Logout succeed
Logout succeed. See you again!

Securing Frame Communication in Browsers PDF
Preview Securing Frame Communication in Browsers
Securing Frame Communication in Browsers AdamBarth CollinJackson JohnC.Mitchell StanfordUniversity StanfordUniversity StanfordUniversity [email protected] [email protected] [email protected] Abstract isolate frames. In more complex mashups, the integra- tordoesintendtocommunicatewiththegadgetsandre- Manywebsitesembedthird-partycontentinframes,re- quiressecureinter-framecommunication. lying on the browser’s security policy to protect them In this paper, we study the contemporary web ver- from malicious content. Frames, however, are often in- sionofarecurringproblemincomputersystems: isolat- sufficientisolationprimitivesbecausemostbrowserslet ing untrusted, or partially trusted, software components framedcontentmanipulateotherframesthroughnaviga- whileprovidingsecureinter-componentcommunication. tion. Weevaluateexistingframenavigationpoliciesand Whenever a site integrates third-party content, such as advocateastricterpolicy,whichwedeployintheopen- anadvertisement,amap,oraphotoalbum,thesiteruns source browsers. In addition to preventing undesirable theriskofincorporatingmaliciouscontent. Withoutiso- interactions,thebrowser’sstrictisolationpolicyalsohin- lation, malicious content can compromise the confiden- ders communication between cooperating frames. We tiality and integrity of the user’s session with the inte- analyze two techniques for inter-frame communication. grator. While the browser’s well-known “same-origin The first method, fragment identifier messaging, pro- policy” [34] restricts script running in one frame from vides confidentiality without authentication, which we manipulatingcontentinanotherframe,thebrowseruses repair using concepts from a well-known network pro- a different policy to determine whether one frame is al- tocol. The second method, postMessage, provides lowedtonavigate(changethelocationof)anotherframe. authentication, but we discover an attack that breaches Althoughrestrictingnavigationisessentialtoproviding confidentiality. We modify the postMessage API to isolation,navigationalsoenablesoneformofinter-frame provide confidentiality and see our modifications stan- communication used in mashup frameworks from lead- dardizedandadoptedinbrowserimplementations. ing companies. Furthermore, we show that an attacker can use frame navigation to attack another inter-frame 1 Introduction communicationmechanism,postMessage. Websitescontaincontentfromsourcesofvaryingtrust- Isolation. We examine the browser frame as an iso- worthiness. Forexample, manywebsitescontainthird- lation primitive. Because frames can contain untrusted partyadvertisingsuppliedbyadvertisementnetworksor content,thebrowser’ssecuritypolicyrestrictsframein- their sub-syndicates [6]. Other common aggregations teractions. Many browsers, however, insufficiently re- of third-party content include Flickr albums [12], Face- strict the ability of one frame to navigate another frame book badges [9], and personalized home pages offered to a new location. These overly permissive frame nav- by the three major web portals [15, 40, 28]. More ad- igation policies lead to a variety of attacks, which we vanced uses of third-party components include Yelp’s demonstrateagainsttheGoogleAdSenseloginpageand useofGoogleMaps[14]todisplayrestaurantlocations theiGooglegadgetaggregator. Topreventtheseattacks, and the Windows Live Contacts gadget [27]. A web we propose tightening the browser’s frame navigation sitecombiningcontentfrommultiplesourcesiscalleda policywhilemaintainingcompatibilitywithexistingweb mashup,withthepartycombiningthecontentcalledthe content. We have collaborated with browser vendors to integratorandintegratedcontentcalledagadget.Insim- deploy this policy in Firefox 3 and Safari 3.1. As the plemashups,theintegratordoesnotintendtocommuni- policyisalreadyimplementedinInternetExplorer7,the catewiththegadgetsandrequiresonlythatthebrowser policyisnowdeployedinthethreemost-usedbrowsers. Confidentiality Authentication NetworkAnalogue Fragmentidentifierchannel (cid:88) PublicKeyEncryption postMessagechannel (cid:88) PublicKeySignatures postMessage(ourproposal) (cid:88) (cid:88) SSL/TLS Table1: Securitypropertiesofframecommunicationchannels Communication. With strong isolation, frames are Organization. Theremainderofthepaperisorganized limitedintheirinteractions,raisingtheissueofhowiso- asfollows.Section2detailsthethreatmodelfortheseat- lated frames can cooperate as part of a mashup. We tacks. Section3surveysexistingframenavigationpoli- analyze two techniques for inter-frame communication: cies and converges browsers on a secure policy. Sec- fragmentidentifiermessagingandpostMessage. The tion 4 analyzes two frame communication mechanisms, resultsofouranalysisaresummarizedinTable1. demonstrates attacks, and proposes defenses. Section 5 describesrelatedwork. Section6concludes. • Fragment identifier messaging uses characteristics of frame navigation to send messages between 2 ThreatModel frames. As it was not designed for communica- tion, the channel has less-than-desirable security Inthispaper,weareconcernedwithsecuringin-browser properties: messages are confidential but senders interactions from malicious attackers. We assume an are not authenticated. To understand these prop- honestuseremploysastandardwebbrowsertoviewcon- erties, we draw an analogy between this commu- tentfromanhonestwebsite.Amalicious“webattacker” nication channel and a network channel in which attemptstodisruptthisinteractionorstealsensitiveinfor- senders encrypt their messages to their recipi- mation. Typically,awebattackerplacesmaliciouscon- ent’s public key. For concreteness, we examine tent(e.g.,JavaScript)intheuser’sbrowserandmodifies the Microsoft.Live.Channels library [27], thestateofthebrowser, interferingwiththehonestses- which uses fragment identifier messaging to let sion.Tostudythebrowser’ssecuritypolicy,whichdeter- the Windows Live Contacts gadget communicate minestheprivilegesoftheattacker’scontent, wedefine with its integrator. The protocol used by Win- thewebattackerthreatmodelbelow. dowsLiveisanalogoustotheNeedham-Schroeder public-key protocol [29]. We discover an attack Web Attacker. A web attacker is a malicious princi- on this protocol, related to Lowe’s anomaly in the palwhoownsoneormoremachinesonthenetwork. In Needham-Schroederprotocol[23],inwhichamali- order to study the security of browsers when rendering cious gadget can impersonate the integrator to the maliciouscontent, weassumethatthebrowsergetsand Contacts gadget. We suggested a solution based renderscontentfromtheattacker’swebsite. onLowe’simprovementtotheNeedham-Schroeder protocol [23], and Microsoft implemented and de- • Network Abilities. The web attacker has no spe- ployedoursuggestionwithindays. cialnetworkabilities.Inparticular,thewebattacker can send and receive network messages only from • postMessage is a new browser API designed for machines under his or her control, possibly acting inter-frame communication [19]. postMessage asaclientorserverinnetworkprotocolsoftheat- isimplementedinOpera,InternetExplorer8,Fire- tacker’schoice. Typically, thewebattackerusesat fox 3, and Safari. Although postMessage has least one machine as an HTTP server, which we beendeployedsince2005,wedemonstrateanattack refer to for simplicity as attacker.com. The on the channel’s confidentiality using frame navi- web attacker can obtain SSL certificates for do- gation. In light of this attack, the postMessage mains he or she owns; certificate authorities such channelprovidesauthenticationbutlacksconfiden- asinstantssl.comprovidesuchcertificatesfor tiality, analogous to a channel in which senders free.Thewebattacker’snetworkabilitiesaredecid- cryptographically sign their messages. To se- edlyweakerthantheusualnetworkattackerconsid- cure the channel, we propose a change to the eredinstudiesofnetworksecuritybecausetheweb postMessageAPI.Weimplementedourchange attackercanneithereavesdroponmessagessentto inpatchesforSafariandFirefox. Ourproposalhas otherrecipientsnorforgemessagesfromothernet- beenadoptedbytheHTML5workinggroup,Inter- worklocations. Forexample,awebattackercannot netExplorer8,Firefox3,andSafari. actasa“man-in-the-middle.” • Interaction with Client. We assume the honest Out-of-ScopeThreats. Althoughphishing[11,7]can userviewsattacker.cominatleastonebrowser be described informally as a “web attack,” the web window, thereby rendering the attacker’s content. attacker defined above does not attempt to fool the We make this assumption because we believe that user by choosing a confusing domain name (such as an honest user’s interaction with an honest site bankofthevvest.com) or using other social engi- should be secure even if the user separately vis- neering. In particular, we do not assume that a user its a malicious site in a different browser window. treats attacker.com as if it were a site other than We assume the web attacker is constrained by the attacker.com. The attacks presented in this paper browser’s security policy and does not employ a are“pixel-perfect”inthesensethatthebrowserprovides browserexploittocircumventthepolicy. Theweb theusernoindicationwhatsoeverthatanattackisunder- attacker’shostprivilegesaredecidedlyweakerthan way. The attacks do not display deceptive images over anattackerwhocanexecuteaarbitrarycodeonthe thebrowsersecurityindicatorsnordotheyspoofthelo- user’smachinewiththeuser’sprivileges.Forexam- cationbarandorthelockicon. Inthispaper,wedonot ple, a web attacker cannot install or run a system- considercross-sitescriptingattacks,inwhichanattacker widekeyloggerorbotnetclient. exploitsabuginanhonestprincipal’swebsitetoinject malicious content into another security origin. None of Attacks accessible to a web attacker have significant the attacks described in this paper rely on the attacker practical impact because the attacks can be mounted injectingcontentintoanotherprincipal’ssecurityorigin. withoutanycomplexorunusualcontrolofthenetwork. Instead,wefocusonprivilegesthebrowseritselfaffords Inaddition,webattackscanbecarriedoutbyastandard theattackertointeractwithhonestsites. man-in-the-middle network attacker, provided the user visits a single HTTP site, because a man-in-the-middle caninterceptHTTPrequestsandinjectmaliciouscontent 3 FrameIsolation intothereply,simulatingareplyfromattacker.com. There are several techniques an attacker can use to NetscapeNavigator2.0introducedtheHTML<frame> drive traffic to attacker.com. For example, an at- element,whichallowswebauthorstodelegateaportion tacker can place web advertisements, display popular of their document’s screen real estate to another doc- contentindexedbysearchengines,orsendbulke-mailto ument. These frames can be navigated independently attractusers. Typically,simplyviewinganattacker’sad- of the rest of the main content frame and can, them- vertisement lets the attacker mount a web-based attack. selves,containframes,furtherdelegatingscreenreales- Inapreviousstudy[20], wepurchasedover50,000im- tateandcreatingaframehierarchy. Mostmodernframes pressions for $30. During each of these impressions, a are embedded using the more-flexible <iframe> ele- user’sbrowserrenderedourcontent,givingustheaccess ment,introducedinInternetExplorer3.0. Inthispaper, requiredtomountawebattack. we use the term frame to refer to both <frame> and We believe that a normal, but careful, web user who <iframe> elements. The main, or top-level, frame of reads news and conducts banking, investment, and re- a browser window displays its location in the browser’s tailtransactions,cannoteffectivelymonitororrestrictthe locationbar. Subframesareoftenindistinguishablefrom provenienceofallcontentrenderedinhisorherbrowser, other parts of a page, and the browser does not display especiallyinlightofthird-partyadvertisements. Inother their location in its user interface. Browsers decorate a words,webelievethatthewebattackerthreatmodelisan window with a lock icon only if every frame contained accurate representation of normal web behavior, appro- inthewindowwasretrievedoverHTTPSbutdonot re- priate for security analysis of browser security, and not quiretheframestobeservedfromthesamehost.Forex- anassumptionthatuserspromiscuouslyvisitallpossible ample,ifhttps://bank.com/embedsaframefrom badsitesinordertotemptfate. https://attacker.com/, the browser will deco- ratethewindowwithalockicon. GadgetAttacker. Agadgetattackerisawebattacker withoneadditionalability: theintegratorembedsagad- Organization. Section 3.1 reviews browser security getoftheattacker’schoice. Thisassumptionletsusac- policies. Section 3.2 describes cross-window frame curately evaluate mashup isolation and communication navigation attacks and defenses. Section 3.3 details protocolsbecausethepurposeoftheseprotocolsistolet same-windowattacksthatarenotimpededbythecross- anintegratorembeduntrustedgadgetssafely.Inpractice, window defenses. Section 3.4 analyzes stricter naviga- agadgetattackercaneitherwaitfortheusertovisitthe tionpoliciesandadvocatesthe“descendantpolicy.”Sec- integratororcanredirecttheusertotheintegrator’sweb tion3.5documentsourimplementationanddeployment sitefromattacker.com. ofthedescendantpolicyinmajorbrowsers. 3.1 Background Top-level Frames. Top-level frames are often exempt from the restrictions imposed by the browser’s frame ScriptingPolicy. Mostwebsecurityisfocusedonthe navigation policy. Top-level frames are less vulnerable browser’s scripting policy, which answers the question toframenavigationattacksbecausethebrowserdisplays “whenisscriptinoneframepermittedtomanipulatethe their location in the location bar. Internet Explorer and contents of another frame?” The scripting policy is the Safari do not restrict the navigation of top-level frames mostimportantbrowsersecuritypolicybecausetheabil- atall. Firefoxrestrictsthenavigationoftop-levelframes ity to script another frame is the ability to control its basedontheiropeners,butthisrestrictioncanbecircum- appearance and behavior completely. For example, if vented [2]. Opera implements a number of restrictions otherWindowisanotherwindow’sframe, on the navigation of top-level frames based on the cur- rentlocationoftheframe. var stolenPassword = otherWindow.document.forms[0]. 3.2 Cross-WindowAttacks password.value; In 1999, Georgi Guninski discovered that the permis- attempts to steal the user’s password in the other win- siveframenavigationpolicyadmitsseriousattacks[16]. dow. Modern web browsers permit one frame to read Guninski discovered that, at the time, the password andwritealltheDOMpropertiesofanotherframeonly field on the CitiBank login page was contained within when their content was retrieved from the same ori- aframe. Becausethepermissiveframenavigationpolicy gin, i.e. when the scheme, host, and port number of lets any frame navigate any other frame, a web attacker theirlocationsmatch. IfthecontentofotherWindow can navigate the password frame on CitiBank’s page was retrieved from a different origin, the browser’s se- to https://attacker.com/, replacing the frame curity policy will prevent this script from accessing withidentical-lookingcontentthatsendstheuser’spass- otherWindow.document. word to attacker.com. In the modern web, this cross-windowattackmightproceedasfollows: Navigation Policy. Every browser must answer the 1. TheuserreadsapopularblogthatdisplaysaFlash question “when is one frame permitted to navigate an- advertisementprovidedbyattacker.com. other frame?” Prior to 1999, all web browsers imple- mentedapermissivepolicy: 2. The user opens a new window to bank.com, whichdisplaysitspasswordfieldinaframe. PermissivePolicy 3. The malicious advertisement navigates the pass- Aframecannavigateanyotherframe. wordframetohttps://attacker.com/. The locationbarstillreadsbank.comandthelockicon Forexample,ifotherWindowincludesaframe, isnotremoved. otherWindow.frames[0].location = 4. The user enters his or her password, which is then "https://attacker.com/"; submittedtoattacker.com. navigates the frame to https://attacker.com/. Of thebrowsers inheavy use today, Internet Explorer6 This has the effect of replacing the frame’s docu- and Safari 3 both implement the permissive policy. In- ment with content retrieved from that URL. Under ternet Explorer 7 and Firefox 2 implement stricter poli- the permissive policy, this navigation succeeds even if cies(describedinsubsequentsections). However,Flash otherWindowcontainscontentfromadifferentsecu- Playercanbeusedtocircumventthestricternavigation rityorigin. Thereareanumberofotheridiomsfornavi- policy of Internet Explorer 7, effectively reducing the gatingframes,including policyto“permissive.” Manywebsitesarevulnerableto this attack, including Google AdSense, which displays itspasswordfieldinsideaframe;seeFigure1. window.open("https://attacker.com/", "frameName"); Window Policy. In response to Guninski’s report, whichrequeststhatthebrowsersearchforaframenamed Mozillaimplementedastricterpolicyin2001: frameName and navigate the frame to the specified URL.Framenamesexistinaglobalnamespaceandare WindowPolicy notrestrictedtoasinglesecurityorigin. Aframecannavigateonlyframesinitswindow. Figure1: Cross-WindowAttack: Theattackercontrolsthepasswordfieldbecauseitiscontainedwithinaframe. Thispolicypreventsthecross-windowattackbecausethe Microsoft,inexchangeformoney. Mostadvertise- web attacker does not control a frame in the same win- ments,includingGoogleAdWords,arecontainedin dowastheCitiBankortheGoogleAdSenseloginpage. frames,bothtopreventtheadvertisers(whoprovide Without a foothold in the window, the attacker cannot the gadgets) from interfering with the publisher’s navigatetheloginframetoattacker.com. siteandtopreventpreventthepublisherfromusing JavaScripttoclickontheadvertisements. 3.3 Same-WindowAttacks We refer to aggregators and advertisements as simple The window frame navigation policy is neither univer- mashupsbecausethesemashupsdonotinvolvecommu- sally deployed nor sufficiently strict to protect users on nicationbetweenthegadgetsandtheintegrator. Simple themodernwebbecausemashupsviolateitsimplicitse- mashupsrelyonthebrowsertoprovideisolationbutdo curityassumptionthatanhonestprincipalwillnotembed notrequireinter-framecommunication. aframetoadishonestprincipal. Gadget Hijacking Attacks. Mashups invalidate an Mashups. A mashup combines content from multiple implicit assumption of the window policy, that an hon- sources to create a single user experience. The party estprincipalwillnotembedaframetoadishonestprin- combining the content is called the integrator and the cipal. A gadget attacker, however, does control a frame integratedcontentiscalledagadget. embedded by the honest integrator, giving the attacker • Aggregators. Gadget aggregators, such as the foothold required to mount a gadget hijacking at- iGoogle [15], My Yahoo [40], and Win- tack [22]. In such an attack, a malicious gadget navi- dows Live [28], are one form of mashup. These gatesatargetgadgettoattacker.comandimperson- sites let users customize their experience by se- atesthegadgettotheuser. lecting gadgets (such as stock tickers, weather • AggregatorVulnerabilities. iGoogleisvulnerable predictions, news feeds, etc) to include on their to gadget hijacking in browsers, such as Firefox 2, homepage.Thirdpartiesareencouragedtodevelop that implement the permissive or window policies; gadgets for the aggregator. These mashups embed see Figure 2. Consider, for example, one popu- the selected gadgets in a frame and rely on the lar iGoogle gadget that lets users access their Hot- browser’s frame isolation to protect users from mail inbox. (This gadget is neither provided nor maliciousgadgets. endorsed by Microsoft.) If the user is not logged • Advertisements. Webadvertisingisasimpleform intoHotmail,thegadgetrequeststheuser’sHotmail of mashup, combining first-party content, such as password. AmaliciousgadgetcanreplacetheHot- newsarticlesorsportsstatistics,withthird-partyad- mailgadgetwithcontentthataskstheuserforhisor vertisements. Typically, the publisher (the integra- herHotmailpassword. Asinthecross-windowat- tor)delegatesaportionofitsscreenrealestatetoan tack,theuserisunabletodistinguishthemalicious advertisement network, such as Google, Yahoo, or passwordfieldfromthehonestpasswordfield. (a) Before (b) After Figure2: GadgetHijackingAttack. Underthewindowpolicy,theattackergadgetcannavigatetheothergadgets. • AdvertisementVulnerabilities. Althoughtextad- Pixel Delegation. The descendant policy provides the vertisements often do not contain active content most attractive trade-off between security and compat- (e.g., JavaScript), other forms of advertising, such ibility because it is the least restrictive policy that re- as Flash advertisements, do contain active content. spectspixeldelegation.Whenoneframeembedsanother An attacker who provides such an advertisement frame, theparentframedelegatesaregionofthescreen can steal advertising impressions allotted to other tothechildframe. Thebrowserpreventsthechildframe advertisers via gadget hijacking. A malicious ad- from drawing outside of its bounding box but does al- vertisement can traverse the page’s frame hierar- low the parent frame to draw over the child using the chyandnavigateframescontainingotheradvertise- position: absolutestyle. Thedescendantpolicy ments to attacker.com, replacing the existing permitsaframetonavigateatargetframepreciselywhen contentwiththeattacker’sadvertisement. theframecouldoverwritethescreenrealestateofthetar- get frame. Although the child policy is stricter than the 3.4 StricterPolicies descendantpolicy,theadditionalstrictnessdoesnotpre- vent many additional attacks because a frame can sim- Althoughbrowservendorsdonotdocumenttheirnaviga- ulatethevisualeffectsofnavigatingagrandchildframe tionpolicies,wewereabletoreverseengineeredthenav- by drawing over the region of the screen occupied by igation policies of existing browsers, and we confirmed thegrandchildframe. Thechildpolicy’saddedstrictness our understanding with the browsers’ developers. The does,however,reducethepolicy’scompatibilitywithex- existing policies are shown in Table 2. In addition to isting sites, discouraging browser vendors from deploy- thepermissiveandwindowpoliciesdescribedabove,we ingthechildpolicy. discoveredtwootherframenavigationpolicies: DescendantPolicy OriginPropagation. Astrictinterpretationofthede- Aframecannavigateonlyitsdescendants. scendantpolicypreventsaframefromnavigatingitssib- lings, eveniftheframeisfromthesamesecurityorigin ChildPolicy asitsparent. Inthissituation,theframecannavigateits Aframecannavigateonlyitsdirectchildren. siblingindirectlybyinjectingscriptintoitsparent,which canthennavigatethesiblingbecausethesiblingisade- TheInternetExplorer6teamwantedtoenablethechild scendantoftheparentframe.Ingeneral,browsersshould policy by default, but shipped the permissive policy be- decidewhetherornottopermitanavigationbasedonthe cause the child policy was incompatible with a large activeframe’ssecurityorigin.Browsersshouldletanac- number of web sites. The Internet Explorer 7 team de- tiveframenavigateatargetframeifthereexistsaframe signed the descendant policy to balance the security re- in the same security origin as the active frame that has quirement to defeat the cross-window attack with the thetargetframeasadescendant.Byrecognizingthisori- compatibilityrequirementtosupportexistingsites[33]. ginpropagation,browserscanachieveabettertrade-off betweensecurityandcompatibly. Theseadditionalnavi- • Frame. Inthe frameversionof thegadget, thein- gationsdonotsacrificesecuritybecauseanattackercan tegrator embeds a frame to maps.google.com, perform the navigations indirectly, but allowing them is whichGooglefillswithamapcenteredatthespeci- moreconvenientforhonestwebdevelopers. fied location. The user can interact with map, but the integrator is oblivious to this interaction and cannotinteractwiththemapdirectly. 3.5 Deployment • Script. In the script version of the gadget, the We collaborated with the HTML 5 working group [18] integrator embeds a <script> tag that executes andbrowservendorstodeploythedescendantpolicyin JavaScriptfrommaps.google.com. Thisscript severalbrowsers: createsarichJavaScriptAPItheintegratorcanuse • Safari. We implemented the descendant policy as tointeractwiththemap,butthescriptrunswithall a patch for Safari. Apple accepted our patch and oftheintegrator’sprivileges. deployed the descendant policy to Mac OS X and WindowsSafariusersasasecurityupdate[30].Ap- Yelp. Yelp is a popular review web site that uses the ple also deployed our patch to all iPhone and iPod Google Maps gadget to display the locations of restau- touchusers. rants and other businesses it reviews. Yelp requires a high degree of interactivity with the Maps gadget be- • Firefox. Weimplementedthedescendantpolicyas cause it places markers on the map for each restaurant a patch for Firefox. Before accepting our patch, anddisplaystherestaurant’sreviewwhentheuserclicks Mozilla requested tests for all their previous frame on the marker. In order to deliver these advanced fea- navigationregressions. Weprovidedthemwithap- tures,YelpmustusethescriptversionoftheMapsgad- proximately 1000 lines of regression tests for their get.ThisdesignrequiresYelptotrustGoogleMapscom- automatic test harness, covering the frame naviga- pletely because Google’s script runs with Yelp’s priv- tionsecurityvulnerabilitiesfromthepasttenyears. ileges in the user’s browser, granting Google the abil- Mozilla accepted our patch and deployed the de- ity to manipulate Yelp’s reviews and steal Yelp’s cus- scendantpolicyinFirefox3[1]. tomer’s information. Although Google might be trust- • Flash. WereportedtoAdobethatFlashPlayerby- worthy,thescriptapproachdoesnotscalebeyondhighly passesthedescendantpolicyinInternetExplorer7. respectedgadgetproviders. Secureinter-framecommu- AdobeagreedtoshipapatchtoallInternetExplorer nicationprovidesthebestofbothalternatives: Yelp(and usersintheirnextsecurityupdate. similarsites)canrealizetheinteractivityofthescriptver- sionofGoogleMapsgadgetwhilemaintainingthesecu- • Opera.WenotifiedOperaSoftwareaboutinconsis- rityoftheframeversionofthegadget. tencies in Opera’s child policy that can be used in gadgethijackingattacks. Theyplantofixthesevul- 4.1 TheFragmentIdentifierChannel nerabilities in the upcoming release of Opera 9.5, and are evaluating the compatibility benefits of Although the browser’s scripting policy isolates frames adoptingthedescendantpolicy[35]. fromdifferentsecurityorigins,clevermashupdesigners havediscoveredanunintendedchannelbetweenframes: 4 FrameCommunication the fragment identifier channel [3, 36]. This channel is regulatedbythebrowser’sless-restrictiveframenaviga- Over the past few years, web developers have built so- tionpolicy. This“found”technologyletsmashupdevel- phisticatedmashupsthat,unlikesimpleaggregatorsand opersplaceeachgadgetinaseparateframeandrelyon advertisements, are comprised of gadgets that commu- the browser’s security policy to prevent malicious gad- nicate with each other and with their integrator. Yelp, getsfromattackingtheintegratorandhonestgadgets. whichintegratestheGoogleMapsgadget,motivatesthe need for secure inter-frame communication by illustrat- Mechanism. Normally, when a frame is navigated to ing how communicating gadgets are used in real de- a new URL, the browser retrieves the URL from the ployments. Sections 4.1 and 4.2 analyze and improve network and replaces the frame’s document with the fragment-identifiermessagingandpostMessage. retrieved content. However, if the new URL differ- ent from the old URL only in the fragment (the por- GoogleMaps. OnepopulargadgetistheGoogleMaps tion after the #), then the browser does not reload API[14]. Googleprovidestwomechanismsforintegrat- the frame. If frames[0] is currently located at ingGoogleMaps: http://example.com/doc, IE6(default) IE6(optional) IE7(default) IE7(optional) Firefox2 Safari3 Opera9 Permissive Child Descendant Permissive Window Permissive Child Table2: Framenavigationpoliciesdeployedinexistingbrowsers. frames[0].location = 1. Thepublic-keychannelissusceptibletotrafficanal- "http://example.com/doc#message"; ysis,butanattackercannotdeterminethelengthof amessagesentoverthefragmentidentifierchannel. changestheframe’slocationwithoutreloadingtheframe An attacker can extract timing information by fre- or destroying its JavaScript context. The frame can ob- quentlypollingthebrowser’sclock,butobtaininga serve the value of the fragment by periodically polling high-resolutiontimingsignalsignificantlydegrades window.location.hash to see if the fragment thebrowser’sperformance. identifier has changed. This technique can be used to 2. The fragment identifier channel is constrained by send short string messages entirely within the browser, thebrowser’sframenavigationpolicy. Inprinciple, avoidingnetworklatency. However,thecommunication thiscouldbeusedtoconstructprotocolssecurefor channel is somewhat unreliable because, if two naviga- thefragmentidentifierchannelthatareinsecurefor tionsoccurbetweenpolls,thefirstmessagewillbelost. the public-key channel (by preventing the attacker from navigating the recipient), but in practice this Security Properties. Because it was “found” and not restriction has not prevented us from constructing designed, the fragment identifier channel has less-than- attacksonexistingprotocolimplementations. idealsecurityproperties. Thebrowser’sscriptingpolicy Despite these differences, we find the network analogy preventssecurityoriginsotherthantheoneprecedingthe usefulinanalyzinginter-framecommunication. #fromeavesdroppingonmessagesbecausetheyareun- able to read the frame’s location (even though the nav- igation policy permits them to write to the frame’s lo- Windows Live Channels. Microsoft uses the frag- cation). Browsersalsopreventarbitrarysecurityorigins ment identifier channel in its Windows Live plat- from tampering with portions of messages. Other secu- form library to implement a higher-level channel API, rity origins can, however, overwrite the fragment iden- Microsoft.Live.Channels [36]. The Windows tifier in its entirety, leaving the recipient to guess the LiveContactsgadgetusesthisAPItocommunicatewith senderofeachmessage. its integrator. The integrator can instruct the gadget to To understand these security properties, we develop addorremovecontactsfromtheuser’scontactslist,and ananalogywithwell-knownpropertiesofnetworkchan- thegadgetcansendtheintegratordetailsabouttheuser’s nels. Weviewthebrowserasguaranteeingthatthefrag- contacts. Whenevertheintegratorasksthegadgettoper- ment identifier channel has confidentiality: a message formasensitiveaction, thegadgetaskstheusertocon- canbereadonlybyitsintendedrecipient. Thefragment firmtheoperationanddisplaystheintegrator’shostname identifierchannelfailstobeasecurechannelbecauseit toaidtheuserinmakingtrustdecisions. lacks authentication, the ability of the recipient to un- Microsoft.Live.Channelsattemptstobuilda ambiguously determine the sender of a message. The securechanneloverthefragmentidentifierchannel. By channelalsofailstobereliablebecausemessagesmight reverse engineering the implementation, we determined notbedelivered,andtheattackermightbeabletoreplay thatitusestwosessionsofthefollowingprotocol(onein previousmessagesusingthebrowser’shistoryAPI. eachdirection)toestablishasecurechannel: Thesecuritypropertiesofthefragmentidentifierchan- A→B :N ,URI nel are analogous to a channel on an untrusted network A A secured by a public-key cryptosystem in which each B →A:NA,NB messageisencryptedwiththepublickeyofitsintended A→B :N ,Message B 1 recipient. Inbothcases,ifAlicesendsamessagetoBob, no one except Bob learns the contents of the message In this notation, A and B are frames, N and N are A B (unlessBobforwardsthemessage). Inbothsettings,the fresh nonces (numbers chosen at random during each channeldoesnot provideareliableprocedurefordeter- run of the protocol), and URI is the location of A’s A mining who sent a given message. There are two inter- frame. Under the network analogy described above, estingdifferencesbetweenthefragmentidentifierchan- this protocol is analogous to a variant of the classic nelandthepublic-keychannel: Needham-Schroeder key-establishment protocol [29]. SMash and OpenAjax 1.1. A recent paper [22] from IBMproposedanotherprotocolforestablishingasecure channel over the fragment identifier channel. They de- scribetheirprotocolasfollows: The SMash library in the mashup applica- tioncreatesthesecret,anunguessablerandom value. When creating the component, it in- cludes the secret in the fragment of the com- ponentURL.Whenthecomponentcreatesthe tunnel iframe it passes the secret in the same manner. TheSMashdevelopershavecontributedtheircodetothe OpenAjaxproject,whichplanstoincludetheirfragment identifier protocol in version 1.1. The SMash protocol canbeunderstoodasfollows: Figure3: LoweAnomaly: ThisWindowsLiveContacts gadget received a message that appeared to come from A→B :N,URI A integrator.com,butinrealitytherequestwasmade B →A:N byattacker.com. A→B :N,Message 1 Thisprotocoladmitsthefollowingsimpleattack: TheNeedham-Schroederprotocolwasdesignedtoestab- Attacker→Gadget:N,URI lishasharedsecretbetweentwopartiesoveraninsecure I channel. IntheNeedham-Schroederprotocol,eachmes- Gadget→Integrator:N sageisencryptedwiththepublickeyofitsintendedre- Attacker→Gadget:N,Message cipient.TheWindowsLiveprotocoldoesnotemployen- cryptionbecausethefragmentidentifierchannelalready We have confirmed this attack by implementing the at- providestherequiredconfidentiality. tack against the SMash implementation. Additionally, The Needham-Schroeder protocol has a well-known the attacker is able to conduct this attack covertly by anomaly, due to Lowe [23], which leads to an attack in blocking the message from the gadget to the integrator thebrowsersetting.IntheLowescenario,anhonestprin- becausethemessagewaitsfortheloadeventtofire. cipal,Alice,initiatestheprotocolwithadishonestparty, Eve. EvethenconvinceshonestBobthatsheisAlice. In SecureFragmentMessaging. Thefragmentidentifier order to exploit the Lowe anomaly, an honest principal channelcanbesecuredusingavariantoftheNeedham- must be willing to initiate the protocol with a dishonest Schroeder-Loweprotocol[23]. ThemainideainLowe’s principal. This requirement is met in mashups because improvementoftheNeedham-Schroederprotocolisthat the integrator initiates the protocol with the gadget at- the responder must include his identity in the second tacker’sgadgetinordertoestablishachannel.TheLowe messageoftheprotocol,lettingthehonestinitiatordeter- anomalycanbeexploitedtoimpersonatetheintegratorto minethatanattackisinprogressandaborttheprotocol. theWindowsLiveContactsgadgetasfollows: A→B :N ,URI A A Integrator→Attacker:N ,URI I I B →A:N ,N ,URI A B B Attacker→Gadget:N ,URI I I A→B :N B Gadget→Integrator:N ,N I G ... Integrator→Attacker:N ,Message G 1 A→B :N ,N ,Message A B i Afterthesefourmessages,theattackerpossessesNI and B →A:NA,NB,Messagej N and can impersonate the integrator to the gadget. G Wehavesuccessfullyimplementedthisattackagainstthe We contacted Microsoft, IBM, and the OpenA- Windows Live Contacts gadget. The issue is easily ob- JAX Alliance about the vulnerabilities in their frag- servablefortheContactsgadgetbecausethegadgetdis- ment identifier messaging protocols and suggested playstheintegrator’shostnametotheuserinitssecurity the above protocol improvement. Microsoft adopted userinterface;seeFigure3. our suggestions and deployed a patched version of IAn(cid:425)teagcrkaetror IAn(cid:425)teagcrkaetror source.postMessage(secret) source.postMessage(secret) IAn(cid:425)teagcrkaetror IAn(cid:425)teagcrkaetror postMessage(secret) postMessage(secret) GAG(cid:425)aaddaggckeeettr GAGA(cid:425)(cid:425)aaddaaggcckkeeeettrr top.postMessage(msg) top.postMessage(msg) (a) Integratorsendssecretmessagestochild (b) Attackerhijacksintegrator’schild Figure4: RecursiveMashupAttack Microsoft.Live.Channels and of the Windows the origin property accurately identifies the sender; LiveContactsgadget. IBMadoptedoursuggestionsand with cryptographic signatures, verifying the signature revised their SMash paper. The OpenAJAX Alliance on a message accurately identifies the signer of the adoptedoursuggestionsandupdatedtheircodebase. All message. One difference between the channels is that three now use the above protocol to establish a secure cryptographic signatures can be easily replayed, but the channelusingfragmentidentifiers. postMessagechannelisresistanttoreplayattacks. In somecases,however,anattackermightbeabletomount areplayattackbyreloadinghonestframes. 4.2 ThepostMessageChannel HTML 5 [19] specifies a new browser API for asyn- Attacks. AlthoughpostMessageiswidelybelieved chronous communication between frames. Unlike the to provide a secure channel between frames, we show fragment identifier channel, the postMessage chan- an attack on the confidentiality of the channel. A mes- nel was designed for cross-site communication. The sagesentwithpostMessageisdirectedataframe,but postMessage API was originally implemented in iftheattackernavigatesthatframetoattacker.com Opera 8 and is now supported by Internet Explorer 8, beforethemessageeventisgenerated,theattackerwill Firefox3[37],andSafari[24]. receivethemessageinsteadoftheintendedrecipient. • Recursive Mashup Attack. Suppose, for exam- Mechanism. Tosendamessagetoanotherframe, the ple, that an integrator embeds a frame to a gadget sendercallsthepostMessagemethod: and then calls postMessage on that frame. The attacker can load the integrator inside a frame and frames[0].postMessage("Hello world."); carryoutanattackwithoutviolatingthedescendant The browser then generates a message event in the framenavigationpolicy.Aftertheattackerloadsthe recipient’s frame that contains the message, the ori- integratorinsideaframe,theattackernavigatesthe gin (scheme, port, and domain) of the sender, and a gadgetframetoattacker.com. Then,whenthe JavaScriptpointertotheframethatsentthemessage. integrator calls postMessage on the “gadget’s” frame, the browser delivers the message to the at- tacker whose content now occupies the “gadget’s” Security Properties. The postMessage channel frame;seeFigure4. Theintegratorcanpreventthis guarantees authentication, messages accurately identify attackby“framebusting,”i.e.,byrefusingtorender theirsenders,butthechannellacksconfidentiality.Thus, themashupiftop !== self,indicatingthatthe postMessagehasalmostthe“opposite”securityprop- integratoriscontainedinaframe. ertiesasthefragmentidentifierchannel. Wherethefrag- ment identifier channel has confidentiality without au- • Reply Attack. Another postMessage idiom is thentication, the postMessage channel has authenti- alsovulnerabletointerception,evenunderthechild cation without confidentiality. The security properties framenavigationpolicy: ofthepostMessagechannelareanalogoustoachan- nel on a untrusted network secured by an existentially window.onmessage = function(e) { unforgeable signature scheme. In both cases, if Alice if (e.origin == "https://b.com") sends a message to Bob, Bob can determine unambigu- e.source.postMessage(secret); ouslythatAlicesentthemessage.WithpostMessage, };