respiratory conditions, would not hinder able to grow in the presence of the three BCAAs, indicating that energyprovision,sinceundertheseconditionsdecreasedinterme- catabolism is not required for growth, however the bat1D bat2D PLoSONE | www.plosone.org 9 January2011 | Volume 6 | Issue 1 | e16099 AminotransferaseDuplicationandSpecialization amyl alcohol and isoamyl alcohol, which have a great impact on Table3.Growthphenotypesofsingleanddoublebat1Dand beer smell and taste in either fermento-respiratory or respiratory bat2Dmutants. conditions [12,16]. Although incapacity to produce higher alcohols should not affect growth rate, the fact that either one of Relativegrowtha(%) the two single mutants are unable to grow on ethanol-VIL, suggests that catabolism of these compounds in addition to the Ethanol production of fusel alcohols could provide intermediates indis- Strain NH4+ NH4+VIL VIL pensable for growth under respiratory conditions. Since fusel alcohols are not further metabolized it could be considered that CLA1-2(WT) 100 100 0 the main product contributed by BCAA catabolism could be CLA31(bat1D) 87 93 0 oxidized NAD+ produced when fusel aldehydes are reduced to CLA32(bat2D) 100 94 0 fuselalcoholsthroughtheEhrlichpathway,howeverthispossible CLA33(bat1Dbat2D) 0 0 0 role of the Ehrlich pathway remains to be analyzed [17]. Thus retention of BAT1 and BAT2 ensure BCAAs catabolism and KlWT 100 100 71 growthunderrespiratoryconditionsinS.cerevisiae.Thiscouldhave CLA34(Klbat1D) 0 64 0 actedasapositiveselectionleadingtoBAT1andBAT2retention. CLA34(CENKlBAT1) 90 100 85 aValuesareshownrelativetogrowthrateofthewildtypestrain(0.20h21and Concluding remarks 0.11h21onNH+andaminoacids,respectively);andrepresentthemeans Genetic redundancy is a major feature of virtually all species; 4 fromthreeindependentexperiments(variationwasalways#10%). duplication of functional genes constitutes a source of new or bAminoacidsweresupplementedataconcentrationof150mg/l,100mg/lor specializedfunctionsoftheencodedproteins.Duplicategenesthat 30mg/lofvaline(V),leucine(L)orisoleucine(I)respectively. doi:10.1371/journal.pone.0016099.t003 are retained either provide an increased dosage of the same product or go through a process of subfunctionalization, during which both copies of the gene lose a subset of their ancestral mutant of S. cerevisiae is unable to grow under these conditions functions, whileacquiring newproperties[7,8,18]. suggesting that BCAAs catabolism is compelling. It could be BAT1 and BAT2 retention and acquisition of divergent considered that retention of the two paralogues in S. cerevisiae has expressionprofiles,warrantsaminoacidanda-ketoacidprovision led toefficient VIL degradation. In this regard ithas been found under fermento-respiratory and respiratory conditions. In addi- thatBCAAcatabolismthroughBat1andBat2playsamajorrole tion,distributionofthebiosyntheticandcataboliccharacterofthe in the production of higher alcohols such as isobutanol, active BCATintwoisozymescouldcontributetotheavoidanceoffutile cycles since the independent regulation of each gene determines thepresenceofthepertinentisozymesundereitherbiosyntheticor catabolic physiological conditions. The divergent physiological role played by Bat1 and Bat2 is further enhanced through differential localization; each enzyme is located in the compart- mentinwhichthepertinentsubstratesareproduced.Thefactthat KlBat1ismainlybiosyntheticanditscatabolicroleisonlyexerted whenVILisaddedtothemediumexcludestheoperationoffutile cycles. It has been proposed that the specialization of the GDH1- and GDH3-encodedNADP-dependentglutamatedehydrogenasesand the LYS20-LYS21-encoded homocitrate synthases could result in theformationofhetero-oligomericstructuresshowingbiochemical properties distinct from those displayed by the homo-oligomers, and which could play an important role under certain environ- mental conditions [4,6]. Building up of Gdh1-Gdh3 or Lys20- Lys21 hetero-oligomeric isoforms is possible since both enzymes are located in the same subcellular compartment. For Bat1 and Bat2, constitution of hetero-oligomeric isoforms would be hindered by differential localization. Since in many cases oligomerization domains are conserved in paralogous proteins, differential subcellular localization would avoid hetero-oligomer- ization, preventing the formation of hybrid isozymes whose biologicalactivitycouldbehindered.Thefactthatthebifunctional Figure 6. BAT1 and KlBAT1 expression is repressed under role played by the ancestral-like KlBat1 has been distributed in respiratoryconditions.Northernanalysiswascarriedoutwithtotal Bat1 and Bat2, which could be presumed to be oligomeric RNA samples obtained from S. cerevisiae WT, bat1D BAT2 and BAT1 bat2D and K. lactis WT cultures grown on ammonium-glucose or enzymes [19–21] suggests that for this case, formation of hetero- ammonium-ethanol to mid exponential growth phase. Filters were oligomericformscouldhindertheirbiologicalactivity,underscor- sequentiallyprobedwiththeBAT1,BAT2,KlBAT1-specificPCRproducts ing the role of enzyme relocalization on the functional diversifi- described in experimental procedures and a BamH1-HindIII 1500bp cationof duplicate genes. ACT1 DNA or an SCR1 400bp PCR fragment as loading controls. This study provides an example indicating that the improve- Numbers indicate relative expression as compared to the WT strains ment of the functions carried out by a bifunctional gene product grown on ammonium-glucose. Four biological replicates were per- formed,andrepresentativeresultsareshown. canbeachievedthroughgeneduplicationandfurthersubfunctio- doi:10.1371/journal.pone.0016099.g006 nalizationashasbeenshowntobethecaseforthegeneticswitch PLoSONE | www.plosone.org 10 January2011 | Volume 6 | Issue 1 | e16099

See more

The list of books you might like