Logout succeed
Logout succeed. See you again!

Self-Consistent Field Theory of Multiply-Branched Block Copolymer Melts PDF
Preview Self-Consistent Field Theory of Multiply-Branched Block Copolymer Melts
Self-Consistent Field Theory of Multiply-Branched Block Copolymer Melts Gregory M. Grason and Randall D. Kamien Department of Physics and Astronomy, University of Pennsylvania, Philadelphia, PA 19104-6396, USA (Dated: February 2, 2008) Wepresentanumericalalgorithmtoevaluatetheself-consistentfieldtheoryformeltscomposedof block copolymers with multiply-branchedarchitecture. We present results for thecase of branched 5 copolymers with doubly-functional groups for multiple branching generations. We discuss the sta- 0 bility of the cubic phase of spherical micelles, the A15 phase, as a consequence of tendency of the 0 ABinterfaces to conform to thepolyhedral environment of theVoronoi cell of the micelle lattice. 2 n I. INTRODUCTION a J 8 Block copolymers provide an ideal route to engineer- 1 ing well-controlled structure on nanometer length scales [1, 2]. Through control over the chemical architecture, ] t thesesystemscanbetunedtoself-assembleintoperiodic f o structures of an astounding variety. A plethora of new s phases and structures have been identified in dilute di- . t block systems [3, 4], triblock systems [5], and confined a diblocks[6]. Onemightthinkthereishardlymoretosay m about melts of the simplest of block copolymer architec- - tures, the neat linear AB diblock copolymer. It is well d n knownthattheselineardiblockcopolymersdisplayahost o oforderedphases: spheres,cylinders,lamellaandthebi- c continuous gyroid [7]. However, we have argued [8, 9] [ that the tendency to minimize the AB interfacial area 1 shouldstabilizeanewcubicphasewithPm3nsymmetry, v theA15lattice. Thesubsequentsynthesisandcharacteri- 4 zationofPEO-docosyldendrimericdiblockscorroborated 0 our prediction [10] and was in agreement with the self- FIG. 1: A schematic of the branched molecular architecture. 4 consistent field theory (SCFT) phase diagram for mik- The first generation A-block contains fN segments. Each 1 0 toarm star copolymers [8]. In this article, we provide higher generation B-block is composed of (1−f)N/NB seg- 5 the details of SCFT for branched architectures and, to ments. Here, the branching of each generation is 2. In the 0 our knowledge, the first SCFT phase diagrams for true, mean-fieldapproximation,itisnecessarytodefineonlyasin- th / multiply-branched dendritic diblock copolymers. gle coordinate, sα, for the set of branching points of the α t generation. a The serial development of new chemical synthesis m routes is typically a costly and slow means for exploring - the consequences of novel copolymer architectures. It is d oped a more refined self-consistent brush analysis for n thereforedesirabletodeveloptheoreticaltoolsfortheeffi- dendritic copolymer melts [14]. Both works showed a o cientcomputationthe phasebehaviorwhichcansystem- c atically mapout novelphase properties for a broadclass similar increase in stability of high interface curvature : phases. Despite the analytic transparency of these SST v copolymer architectures. Milner and Olmsted developed calculations, the results of these calculations are predi- i astrong-segregationtheory(SST)approachtothephase X catedonmany assumptions aboutthe detailed structure behaviorofA B miktoarmstarcopolymermelts,appli- n m r cableintheχN limit,whereχistheFlory-Huggins ofthemicellaraggregates. Inparticular,certainassump- a →∞ tions must be made concerning the interfacialshape and immiscibility parameter and N is the total number of the direction in which copolymer chains stretch in the chemical segments in the copolymer [11, 12]. For asym- aggregates [8, 12]. Because the free energy differences metric copolymers, say for n > m, the effective spring constant of the more abundant polymer block is n2/m2 between phases are small, the presence of these undeter- mined degrees of freedom makes the task of locating the times morestiffthanotherblock. Suchasymmetryleads true free energy ground state analytically cumbersome, an enhanced stability of phases with strong interfacial if not impossible. curvature, and thus, spherical and cylindrical micelles are predicted to dominate the phase behavior for large In Section II we present the theoretical derivation of molecularasymmetry[11]. FredricksonandFrischknecht the SCFT for multiply-branched copolymer melts from introduced an approximate SST approach to multiply- the full classical partition function of this system. We branched dendritic copolymers [13], and Pickett devel- present an algorithm for the SCFT of block copolymers 2 withina specific classofmultiply-branchedarchitectures within any chain portion of length ∆s there are (∆s)N (see Figure 1). Like the SCFT approaches of Matsen segments. Thus, in these coordinates, the length of the andSchick forlinear AB diblock copolymers[15]andfor A block is given by ∆s = f and that of the B sections A (AB) starblock copolymers [16], this approach makes is given by ∆s =(1 f)/ . n B B − N no approximation beyond the approximation of mean- A particular melt configuration is specified by n field in the monomer concentration profile. Therefore, branched curves in space, r (s), the course-grained po- β this SCFT fully captures the copolymer chain fluctua- sition of the (sN)th segment of the βth chain. At this tions in the presence of the averageconcentrationprofile point, we do not introduce an explicit parameterization of constituent monomers. Moreover, this approach effi- of the full branched configuration. It suffices to demand ciently minimizes over all possible copolymer configura- thatthefirstgenerationcurveisjoinedtoη secondgen- 2 tions,precludingthevariationalassumptionsoftenneces- eration curves which are each joined to η third curves, 3 saryin the SST calculations. Finally, a numericalimple- etc.. Given this set of branched curves, we define the mentation of SCFT is not limited to the infinite χN pa- dimensionless segment density operators, rameterrange. Givenanarbitraryamountof computing time the equilibrium phase canbe determined for any fi- N n 1 φˆ (r) ds γ(s) δ(r r (s)) , (2) nitevalueofχN. Practically,SCFTprovidesanefficient A ≡ ρ − β means of computing the mean field free energy of most 0 βX=1Z0 phases for χN < 100 [17]. In Section III we present the results ofan ap∼plicationofSCFT to a series ofbranched N n 1 copolymer melts within a specific class of this structural φˆ (r) ds (1 γ(s)) δ(r r (s)) , (3) B β ≡ ρ − − motif, specifically,copolymerswhichbranchdoublywith 0 β=1Z0 X each successive generation. We discuss these results in context of elastically asymmetric copolymer melts and where γ(s) is a function which is equal to 1 when s lies the geometry of the AB interface. We conclude in Sec- along an A portion of the chain and 0 when s is along a tion IV. B portion of the chain, and the integration range is over the entire branchedcurve. In a neat system, the allowed melt configurations are incompressible, and thus we are II. SELF-CONSISTENT FIELD THEORY FOR constrained to consider configurations for which BRANCHED ARCHITECTURES φˆ (r)+φˆ (r)=1 . (4) A B Our approach to multiply-branched diblocks is an ex- Thefullpartitionfunctionforthemeltisthefunctional tension of the SCFT approach to linear diblocks and integral over n branched curves: starblock copolymers pioneered by Matsen and Schick [15, 16]. While the derivation of the mean-field free en- n 1 ergy for the mulitply-branched system follows directly = [dr ] δ[1 φˆ (r) φˆ (r)] β A B from the results for the linear and starblock architec- Z n! − − Z β=1 tures, we present its full derivation here since the sub- Y sequent evaluation of that free energy requires a slightly exp 3 1ds γ(s)+κ2(1 γ(s)) r˙ (s)2 moregeneralizedapproach. Nevertheless,wherepossible, × (− 2Na2 Z0 (cid:20) − (cid:21)| β | we attempt to keep the notation consistent with theirs. We considerasystemoftotalvolume,V, containingn χρ dr φˆ (r)φˆ (r) , (5) 0 A B branched copolymers. These copolymers are each com- − ) Z posed of N total segments. Without loss of generality, we define the segment volume for both monomer type where a normalization factor is absorbed into the func- to be ρ−1, so that the total volume of the system is tional measure, [dr ], r˙(s) = dr(s)/ds, κ a /a mea- 0 β ≡ A B V = nN. The statistical segment lengths for the A and sures the relative length of the A and B segments, and ρ0 B-typemonomersaredenotedbyaAandaB. Thevolume a ≡ aA. The Flory-Huggins parameter, χ, characterizes fraction of A-type monomer in the system is denoted by the repulsive interaction between unlike monomers. f. Thus,eachchainiscomposedoffN A-type segments We can use the identity [dΦA,B] δ[ΦA,B(r) − and (1 f)N B-type segments. The architecture of our φˆ (r)] = 1 to transform (5) into a functional integral − A,B R molecule is shown in Figure 1. The first generation is overthemonomerdistributions. Introducingfieldsconju- a single A-block. Grafted onto this are (g 1) genera- gate to the total and individual segment concentrations, − tions of equallength B-blocks. The branching of the αth we have explicit representations of the delta-functionals, generation is given by η so that the total number of B α blocks, NB, is given by, δ[1−φˆA(r)−φˆB(r)]= NB =η2(1+η3(1+η4(...(1+ηg−1(1+ηg))...) . (1) [dΞ] exp ρ0 dr Ξ(r)[1 φˆ (r) φˆ (r)] , (6) A B We define a coordinate along the polymer, s, so that Z (N Z − − ) 3 and, Minimizing with respect to W (r) and W (r), respec- A B tively, we find expressions for the mean-field densities, δ[Φ (r) φˆ (r)]= A,B A,B − Z [dWA,B] exp(ρN0 Z drWA,B(r)[ΦA,B(r)−φˆA,B(r)]), φA,B(r)=−ρn0NQδwAδ,QB(r) , (13) (7) where we have defined [w (r),w (r)]. A B Q≡Q Upon inspection, it is clear how these relations consti- wherethe limits ofintegrationofthe conjugatefieldsare tute the mean-fieldtheoryresultofthe fullproblem. We i . Insertingtheserepresentationsandtheaboveiden- ± ∞ have replaced the problem of multiply-branched chains tity into (5) and integrating over the delta functions in mutuallyinteracting,withtheproblemofnon-interacting (2) and (3), the full partition function is given by, chainssubjecttothefieldsw (r)andw (r). Thesefields A B 1 are chosen to represent the mean-field interactions pro- Z = n! [dΞ][dWA][dWB][dΦA][dΦB] duced by the monomer distributions φA(r) and φB(r), Z That is, from (10) and (11) it is clear that A-type (B- ( [W (r),W (r)])nexp n dr χNΦ (r)Φ (r) type) monomers experience a repulsion proportional to × Q A B (−V Z (cid:20) A B χN timesthelocaldensityofB-type(A-type)monomers andarepulsionduetotheoverallincompressibilityofthe W (r)Φ (r) W (r)Φ (r) Ξ(r)[1 Φ (r) Φ (r)] , system, given by ξ(r). Because the mean-field incom- A A B B A B − − − − − (cid:21)) pmroenssoimbielirtydecnosnitsyt,raξ(inrt),co(1n2t)r,ibduetpeseneqdusaollnylytoobnotthhepottoetna-l (8) tials,w (r)andw (r). Hence,weseethatξ(r)issimply A B where [W (r),W (r)]isthepartitionfunctionforasin- the Lagrange-multiplier field which allows us to fix the A B Q glenon-interacting,branchedchainsubjecttothespatial combined, local segment concentration to ρ . Moreover, 0 field, W (r) acting on first generation of the chain and the average segment distributions, (13), are simply the A W (r) acting on the higher generations: averagedistributionsproducedbynon-interactingchains B subject to the fields w (r) and w (r). Thus, eqns. (10)- A B n (13)provideafullyself-consistentsetofequations,which [WA(r),WB(r)]= [drβ] can be solved to yield the mean-field result. Once the Q Z β=1 w (r) and w (r) are found, we can compute the mean- Y A B 1 3 field free energy per chain, exp ds γ(s) r˙ (s)2+W (r (s)) × (−Z0 (cid:20) (cid:18)2Na2| β | A β (cid:19) F = ln V−1 dr[w (r)φ (r)+w (r)φ (r)] A A B B +(1 γ(s)) 3κ2 r˙ (s)2+W (r (s)) . (9) nkBT − Q− Z − (cid:18)2Na2| β | B β (cid:19)(cid:21)) +V−1 dr χNφA(r)φB(r) . (14) Z In general, it is not possible to evaluate the functional integrals in (8). Nevertheless, in the limit where N is The first line of (14) gives the entropy per branched chain, and the second line gives the enthalpic, or inter- large, fluctuation contributions to the partition function are small, and the integral is dominated by its saddle- action, contribution to the free energy. point, where the free energy per chain, kBT ln , is For a given set of monomer potentials, wA(r) and minimal [18, 19] . The saddle-point appr−oxinmatioZn, of wB(r), can be evaluated. We start by defining the Q Green’s function, or propagator, for a continuous, un- course, yields the mean-field results. To obtain the mean-field result, we solve for the field branched portion of the chain, configurations, [φ (r), φ (r), w (r), w (r), ξ(r)],which A B A B r minimize the free energy (that is, the lower-case func- G(r ,s ;r ,s ) f[dr ] i i f f β tionsaretheextremalvaluesoftheupper-casefunctions). ≡ r Z i Minimizing with respect to ΦA(r), ΦB(r) and Ξ(r), re- sf 3 spectively, we obtain the mean-field equations: × exp − ds 2Na2|r˙β(s)|2+wA(rβ(s)) γ(s) (cid:26) Zsi (cid:20) (cid:21) w (r)=χNφ (r)+ξ(r) , (10) 3κ2 A B + r˙ (s)2+w (r (s)) 1 γ(s) , (15) 2Na2| β | B β − (cid:20) (cid:21) (cid:27) (cid:0) (cid:1) where this path integral is carried out over all paths, wB(r)=χNφA(r)+ξ(r) , (11) r (s), which such that r (s )=r and r (s )= r . We β β i i β f f absorb a normalization into [dr ] so that the integral of β thepropagatoroverthecoordinatesr andr isindepen- i f 1=φ (r)+φ (r) . (12) dentofarclength,s s . Thisisthesameasdemanding A B f i − 4 the probability distributions all paths diffusing fromany of the η free ends are equivalent, and therefore, q†(r,s) g is well defined. We summarize the above definition by writing q†(r,s) in terms of our unbranched propagator,G(r ,s ;r ,s ): i i f f q†(r,s)= dr G(r,s;r ,s ) [q†(r ,s+)]ηα+1 , α α α α α Z for s >s>s , (16) α−1 α where q†(r ,s+) indicates that we take the value of this α α functionfromtheendofthehighergenerationats (just α beforethebranchpoint). Ifwenormalizeourpropagator so that lim G(r ,s ;r ,s ) = δ(r r ), then we sf→si i i f f f − i establish a set of boundary conditions for q†(r,s) at its free end at s and each branching point, g FIG. 2: A schematic representation of the probability cap- q†(r,s−)=1 , (17) tured by the end-distribution functions, q†(r,s) and q(r,s), g for a 4-generation molecule. For the point, s, q†(r,s) is pro- portional to the probability that the dashed portion of the chain has diffused to the position, r. For the same point, q†(r,s−)=[q†(r ,s+)]ηα+1 , (18) α α α q(r,s) is proportional totheprobability that thedotted por- where q†(r,s−) is the limit of the function as s ap- tion of the chain has diffused to the the same position. The α probability that thepoint is at rat sis theproduct of q and proachessα from below (just after the branching point). q†. Thus,ata givenbranchingpoint, sα the value ofq†(r,s) changesdiscontinuously,fromq†(r,s+)toq†(r,s−),since α α the function assumes the probability of the other higher that the probability of any portion of this chain having generation branches meeting it at that point. any configuration(in the absence of external potentials) Because q†(r,s) is defined in terms of the propagator, is independent of the number of segments it contains. G(r ,s ;r ,s ), we know that it will obey the same dif- i i f f Note that G(r ,s ;r ,s ) is identical to the imaginary- fusion equation as the propagator. Namely, i i f f timequantummechanicalamplitude(withs it)fora particle of mass, Na2/3 (or Na2/3κ2 when γ→(s)−=0), in ∂q† N6a2∇2q†−wA(r)q† , for s0 <s<s1 , the potential, w (r) (or w (r) when γ(s)=0) mov- = sing.frTohmerreifaotret,−hweieAniktniaolw“ttimh−aet,”BGs(ir,t,osr;irat,asla)teorb“eytismteh,”e − ∂s N6κa22∇2q†−wB(r)q† , for s1 <s<sg (,19) f i i f f imaginary-time Schr¨odinger equation, or diffusion equa- It should be understood that we will solve these first- tionand,unlikeitsinterpretationinquantummechanics, orderequationsfor the unbranchedportions ofthe chain representsaprobabilityandnot anamplitude. Wemake andusethebranchingpointstodetermineboundarycon- explicit use of this fact below. ditions; hence, we do not need to worryabout differenti- To capture the branched architecture of the chain we ating at branching points. define the end-distribution functions. These functions Because Eq. (19) is a linear equation for q† which is compute the statistical weight of a chain diffusing along first orderin s, givenany set of fields, wA(r) and wB(r), its trajectory to some position in space. That is, we we can solve for q†(r,s) for all segments. First, using define a function, q†(r,s), which is proportional to the (19) and (17) we solve for the q†(r,s) for the gth gener- probability that the branched chain diffused from one ation. Then, we can use (19), (18) and our solution for of its free ends at sg, where sα is the length coordinate q†(r,sg−1)tosolveforthe(g−1)th generationofq†(r,s). corresponding to the branching point of αth generation Likewise, we can then iteratively solve for all lower gen- (see Fig. 1). Note that for s <s<s this function is erations until we get to the first. g−1 g simplytheprobabilitythatanunbranchedchaindiffused Oncethevalueofq†(r,s)isknownforallsdowntos0, from its free end to s at some position, r. But if s < wecancompute the single-chainpartitionby integrating g−1 s<s , then q†(r,s) is proportional to the probability this backwardmotion end-distribution function over the g−2 that η free ends diffused from s to some intermediate position of the free end of the A-block, g g position, say r , at s and then diffused on to r at g−1 g−1 s (see Fig. 2). Thus, as s decreases towards the free = dr q†(r,s ) . (20) 0 endofthe Ablockats0,q†(r,s)assumestheprobability Q Z of all the higher generations diffusing “into” this lower However, in order to compute the mean-field melt free generationbranch. Wewillrefertothisdiffusionfroms energy we need to calculate the average monomer dis- g towards s as “backwardmotion.” Note that in terms of tributions, φ (r) and φ (r), created by the monomer 0 A B 5 potentials, w (r) and w (r). By introducing another becomputationallyintensiveformeltphaseswithspatial A B end-distribution function, q(r,s), we can compute the variationinthreedimensions. Instead,weuseFourierex- functionalderivativeof ln withrespecttothesefields pansions of the functions to solve for q†(r,s) and q(r,s) directly. − Q givenanarbitrarysetofexternalfields,w (r)andw (r). A B Wedefineq(r,s)tobeproportionaltoprobabilitythat Sinceweknowthatequilibriumstructuresarethemselves achainconfigurationsdiffusesinthe “forward”direction infinitelyperiodicstructures,weexpectthatwecanvery fromitsotherfreeend(thefreeendoftheAblockats ) accurately describe mean-field results with a finite num- 0 along one of the branchedtrajectoriesof the molecule to ber of Fourier terms included the expansion. For up to satthepositionr(seeFig. 2). Atbranchingpoints,s , moderately large degrees of segregation (for χN < 50) α q(r,s) assumes the probability that (η 1) branches the spectral methods of [15] and [16] allow for the∼rapid α+1 have also diffused from their free ends at s−to r at s . and very accurate exploration of mean-field thermody- g α α This is to say that q(r ,s+) contains not only the prob- namics [19]. We present the spectral form of our SCFT α α ability that the s end diffused to this point but also the for multiply-branchedcopolymermelts in the Appendix. 0 probability that all of the other branches, not including the currently diffusing path, have diffused to to r at α s+ to meet it. This property makes q(r,s) convenient III. DOUBLY FUNCTIONAL BRANCHING: α forcomputingtheaveragemonomerdistributions. Using THE ROLE OF INTERFACES the above definition we have, Using the SCFT derived in the previous section we q(r,s)= drαG(rα,sα;r,s)q(rα,s−α)[q†(rα,s+α)]ηα−1, cmoumltpipultye-dbrtahnechχeNdc≤opo4l0ymmeeramn-efiltesldwphheraesethbeebhraavnicohrinfogr, Z for s >s>s . (21) or functionality, of each generation is 2. We compute α α+1 the phase behavior for g =2...6 for monomers of equal The corresponding boundary conditions for q(r,s) are segment size, κ = 1. To achieve a precision of 10−3 in given by, f and 10−2 in χN we require a precision in±the free energy±ofbetter than 10−4. This requirestheuse ofup q(r,s+0)=1 , (22) to 908 basis functions±for some phases. The mean-field phase diagrams for 3 g 6 are shown in Figs. 3 and ≤ ≤ 4. We have already reported on the phase behavior for q(r,s+)=q(r,s−) [q†(r ,s+)]ηα−1 . (23) g =2, the AB2 miktoarm star [8]. α α α α The thermodynamicsof these melts arestronglyinflu- Since the “motion” of the diffusion along the chain is enced by the introduction of the multiply-branched ar- reversed from that of q†(r,s) the diffusion equation for chitecture. Comparedtothepredictedphasebehaviorof q(r,s) is the same as (19) except with a plus sign ap- linear AB block copolymer melts, the phase boundaries pearing on the left hand side. In analogy with q†(r,s), of these branched copolymer melts are skewed system- we must first solve the diffusion and (22) for the first atically towards larger values of f for most phases [15]. generationof q(r,s). We then use our second generation This indicates an enhanced preference for phases where solution of q†(r,s) and the first generation solution of the branched polymer domain is on the convex side of q(r,s) in (23) to find the solution for the second genera- curved AB interfaces. In Figure 5 we plot the strong- tion. We can repeat the process to solve for q(r,s) over segregation(χN =40)phaseboundariesasafunctionof the entire length from s to s . branching generation. The preference for morphologies 0 g It is not difficult to show that the monomer distribu- with the branched, B domain on the outside of a highly tions, given by Eq. (13), can be computed by, curved interface is increases with increasing generation. For example, spherical micelles where the A blocks form φ (r)= V s1ds q(r,s)q†(r,s) , (24) the core region are stable up to f =0.275 for g = 2 but A stable up to f = 0.350 for g = 6. This effect is well QZs0 established for copolymer architectures with elastically asymmetric blocks [12, 16, 21, 22]. V g sα In general, elastic asymmetry stems chiefly from two φ (r)= ds q(r,s)q†(r,s) , (25) B NB,α sources—asymmetric monomer sizes and asymmetric QαX=2 Zsα−1 copolymer architecture. Milner demonstrated within whereV = nN and isthenumberofB-blocksinthe SST that the elastic asymmetry between copolymer ρ0 NB,α blocks of a A B miktoarm star is captured by the pa- αth generation, which is simply given by η η ...η . n m Tenhtuirse,lythweimtheatnh-efieelnddf-rdeiesterinbeurtgiyo,n(1fu4)n,ctciaonnsbα,eqαc(or−m,1sp)uatne2dd rspamecettivere,vǫo=lummne(sρρoBAfaat2A2Bh)e1/A2,awndheBreseρg−Am1eanntds[ρ1−B11].aFrreotmhethreis- q†(r,s). analysisitcanbeshownthattheeffectivespringconstant Whilereal-spacemethodsfornumericallysolvingthese ofthe B brushdomainisa factorofǫ2 times the valueof diffusion equations exist, [19, 20] these methods tend to the symmetric case (for ǫ = 1). For ǫ > 1, the molecu- 6 FIG. 3: Phase diagrams for g = 3 and g = 4. Dis labels re- FIG. 4: Phase diagrams for g =5 and g =6. Labels appear gions where the melt is disordered. Stableregions of ordered as in Figure 3. phases are labeled: (Lam) lamellar; (Gyr) gyroid, Ia¯3d sym- metry; (Hex) hexagonal-columnar, p6mm symmetry; (A15) spherephase,Pm¯3nsymmetry;(BCC)body-centercubiclat- strong-segregation analysis employed by Frischknecht tice of spheres, Im¯3m symmetry; and (FCC) face-centered andFredricksonwefind,forexample,thatthestiffnessof cubic lattice of spheres, Fm¯3m symmetry [24]. The circle a lamellar B domain in these doubly-functional copoly- marksthemeanfieldcriticalpointthroughwhichthesystem mermeltsisenhancedbyafactorof4(8g−1 1)/[7(2g−1 cantransitionfromthedisorderedstatetotheLamphasevia − − 1)] over the linear, unbranched case [13]. This corre- a continuous, second-order phase transition. All other phase spondstofactorsof4,12, 292 41.7,156and604multi- transitions are first-order 7 ≃ plying the stretching free energy of a lamellar B domain for the g = 2,3,4,5 and 6 case respectively. Pickett demonstrates, however, that the Alexander-de Gennes lar asymmetry leads to the stabilization of morphologies approximationprovides an overestimate of the branched where the B polymer block composes the outer corona chain free energy whose error grows quickly with the of spherical and cylindrical domains for larger values of branchinggeneration[14]. BasedontheanalysisofPick- Acompositionthanis observedforelasticallysymmetric ett [14] for a slightly different copolymer architecture we copolymers [23]. might expect that by relaxing the constraint that the It is desirable to have a similar quantitative mea- chain ends are held at the tips of the brush, the SST sure of the elastic asymmetry for copolymers with this stretching free energy of the branched B domain can by multiply-branched structural motif. However, in con- relaxed from the Alexander-de Gennes upper limit by trast to the miktoarm star architecture, the elastic en- factors of roughly 2.6, 5.5, 11.7 and 24.6 for g = 3,4,5 hancementofmultiply-brancheddomainsdependsonthe and 6, respectively (the g =2 case corresponds the AB 2 aggregate morphology. Using the Alexander-de Gennes, miktoarm star). This allows us to estimate more realis- 7 moment, or “stretching” moment, of the Voronoi cell, dΩˆR5 (Ωˆ) =(4π)2/3 X , (27) IX RdΩˆR3 (Ωˆ) 5/3 X where again we have nor(cid:0)mRalized by t(cid:1)he same measure forasphericalcellofequalvolume. Itcanbeshownthat the free energy per chain in a micellar phase arranged in lattice X is simply given by F =F ( 2 )1/3, where X 0 A I F is the free energy per chain for the case when the 0 Voronoi cell is approximated as a sphere [9, 12]. Given these geometricmeasures forall candidate arrangements of spherical micelles we can assess the relative stability of these phases in this limit where AB interface has the same shape as the unit cell of the lattice. It was discov- eredbyWeaireandPhelanthatthespacepartitionofthe A15latticehasthelowestareaofallknownequalvolume periodic partitions of three dimensional space [25]. It is for this reason,despite the factthat the BCC lattice has a smaller second moment, that the A15 lattice is most stable among the lattice arrangements of spherical mi- FIG. 5: The SCFT phase boundaries computed at χN = 40 celles when AB interfaces have adopted the shape of the for2≤g≤6aredepictedasopencircles. Forcomparisonthe Voronoi cell in which they are confined. In particular, χN =40phaseboundariesforlineardiblocksareindicatedof this limit predicts that the free energy per chain for the thef axis. Note theabsence of a stable A15 phase for linear A15 phase is 0.14% and 0.61% lower than the BCC and AB diblock copolymer melts. FCC phases, respectively. Of course, there are finite χN correctionsto this asymptoticlimit due to chainfluctua- tic values of the elastic asymmetry in the lamellar mor- tionswhichareneglectedinthestrong-segregationlimit, phology: 4 for g = 2; 4.6 for g = 3; 7.7 for g = 4; but the lowest order corrections which distinguish be- 13.4 for g = 5; and 24.6 for g = 6. While these are tween morphologies are smaller than the leading order somewhat crude estimates, they provide reasonable cor- free energy term by a factor of (χN)−4/9 [26, 27]. respondence between the SST phase behavior of these The conclusions of our SST analysis are valid in the multiply-branched copolymers and AB copolymers [8]. limit that the AB interface has adopted the polyhe- n Forexample,therespectiveχN =40,Gyr-LamandA15- dral shape of the lattice Voronoi cell. It is well known Hex transitions occur at f = 0.546 and f = 0.349 for a that constraining a micelle to occupy a polyhedral unit melt of AB miktoarm stars,corresponding to an elastic cellfrustrates the internalconfigurationofthe aggregate 5 asymmetry of 25. This should be compared to the same [28, 29]. Chains which extend along directions towards transitions which occur at f = 0.550 and f = 0.350, cornersoftheVoronoicellmuststretchfurtherthanthose respectively, for a g = 6 branched copolymer, with an extendingtowardsthewalls. The differenceintensionin estimated elastic asymmetry of 24.6. these chains leads to a tendency to distort the AB in- We note the stability of the cubic A15 phase in these terface from its ideal, uniformly curved shape into the melts. We have argued [9] that as χN and in polyhedral shape of the Voronoi cell. Of course, the mi- the limit that the AB interface of a sphere→pha∞se is con- celle will adopt some compromise between the uniform strained to adopt the same shape as the lattice unit cell curvature and relaxed outer chain stretching which will thattheA15shouldbetheequilibriumstructure. Inthis be determined by the relative importance of outer chain limit the relative stability of competing arrangements of stretching and the forces which pull inward on the AB micellescanbeassessedpurelyintermsoftwogeometric interface,namely the surfacetensionandthe inner chain momentsoftheVoronoipolyhedraofthelattice: thearea stretching. We demonstrated [8] how the tendency for and the second-moment of the lattice . If R (Ωˆ) mea- cylindrical micelles in the Hex phase to adopt an hexag- X sures the radial distance from the center to the surface onal interface shape is enhanced both by an increase in ofthe VoronoicelloflatticeX atsolidangle,Ωˆ, thenwe innerdomainvolumefraction,f,andtheelasticasymme- can compute the area in terms of the area of a spherical trybetweenthe coronalandcorepolymerdomains,ǫ. In cell of equal volume, particular, we found that although AB interfaces in mi- celles for symmetric molecules (e.g. linear AB diblocks) AX = (4π1)1/3R dΩˆ(cid:2)RX2 (dΩˆΩˆ)R+X3((∇ΩˆΩ)ˆR2/X3(Ωˆ))2(cid:3) , (26) rcmeyemlitnraidicnriccroaepllaomtlyivimceeleylrlesus(nǫcpo>emrt3pu)orhbseaedvdeobifnytveterhrfeaycleaesltatwsictheicicashlylmyarmaesevytemrryy-, nearlyhexagonalin re∼gionswhere the Hex phase is ther- (cid:0)R (cid:1) where ∇Ωˆ =θˆ∂∂θ +φˆ∂∂φ. We can also define the second- modynamically stable. Given the stability of the A15 8 FIG. 6: A view of the Voronoi cell of the BCC lattice, a truncated octahedron, with half of one hexagonal face and a quarter of one square face removed to reveal the inside. The FIG. 7: Plot of the measured distortion, α as defined in eqs. edges are drawn as black lines, the outside is shown as blue (28)and(29),measuredfromSCFTresultsfortheBCCphase andtheinsideisshownasyellow. Thevectorsconnectingthe of branched copolymer melts for generations, 2 ≤ g ≤ 6. centerofthecelltothecornersalongthe(210)directionsand Forcomparisonthedashedlineshowsthesamedistortionfor thenearest walls along the(111) directions are shown. linear AB diblock copolymer melts. phase in the present system (Figure 5), it must be that the interfaces of the sphere phases are also substantially close-packinglimit ofhardspheresin a BCC lattice is at distorted by the polyhedral environment of the lattice a volume fraction of √3π/8 0.68024, the cores of the ≃ Voronoi cell. micelles are highly deformed for f well below this. Since We can quantify the extent to which AB interfaces in the outer chain stretching is responsible for this poly- sphere phases adopt the shape of the Voronoi cells from hedral distortion, the tendency to adopt the truncated- our SCFT results. A measure of the distortion of the octahedral shape of the BCC lattice is enhanced as the interface of a micelle in the BCC phase from the ideal stiffness of the coronal region is increased by molecular spherical shape is the difference of the distances from branching. the center of the micelle to the interface along directions To further visualize this distortion we compute the towards the closest face of the Voronoi cell, the (111) mean-curvature, H, of AB interfaces extracted from direction,andtowardsthe cornerofthe Voronoicell,the SCFTresultsformeltsatχN =40atthephasesbound- (210) direction, ary between spherical and cylindrical phasess, the A15- Hex boundary, for g = 6, g = 2, and for linear diblocks. R R (210) (111) The distortion in these interfaces corresponds to mea- δ − , (28) ≡ R +R sured values of α = 0.32, α = 0.128 and α = 0.011, re- (210) (111) spectively. These surfaces are displayed in Figure 8, and where R and R are the radial distances to the (210) (111) followingtheanalysisofMatsenandBates[29]theinter- AB interface along those directions (see Figure 6). For faces are shaded according to the local mean-curvature. a spherical interface we have δ = 0 and for an inter- sph Asthepolyhedraldistortionincreases,thedeviationfrom facewhichasthetruncated-octahedronshapeoftheBCC constant mean curvature grows. The surface tension, γ, Voronoicell, δ =(√5 √3)/(√5+√3) 0.127. By BCC associatedwithaninterfacebetweenunlikepolymermelt − ≃ normalizingmeasuredvaluesofδ byδBCC,wecanassess domain scales as χ1/2 [30]. A patch of area, dA, of a thepolyhedraldistortiononthescalesetbythe shapeof curved interface experiences a force due the surface ten- the BCC Voronoi cell. Therefore, we use, sion which is given by 2HγdA [31]. Since these micelle configurations are saddle-points of the free energy, we δ α (29) knowthat the forcedue to the tensionpulling inwardon ≡ δ BCC the interface is balanced by a net force pulling outward to quantify the polyhedral distortion of the interface as on the micelle interface, that is, the interface must be in a function of molecular architecture. Figure 7 plots the mechanical equilibrium. In copolymer micelles the com- shape parameter, α, measured from SFCT calculations pensating forces are due to a difference in the tension of fortheBCCphaseasfunctionoff andbranchinggenera- the chains in the core and coronal domains. Therefore, tiong. Itisclearthatthepackingfrustrationintroduced variationof the mean curvature of the interface provides by the polyhedral Voronoi cell increases as the volume adirectmeasureofthechaintensionpullingontheinter- fraction of the core of the micelle grows. Although the face. Regions of high interfacial curvature, towards the 9 FIG. 8: The ABinterfaces extracted from the SCFT calculation (thesurfaces at which φA(r)=0.5) for theBCC phase along thethermodynamicphaseboundaryseparatingsphericalandcylindricalmorphologies: (a)forlineardiblocksatf =0.166; (b) for g = 2 branched copolymers at f = 0.275; and (c) for g = 6 branched copolymers at f = 0.350. The interfacial distortion at these pointscorresponds to measured valuesof α=0.011, 0.124 and 0.321, respectively. The surfaces are shaded according to the local mean curvature, H, measured in units of the average mean-curvature, hHi. The variation of the mean-curvature provides a direct measure of the variation of the polymer chain tension at the interface, dueto the polyhedral environment of lattice Voronoi cell. The standard deviation of thecurvature,σH, for each surface is given in units of hHi. edges and vertices of the BCC Voronoi polyhedron, cor- asχN , SST predicts thatF =1.0014F and BCC A15 →∞ respondtoregionswherethe coronalBdomainspullrel- F =1.0061F . We can compare this prediction to FCC A15 atively strongly on the interface. Conversely, relatively the results of our SCFT calculations along the Hex-A15 flat regions on the AB interface, towards the nearest- phase boundary at χN =40 for g = 5 branched copoly- neighborfacesofthe polyhedron,indicate thatthe chain mers(atf =0.340)forwhichwefindF =6.296nk T, A15 B stretching is relatively low. F = 6.314nk T and F = 6.326nk T, corre- BCC B FCC B spondingto0.28%and0.46%higherfreeenergythanthe A15 phase for BCC and FCC phases, respectively. On IV. CONCLUSION the scale of these small free energy differences, the anal- ysis of our geometrical limit is a necessary component From our analysis we see that for elastically asym- of any rational explanation for lattice choice. Therefore, metric copolymers the polyhedral shape of the lattice whilesuchacalculationhasyetbecarriedout,weexpect Voronoi cell forces the micelle configuration to deviate thatamoredetailedSSTanalysisoftherelaxedconfigu- drastically from the limit of uniform interfacial curva- rations of micelle interfaces will bear this argument out. ture. While we havearguedthatinthe limit ofperfectly polyhedralinterfacestheA15phaseismoststableamong Acknowledgments the sphere phases and that very elastically asymmetric micelles approach this polyhedral limit in regions where sphere phases are thermodynamically stable, it has yet Itis a pleasureto acknowledgestimulating discussions to be shown that for small distortions (for α<0.35) the with D. Discher, B. DiDonna, P. Heiney, and V. Percec. minimal Voronoi cell area argument should∼apply. For ThisworkwassupportedbyNSFGrantsDMR01-02459, example, the reduced area of the g = 6, BCC interface DMR01-29804, and INT99-10017, a gift from Lawrence of Figure 8 is 1.0094, to be compared to the reduced J. Bernstein, and the Pennsylvania Nanotechnology In- area of the truncated-octahedron of the BCC Voronoi stitute. cell, 1.0990. In this sense, AB interfaces of physical mi- celles seemsto be distortedless thanabout10%towards their Voronoi polyhedra. Nevertheless, we argue that APPENDIX: SPECTRAL SCFT the polyhedral interface limit of the micelle configura- tions sets the scale of the frustration. While the true Following Matsen and Schick [15, 16] we define a set micelleinterfacesaresomeinterpolationbetweenaspher- of orthogonal basis functions, f (r), which have the pe- i icalandpolyhedralshape,thescaleofthefrustratedfree riodic symmetry of our copolymer phase. We expand all energy is set by the polyhedral interface upper bound. of the necessary functions of position in this basis, so Asmentionedabove,inthelimitofpolyhedralinterfaces that g(r) = g f (r). For example, the BCC phase of i i i P 10 spheres can be described by the set of functions with solution. Usingthesematriceswecanwritethesolutions Im¯3m symmetry. The functions are normalized such for q†(s), i that, T† (s s )Λ†(s ) , for s <s<s , V−1 dr f (r)f (r)=δ . (A.1) j A,ij − 1 j 1 0 1 i j ij q†(s)=P Z i jTB†,ij(s−sα)Λ†j(sα) , for sα−1 <s<sα , In addition, we demand that these functions are eigen- (α=1) , P6 functions of the Laplacian operator so that, where Λ†(s ) are the boundary conditions for q†((sA).a8t) λ i α i 2f (r)= i f (r) , (A.2) s−: ∇ i −D2 i α where D is the length scale of the periodicity of the sys- Λ†(s )=V−1 dr [q†(r,s+)]ηα+1f (r). (A.9) i α α i tem. The set of functions is ordered in an increasing Z sequence in λ , and λ is set to 0 (or f (r) = 1). Be- i 1 1 cause the product of two basis functions, fi(r)fj(r), has Thus, we have that Λ†i(sg)=δi1. the all symmetries of the basis, it belongs in the same In order to compute Λ†(s ) for the lower generations, i α space of functions as our basis. Thus, we can write the we define the function, product as expansion in our basis functions. We define the coefficients, Γ , of the expansion so that, ijk ψ(m)(s ) V−1 dr [q†(r,s+)]mf (r). (A.10) i α ≡ α i f (r)f (r)= Γ f (r) . (A.3) Z i j ijk k Xk Given this definition we have ψi(1)(sα) = qi†(s+α) and, of Alternately, given the set of basis functions invari- course, Λ†i(sα) = ψi(ηα+1)(sα). Using (A.3) and the fact ant under all of the symmetry operations of the thattheFourierexpansionofq†(r,s+)= q†(s+)f (r), α i i α i group, this coefficient can be computed by Γ = it can be shown that, ijk V−1 drf (r)f (r)f (r). P i j k With these definitions and a finite Fourier expansion ψ(m)(s )= Γ q†(s+) ψ(m−1)(s ). (A.11) R i α ijk j α k α of all functions of position we can rewrite the diffusion j,k equation, (17), as a matrix equation, X In order to find q†(s) for the (g 1)th generation, we ∂q† jAijqj†, for s0 <s<s1 , first compute q†(s+i ) by (A.8) an−d Λ†(s )=δ . Using i = (A.4) i g−1 i g i1 − ∂s PjBijqj†, for s1 <s<sg , (aAll.m11)upwetocaηn th.eTnhietnerwateivweliyll choamvepΛut†e(sψi(m))(asng−d1q)†(fos)r g−1 i g−1 i where we havedePfined the matrices, A and B , for s <s<s . We can repeat this procedure until ij ij g−2 g−1 we haveq†(s) downto the firstgeneration. Atthis point Na2λ i i we have computed the probability of a chain diffusing A δ w Γ , (A.5) ij ≡− 6D2 ij − A,k ijk from its branched, B-block tips down to the end of A- k X block. Thatis tosay,wehavecomputedthe single-chain partition function, /V =q†(s ). B Na2λiδ w Γ . (A.6) To find qi(s) weQhave solv1e t0he same matrix equation ij ≡−6κ2D2 ij − B,k ijk as (A.4) except with a plus sign on the left-hand side. k X Again, the transfer matrix for the “reversed motion” A- Since these are symmetric, real matrices we can block solution is defined by, diagonalize A and B by orthogonal transforma- ij ij tions, such that, k,l[OAT]ikAkl[OA]lj = Aiδij and TA,ij(s′−s)≡ [OA]ikexp{Ak(s′−s)}[OA]jk , (A.12) k,l[OBT]ikBkl[OB]ljP= Biδij, where Ai and Bi are the Xk eigenvalues of A and B , and [O ] and [O ] are P ij ij A ij B ij and T (s′ s) is defined similarly. The solution for the orthogonal matrices which diagonalize, A and B , B,ij ij ij − q (s) is respectively. The matrix, i TA†,ij(s′−s)≡ [OA]ikexp{−Ak(s′−s)}[OA]jk , (A.7) jTA,ij(s−s1)Λj(s1) , for s0 <s<s1 , Xk qi(s)= P T (s s )Λ (s ) , for s <s<s , transfers the A-block solution to (A.4) from s to s′, and (αj=B1,)ij, − α j α α−1 α the matrix T† (s′ s) does the same for the B-block P6 (A.13) B,ij −