Logout succeed
Logout succeed. See you again!

Simplicity of the group of compactly supported area preserving homeomorphisms of the open disc and fragmentation of symplectic diffeomorphisms PDF
Preview Simplicity of the group of compactly supported area preserving homeomorphisms of the open disc and fragmentation of symplectic diffeomorphisms
Simplicity of Homeo(D2,∂D2,Area) and fragmentation of symplectic diffeomorphisms Fr´ed´eric Le Roux∗ Laboratoire de math´ematiques, UMR 8628 Universit´e Paris Sud, Bat. 425 9 91405 Orsay Cedex FRANCE 0 0 2 n a R´esum´e J 6 In1980,AlbertFathiaskedwhetherthegroupofarea-preservinghomeo- 1 morphisms of the 2-disc that are the identity near the boundary is a simple group. In this paper, we show that the simplicity of this groupis equivalent ] S to the following fragmentation property in the group of compactly suppor- D ted, area preserving diffeomorphisms of the plane : there exists a constant m such that every element supported on a disc D is the product of at most . h m elements supported on topological discs whose area are half the area of D. t a m R´esum´e [ En 1980, Albert Fathi pose la question de la simplicit´e du groupe 1 des hom´eomorphismes du disque qui pr´eservent l’aire et sont l’identit´e v 8 pr`es du bord. Dans cet article, nous montrons que la simplicit´e de ce 2 groupe est´equivalente `a une propri´et´ede fragmentation dans le groupe des 4 diff´eomorphismes du plan, pr´eservantl’aire et `a support compact,`a savoir: 2 il existe une constante m telle que tout ´el´ement a` support dans un disque D . 1 est le produit d’au plus m ´el´ements dont les supports sont inclus dans des 0 disques topologiques dont l’aire est la moiti´e de l’aire de D. 9 0 AMS classification: 37E30, 57S99, 28D15. : v Keywords: simple group; surface homeomorphism; hamiltonian dynamics; i fragmentation; symplectic diffeomorphisms. X r a This paper is concerned with the algebraic study of the group G = Homeo(D2,∂D2,Area) of area-preserving homeomorphisms of the 2-disc that are the identity near the boundary. The central open question is the following. Question 1 ([Fa80]). Is G a simple group? ∗This work was partially supported by the ANR Grant “Symplexe” BLAN 06-3-137237. However,theauthordoesnotsupporttheFrenchresearchpolicyrepresentedbytheANR,which promotes post-doctoral positions at theexpenseof permanent positions and project fundingat the expenseof long-term funding. 1 The study of the simplicity of groups of homeomorphisms goes back as far as 1935. Indeed in the famous Scottish Book ([SB57]), S. Ulam asked if the identity component in the group of homeomorphisms of the n-sphere is a simple group. This question was answered in the affirmative by Anderson and Fisher in the late fifties ([An58, Fi60]). In the seventies lots of (smooth) transformation groups were studied by D. Epstein, M. Herman, W. Thurston, J. Mather, A. Banyaga, and proved to be simple (see the books [Ba97] or [Bo08]). Let us give some details on the group Gdiff = Diffeo(D2,∂D2,Area), which is the smooth analog of our group G. This group is not simple, since there exists a morphism from Gdiff to R, called the Calabi invariant. But Banyaga proved that the kernel of the Calabi invariant coincides with the subgroup [Gdiff,Gdiff] generated by commutators, and is a simple group. Thus the normal subgroups of Gdiff are exactly the inverse images of the subgroups of R under the Calabi morphism. The analog of question 1 is also solved in higher dimensions. Indeed A. Fathi proved the simplicity of the group of volume preserving homeomorphisms of the n-ballwhicharetheidentityneartheboundary,whenn ≥ 3. However,Question1 remains unsolved (see [Fa80]). Actually some normal subgroups of G have been defined by E. Ghys ([Gh07], see [Bo08]), andby S.Mu¨ller andY.-G. Oh([MO07]). Butsofar noonehas been able to prove that these are proper subgroups: they might turn out to be equal to G. In this text, I propose to define still another family of normal subgroups {N } of G. I have not been able to prove that these subgroups are proper, but ϕ we can prove that they are good candidates. Theorem 1. If some normal subgroup of the family {N } is equal to G, then G ϕ is simple. The present work has its origin in Fathi’s proof of the simplicity in higher dimensions. Fathi’s argument has two steps. The first step is a fragmentation result: anyelementofthegroupcanbewrittenasaproductoftwoelements, each of whichis supportedon a topological ball whosevolume is 3 of thetotal volume. 4 Thesecondstepshowshowthisfragmentationproperty,letuscallit(P ),implies 1 the perfectness (and simplicity) of the group. While the second step is still valid in dimension 2, the first one fails. In the sequel we propose to generalise the fragmentation property (P ) by considering a family of fragmentation properties 1 (P ) depending on the parameter ρ ∈ (0,1] (a precise definition is provided in ρ section 1). A straightforward generalisation of Fathi’s second step will prove that if the property (P ) holds for some ρ, then G is simple (Lemma 3.1 below). On ρ the other hand, we notice that if none of the properties (P ) holds, then the ρ subgroups N are proper, and thus G is not simple (Lemma 2.1). Thus we see ϕ firstly that Theorem 1 holds, and secondly that Question 1 is translated into a fragmentation problem, namely the existence of some ρ such that property (P ) ρ holds. Christian Bonatti drew my attention to the possibility of formulating this fragmentation problem in terms of a single property (P ). This property, which 0 may beseen as thelimit of theproperties (P )as ρtends to zero, is thefollowing: ρ there exists a constant m such that any homeomorphism of the plane, supported on a disc having area equal to one, is the composition of m homeomorphisms supported on some topological discs having area equal to one half. This discussion is summarised by the next theorem. 2 Theorem 2. The following properties are equivalent: 1. the group G is simple, 2. there exists some ρ ∈(0,1] such that the property (P ) holds, ρ 3. property (P ) holds. 0 Furthermore we will prove that the simplicity of G is also equivalent to the similar fragmentation propertyon thesmoothsubgroupGdiff (seeLemma4.1 and Theorem 3 in section 4 below). We will see in section 6 that Entov-Polterovich quasi-morphisms, coming from Floer homology, implies that the fragmentation property (P ) do not hold for ρ ∈ (1,1]. Whether it holds or not for ρ ∈ [0, 1] ρ 2 2 remains an open question. The definitions and precise statments are given in section 1, as well as the links between properties (P ) and (P ) for ρ > 0. The proofs of Theorem 1 0 ρ and 2 are given in sections 2 and 3. Sections 4 and 5 provide the link with diffeomorphisms. Some more remarks, in particular the connection with other surfaces, are mentionned in section 7. Sections 5, 6 and 7 are independant. Acknowledgments I am pleased tothankEtienneGhys forhaving introduced the problem to me (in La bussi`ere, 1997); Albert Fathi, Yong-Geun Oh and Claude Viterbo for having organised the 2007 Snowbird conference that cast a new light on the subject; the “Symplexe” team for the excellent mathematical atmosphere, and especially Vincent Humili`ere, Emmanuel Opshtein and Pierre Py for the Parisian seminars and lengthy discussions around the problem; Pierre Py again for his precious commentaries on the text; Christian Bonatti for his “je transforme ton emmental en gruy`ere” trick; and Sylvain Crovisier and Franc¸ois B´eguin for the daily morning coffees, with and without normal subgroups. 1 The fragmentation norms In the whole text, the disc D2 is endowed with the normalised Lebesgue measure, denoted by Area, so that Area(D2) = 1. The group G is endowed with the topology of uniform convergence (also called the C0 topology), that turns it into atopologicalgroup. WerecallthatGisarcwiseconnected: anelementaryproofis provided bythefamous Alexander trick ([Al23]). We willusetheterm topological disc to denote any image of a euclidean closed discunderan element of the group G. As a consequence of the classical theorems by Scho¨nflies and Oxtoby-Ulam, any Jordan curve of null area bounds a topological disc (see [OU41]). Remember that the support of some g ∈ G is the closure of the set of non-fixed points. For any topological disc D, denote by G the subgroup of G consisting of the D elements whose support is included in the interior of D. Then each group G is D isomorphic to G, as shown by the following “re-scaling” process. Let Φ ∈ G be such that D = Φ−1(D ) where D is a euclidean disc. Then the map g 7→ ΦgΦ−1 0 0 provides an isomorphism between the groups G and G . We may now choose D0 D a homothecy Ψ that sends the whole disc D2 onto D , and similarly get an 0 isomorphism g 7→ ΨgΨ−1 between G and G . D0 3 Definition of the fragmentation metrics Let g be any element of G. We define the size of g as follows: Size(g) = inf{Area(D),D is a topological disc that contains the support of g}. Let us emphasize the importance of the word disc: an element g which is sup- ported on an annulus of small area surrounding a disc of large area has a large size. Also note that if g has size less than the area of some disc D, then g is conjugate to an element supported in D. The following proposition says that the group G is generated by elements of arbitrarily small size. It is an immediate consequence of Lemma 6.5 in [Fa80] (where the size is replaced by the diameter). Proposition 1.1 (Fathi). Let g ∈ G, and ρ ∈ (0,1]. Then there exists some positive integer m, and elements g ,...g ∈ G of size less than ρ, such that 1 m g = g ···g . m 1 We now define the family of “fragmentation norms”.1 For any element g ∈ G and any ρ ∈ (0,1], we consider the least integer m such that g is equal to the product of m elements of size less than ρ. This number is called the ρ-norm of g and is denoted by ||g|| . The following properties are obvious. ρ Proposition 1.2. ||hgh−1|| = ||g|| , ||g−1|| = ||g|| , ||g g || ≤ ||g || +||g || . ρ ρ ρ ρ 1 2 ρ 1 ρ 2 ρ As a consequence, the formula d (g ,g ) = ||g g−1|| ρ 1 2 1 2 ρ defines a bi-invariant metric on G. The normal subgroups N ϕ Given some element g ∈ G, we consider the ρ-norm of g as a function of the size ρ: ρ7→ ||g|| , ρ and call it the complexity profile of g. Let ϕ: (0,1] → R+ be any non-increasing function. We define the subset N containing those elements of G whose com- ϕ plexity profile is essentially bounded by ϕ: N = {g ∈G,||g|| = O(ϕ(ρ))} ϕ ρ where the notation ψ(ρ) = O(ϕ(ρ)) means that there exists some K > 0 such that ψ(ρ) < Kϕ(ρ) for every small enough ρ. The following is an immediate consequence of proposition 1.2. Proposition 1.3. For any non-increasing function ϕ : (0,1] → R+, the set N ϕ is a normal subgroup of G. The reader who wants some examples where we can estimate the complexity profile may jump to section 5, where we will see that commutators of diffeomor- phisms have a profile equivalent to the function ϕ : ρ 7→ ρ−1. This will imply 0 that N is the smallest non-trivial subgroup of our family {N }. ϕ0 ϕ 1The definition of thefragmentation norm is not new, see example 1.24 in [BIP07]. 4 The fragmentation properties (P ) ρ Let ρ ∈ (0,1]. We now define our fragmentation property (P ) by asking for a ρ uniform bound in the fragmentation of elements of size less than ρ into elements of a smaller given size. (P ) There exists some number s ∈ (0,ρ), and some positive integer m, such ρ that any g ∈ G of size less than ρ satisfies ||g|| ≤ m. s Here are some easy remarks. Let us denote by P(ρ,s) the property that there exists a boundm with ||g|| ≤ m for every element g of size less than ρ. Fix some s ρ ∈ (0,1] and some ratio k ∈ (0,1). Assume that property P(ρ,kρ) holds. Then by re-scaling we get that property P(ρ′,kρ′) also holds for any ρ′ < ρ (with the same bound m). In particular we can iterate the fragmentation to get, for every positive n, property P(ρ,knρ) (with the bound mn). This shows that property P(ρ,s) implies property P(ρ,s′) for every s′ < s. The converse is clearly true, so that property P(ρ,s) depends only on ρ and not on s. In particular we see that property (P ) is equivalent to the existence of a number m such that every g of ρ size less than ρ satisfies ||g||ρ ≤ m. 2 Also note that property P(ρ ) implies property P(ρ ) if ρ < ρ (again by re- 0 1 1 0 scaling). Thus property P is more and more likely to hold as ρ decreases from 1 ρ to 0. The fragmentation property (P ) 0 In this paragraph we introduce the fragmentation property (P ), and prove that 0 it is equivalent to the existence of some ρ > 0 such that property (P ) holds. ρ Consider, just for the duration of this section, the group Homeo (R2,Area) c of compactly supported, area preserving homeomorphisms of the plane. Any image of a euclidean closed disc under some element of this bigger group will again be called a topological disc. We also define the size of an element of the group as in G. Property (P ) is as follows. 0 (P0) There exists some positive integer m such that any g ∈ Homeoc(R2,Area) of size less than 1 is the composition of at most m elements of Homeo (R2,Area) of size less than 1. c 2 Since each piece of the fragmentation provided by property (P ) is supported on 0 a disc with area 1, the union of the supports has area at most m, but this gives 2 2 no bound on the area of a topological disc containing this union. However, if the union of the supports surround a region with big area, then we may find a new fragmentation by “bursting the bubble”, i.e. conjugating the situation by a map that contracts the areas of the surrounded regions and preserves the area everywhere else. This is the key observation, due to Christian Bonatti, to the following lemma. Lemma 1.4. Property (P ) holds if and only if there exists some ρ∈ (0,1] such 0 that property (P ) holds. ρ 5 Proof. Let us prove the easy part. Suppose (P ) holds for some ρ > 0, let m be ρ a bound for ||g||ρ for those g ∈ G of size less than ρ. Let g ∈ Homeoc(R2,Area) 2 of size less than 1. Choose some element of the group that sends the support of g into the euclidean unit disc D2, and compose it with the homothecy that sends D2 onto a disc of area ρ included in D2; we denote by Ψ the resulting map. Then ΨgΨ−1 is an element of G of size less than ρ. According to hypothesis (P ), we ρ may write this element as a composition of m elements of G of size less than ρ. We may conjugate these elements by Ψ−1 and take the composition to get a 2 fragmentation of g into m elements of size 1. Thus (P ) holds. 2 0 Now assume that (P ) holds, and let m ≥ 2 be given by this property. We 0 willprove thatproperty(P )holdsforρ= 2. Consider,in theplane, aeuclidean ρ m disc D of area 1. By the same re-scaling trick as before, it suffices to prove that ρ any g ∈ Homeo (R2,Area) with size less than 1 and supported in the interior of c D may be fragmented as a product of m elements of Homeo (R2,Area) with size c less than one half and supported in the interior of D. Property (P ) provides us 0 with a fragmentation g = g′ ◦···◦g′ by elements of size less than one half, but m 1 maybe not supported in D. Now comes the “bursting the bubbles” trick. Let D′ be a topological disc whose interior contains all the supports of the g′’s. The i union of the supports has area less than 1. Thus we may find some topological ρ discs K′,...K′, included in the interior of D′, that are pairwise disjoint and 1 ℓ disjoint from the supports of the g′’s, such that i ℓ 1 AreaD′\ K′< . j ρ j[=1 Denote by D the support of our original map g. Note that D is included in 0 0 the union of the supports of the g′’s, thus it is disjoint from the K′’s. Since D i j has area 1, theprevious inequality ensurestheexistence of somepairwisedisjoint ρ discs K ,...K in the interior of D, disjoint from D , such that 1 ℓ 0 ℓ ℓ AreaD\ Kj =AreaD′\ Kj′. j[=1 j[=1 UsingScho¨nfliesandOxtoby-Ulamtheorems,wecanconstructahomeomorphism Ψ of the plane satisfying the following properties: 1. Ψ is the identity on D , 0 2. Ψ(D′)= D, Ψ(K′) = K for each j, j j 3. the restriction of Ψ to the set D′\∪ℓ K′ preserves the area. 2 j=1 j The firstitem shows that ΨgΨ−1 = g. Now for each i we define g = Ψg′Ψ−1. i i Then the second item guarantees that the g ’s are supported in D, and the third i item entails thatthey preservearea andhave size less thanonehalf. Theproduct of the g ’s is equal to g, which provides the desired fragmentation. i 2Havinginmindthesmoothcase(Lemma4.1below),wenoticethatwemayfurtherdemand thatthemapΨisaC∞-diffeomorphism ontheinteriorofD′\∪ℓj=1Kj′. Actually,wemayeven choose thesets D′,Kj and Kj′ tobesmooth discs, andthen themap Ψ may bechosen to bea C∞-diffeomorphism of theplane. 6 2 Simplicity implies fragmentation Lemma 2.1. Assume that none of the properties (P ),ρ ∈ (0,1] holds. Let ρ ϕ :(0,1] → R+ be any function. Then the normal subgroup N is proper, i. e. it ϕ is not equal to G. In this case the group G is not simple. If we consider any element f 6= Id in G, and the function ϕ :ρ7→ ||f|| , then f ρ the normal subgroup N contains f and thus is not equal to {Id}. Hence the ϕf non-simplicity of G will be a consequence of the non-triviality of the subgroups N . ϕ Proof. According to the easy remarks following the definition of property (P ), ρ the hypothesis of the lemma reads the following way: (⋆) for every ρ ∈ (0,1] and every positive integer m there exists some element g of size less than ρ such that ||g||ρ > m. 2 We fix any function ϕ :(0,1] → R+, and we will construct some element g in G that does not belong to N . Let us define D = D2. We pick two sequences ϕ 0 of discs (C ) and (D ) converging to a point, such that for every i (see i i≥1 i i≥1 figure 1), – C and D are disjoint and included in D , i i i−1 – the area of D is less than half the area of C . i i D =D g 0 1 D 1 g2 D2 ... ... C 2 C 1 Figure 1: Construction of g We denote the area of C by ρ . We will construct a sequence (g ) , with i i i i≥1 each g supportedin the interior of C , and then g will bedefined as the (infinite) i i productoftheg ’s. NotethatsincethediscsC ’sarepairwisedisjointthisproduct i i hasameaning,andsincethesequence(C )converges toapointitactually defines i an element of G. Since all the g ’s with j > i will be supported in the interior of j the disc D whose area is less than ρ /2 we will get i i ||g||ρi ≥ ||gi...g1||ρi −1. (1) 2 2 The sequence (g ) is constructed by induction. Assume g ,...,g have been i 1 i−1 constructed. Using hypothesis (⋆), we may choose g supported on C such that i i ||gi||ρi is arbitrarily high, more precisely we demand the following inequality: 2 1 ρ i ||gi||ρi ≥ ϕ + ||gi−1...g1||ρi + 1. (2) 2 ρi (cid:16)2 (cid:17) 2 7 Using inequality (1), the triangular inequality and inequality (2) we get ||g||ρi ≥ ||gi...g1||ρi −1 2 2 ≥ ||gi||ρi − ||gi−1...g1||ρi −1 2 2 1 ρ i ≥ ϕ . ρ 2 i (cid:16) (cid:17) This proves that the complexity profile of g is not equal to O(ϕ). In other words g does not belong to N . ϕ 3 Fragmentation implies simplicity Lemma 3.1. Assume that property (P ) holds for some ρ ∈ (0,1]. Then G is ρ simple. This lemma is just a slight generalisation of Fathi’s argument showing that, underproperty(P ),thegroupGisperfect: anyelementdecomposesasaproduct 1 of commutators. Then perfectness implies simplicity: this is due to “Thurston’s trick”, for completeness the argument is included in the proof below. Proof. We assume that there exists a number ρ∈ (0,1] and a positive integer m such that any element of size less than ρ may be written as the product of m elements of size less than ρ. 2 LetC beasmalldisc. Byusualfragmentation (proposition1.1), any element 1 of G is a product of elements supported in a disc of area less than that of C , 1 and any such element is conjugate to an element supported in the interior of C . 1 Thus to prove perfectness it is enough to consider some element g supported in the interior of C and to prove that g is a product of commutators. 1 Let us first prove that such a g is a product of two commutators when con- sidered in the group Homeo(D2,∂D2), that is, let us forget for a while about the area (this is a “pedagogical” step). Choose two sequences of discs (C ) and i i≥1 (D ) converging to a point, such that (see figure 2) i i≥1 – the interior of D contains both C and C , i i i+1 – the C ’s are pairwise disjoint, i – the D ’s (resp. the D ’s) are pairwise disjoint. 2i 2i+1 D 1 D 2 C C 1 2 Figure 2: The sequences (C ) and (D ) i i≥1 i i≥1 8 For any i ≥ 1 choose some h ∈ Homeo(D2,∂D2), supported on D , that sends i i C onto C . We let g := g, thus g is supported on C , and define inductively i i+1 1 1 1 g := h g h−1 ; thus g is a “copy” of g, supported on C , and the g ’s are i+1 i i i i i i pairwise commuting. Let K := g g−1g g−1··· , K′ := g g−1g g−1··· 2 3 4 5 1 2 3 4 so that KK′ = K′K = g. The map K = [g ,h ][g ,h ]··· may be seen as an 2 2 4 4 infinite product of commutators, but we need a finite product. Now define G := g g ..., H := h h ··· , G′ := g g ··· , H′ := h h ··· 2 4 2 4 1 3 1 3 and observe that K = [G,H] and K′ = [G′,H′]: indeed these equalities may be checked independently on each disc D . Thus g = [G,H][G′,H′] is a product of i two commutators in Homeo(D2,∂D2). Now let us take care of the area. We will use sequences (C ) and (D ) as i i before, and we will get around the impossibility of shrinking C onto C inside i i+1 the group G by using the fragmentation hypothesis. We may assume, for every i, the equality 1 Area(C )= Area(C ). i+1 i 2 Moreover, by fragmentation, we may assume this time that g is supported in the interior of a disc C′ ⊂ C of area ρArea(C ). We use the fragmentation 1 1 1 hypothesis re-scaled on C to write 1 g = f ...f 1,1 1,m (seefigure3)witheachf supportedintheinteriorofatopological discincluded 1,j in C and whose area is 1 ρ Area(C ) = ρArea(C ). 1 2 2 We choose a disc C′ ⊂ C whose area also equals ρArea(C ) and, for each j = 2 2 2 1,...,m, some h ∈ G supported on D and sending the support of f inside 1,j 1 1,j C′. We define 2 g := h f h−1 2 1,j 1,j 1,j j=Y1,...,m which is supported on C′ (see figure 3). We apply recursively the (re-scaled) 2 C 1 C 2 C′ 2 g =g h1,i g2 1 f 1,i Figure 3: Fragment and push every piece inside the small disc... 9 fragmentation hypothesis to get a sequence (g ) with each g supported in the i i≥1 i interior of a disc C′ ⊂ C having area ρArea(C ) and sequences (f ) i i i i,j i≥1,j=1,...,m and (h ) with f supported on C and h supported on D , such i,j i≥1,j=1,...,m i,j i i,j i that g = f and g = h f h−1. i i,j i+1 i,j i,j i,j j=Y1,...,m j=Y1,...,m Obviously g and g are equal up to a product of commutators whose number i i+1 of terms depends only on m. More precisely, we have g g−1 = f h f−1h−1 i i+1 i,j i,j i,j i,j j=Y1,...,m j=Ym,...,1 = [fi,1,P] fi,j hi,jfi−,j1h−i,j1[fi,1,hi,1] j=Y2,...,m j=Ym,...,2 where P is equal to the term between parentheses, and we see recursively that g g−1 is a product of 2m commutators of elements supported in D ; we write i i+1 i g g−1 = [s ,t ]. i i+1 i,j i,j j=1Y,...,2m It remains to define the infinite commutative products K := g g−1g g−1··· , K′ := g g−1g g−1··· 2 3 4 5 1 2 3 4 S := s s ..., T := t t ··· , S′ := s s ··· , T′ := t t ··· j 2,j 4,j j 2,j 4,j j 1,j 3,j j 1,j 3,j and to check that K = [S ,T ], K′ = [S′,T′], and g = KK′ j j j j j=1Y,...2m j=1Y,...2m is a product of 4m commutators. This proves that G is perfect. Letusrecallbriefly,accordingtoThurston,howperfectnessimpliessimplicity. Let D be a disc and g,h ∈ G be such that the discs D,g(D),h(D) are pairwise disjoint. Let u,v ∈ G be supported in D. In this situation the identity [u,v] = [[u,g],[v,h]] may easily be checked, and shows that [u,v] belongs to the normal subgroup generated by g. Now given any g 6= Id in G, one can find an h∈ G and a disc D suchthattheabovesituation takes place. IfGisperfectthensoistheisomorphic group G , hence every f supported in D is a product of commutators supported D in D, and by the above equality such an f belongs to the normal subgroup generated by g. By fragmentation this subgroup is thus equal to G. This proves that G is simple, and completes the proof of the lemma. 4 Fragmentation of diffeomorphisms Here we further translate Question 1 into the diffeomorphisms subgroup Gdiff. Let Gdiff =Diffeo(D2,∂D2,Area) be the group of elements of G that are C∞- diffeomorphisms. Note that for every topological disc D the group of elements supported in the interior of D, Gdiff := Gdiff ∩G , D D 10