Logout succeed
Logout succeed. See you again!

Site-Specific Labeling of Protein Kinase CK2 PDF
Preview Site-Specific Labeling of Protein Kinase CK2
pharmaceuticals Article Site-Specific Labeling of Protein Kinase CK2: Combining Surface Display and Click Chemistry for † Drug Discovery Applications ChristianNienberg1,AnikaRetterath1,Kira-SophieBecher2,ThorstenSaenger1, HenningD.Mootz2andJoachimJose1,* 1 InstitutfürPharmazeutischeundMedizinischeChemie,PharmaCampus, WestfälischeWilhelms-UniversitätMünster,Corrensstraße48,D-48149Münster,Germany; [email protected](C.N.);[email protected](A.R.); [email protected](T.S.) 2 InstitutfürBiochemie,WestfälischeWilhelms-UniversitätMünster,Wilhelm-Klemm-Straße2, D-48149Münster,Germany;[email protected](K.-S.B.); [email protected](H.D.M.) * Correspondence:[email protected];Tel.:+49-(0)251-83-32200;Fax:+49-(0)251-83-32211 † Thebestpresentationatthe1stInternationalElectronicConferenceonMedicinalChemistry. AcademicEditor:JeanJacquesVandenEynde Received:19May2016;Accepted:17June2016;Published:27June2016 Abstract: HumanCK2isaheterotetramericconstitutivelyactiveserine/threonineproteinkinase and is an emerging target in current anti-cancer drug discovery. The kinase is composed of two catalytic CK2α subunits and two regulatory CK2β subunits. In order to establish an assay to identifyprotein-protein-interactioninhibitors(PPI)oftheCK2α/CK2βinterface,abioorthogonal clickreactionwasusedtomodifytheproteinkinaseα-subunitwithafluorophore. Byexpanding thegeneticcode,theunnaturalaminoacidparaazidophenylalanine(pAzF)couldbeincorporated intoCK2α. PerformingtheSPAACclickreaction(Strain-PromotedAzide-AlkyneCycloaddition) bytheuseofadibenzylcyclooctyne-fluorophore(DBCO-fluorophore)ledtoaspecificallylabeled humanproteinkinaseCK2α. Thissite-specificlabelingdoesnotimpairthephosphorylationactivity ofCK2,whichwasevaluatedbycapillaryelectrophoresis. Furthermoreadissociationconstant(K ) D of631˘86.2nMwasdeterminedforthesubstrateα -caseintowardsCK2α. Thislabelingstrategy S1 was also applied to CK2β subunit on Escherichia coli, indicating the site-specific modifications of proteinsonthebacterialcellsurfacewhendisplayedbyAutodisplay. Keywords: CK2;kinase;Autodisplay;clickchemistry;unnaturalaminoacid;bioorthogonal;labeling; drugdiscovery;protein-proteininteraction 1. Introduction Human protein kinase CK2 was discovered in 1954 by Burnett and Kennedy [1] and is a constitutivelyactiveserine/threoninekinase. Erroneouslythekinasewasfirstnamedcaseinkinase 2persuadingcaseinsasinvivosubstrates. Today’sliteraturepostulatesthatcaseinsareonlyinvitro substrates of CK2 [2]. The CK2 holoenzyme forms a heterotetrameric structure composed of two catalytically active α- and two regulatory β-subunits, which are dimerized by a zinc finger [3]. The α-subunit can be replaced in some cases by the isoform CK2α’ [4]. CK2 is a highly pleiotropic proteinkinase,phosphorylatingahugenumberofcellularsubstrates[5]andisinvolvedinmanycellular processes[6].Thekinaseisrelatedtoavarietyofhumandiseasesandrepresentsanimportanttargetin currentcancerresearch[7,8].Currently,plentyofinhibitorsareknowntoinhibitthephosphorylation activityofCK2includingdibenzo[b,d]furane-[9]andindeno[1,2-b]indole-derivatives[10].Oneofthe Pharmaceuticals2016,9,36;doi:10.3390/ph9030036 www.mdpi.com/journal/pharmaceuticals Pharmaceuticals2016,9,36 2of15 most potent ATP-competitive inhibitors found so far is CX4945, which currently is in clinical trials for approval as anti-cancer agent [11]. Beside inhibitors binding to the ATP binding pocket, some compounds interfere with the interaction of the CK2α- and the CK2β-subunit. The cyclic peptide Pc, derived from the C-terminal CK2β segment, is an effective CK2β-competitive compound [12]. Centralpointsfortheidentificationandcharacterizationofnewinhibitorsorinteractionpartnersof CK2arescreening-andprotein-proteininteractionassays,whichoftenrequirethemodificationbya fluorophoreofthetargetenzymeCK2.Methodsincludingflowcytometry,microscalethermophoresis (MST),FRET-oranisotropymeasurementsforthesetests,arebasedonthedetectionofafluorescently labeledprotein[12–15]. Mostcommerciallyavailablelabelingapplicationsattacklysineandcysteine sidechainsofproteins.Theseprocedurescanleadtomodificationsatdifferentpositionsanddifferent protein-to-fluorophoreratios,whichcanresultinheterogeneouslylabeledproducts.Theconsequences canbealteredaffinities,stabilitiesandpotentialchangesinproteinactivityincontrasttotheunlabeled protein.Modifyingproteinsonlyinonewell-selectedpositioncouldyieldaspecificlabelingwithoutany influenceonproteinfoldingalongwithactivityandresultsinahomogenouslylabeledproteinsolution. Theadvantageofaspecificmodificationbyincorporatinganunnaturalaminoacidwithappropriate functionalgroups,hasalreadybeenshownforantibody-drugconjugateswithregardtoselectivityand potency[16]. Unnaturalaminoacidsfacilitatebioorthogonalreactionsandexpandthecapabilitiesof proteinchemistry.Amongothers,thesecomprisethecreationofcyclicpeptidesbyanincorporationof anunnaturalaminoacidfollowedbyanoximeligation[17]aswellassite-specificchemical-taglabeling ofproteinsbyrecombinantsplitinteins[18]. The Autodisplay technology is based on the natural secretion mechanism of autotransporter proteinsingram-negativebacteria. ForcathepsinG,atargetinchronicinflammatorydiseasessuch as lung emphysema, new peptidic inhibitors were identified by using the binding affinity of the fluorescent labeled target protein to a surface translocated peptide library on Escherichia coli [19]. TheheatshockproteinHSP90,ahomodimer,wasalsocombinedwiththesecretionmechanismof Autodisplayandenabledtheidentificationofpeptides,whichinhibitedthedimerizationofHSP90[20]. InpreviousstudiesthesuccessfuldisplayoftheheterotetramericCK2holoenzymeonthesurfaceof E.coliwasreported[21]. RecentlytheAutodisplayofCK2α1wasshownandenabledinhibitortesting bycapillaryelectrophoresisofthelessinvestigatedisoformofCK2α[22]. Combiningaspecifically labeledproteinwiththeAutodisplaymediatedsurfacedisplayenablesavarietyofpossibilitiesfor newapplicationsbasedonfluorescencedetection. In this study, a specific labeling of the human protein kinase CK2α subunit and surface translocated CK2β-subunit on E. coli cells generated by an incorporation of the unnatural amino acidpAzFfollowedbyabioorthogonalclickreactionisreported. Theadvantagesofaspecificprotein modificationaswellasadvantagesfordrugdiscovery,usingmicroscalethermophoresis(MST),with thetargetenzymeCK2αwereconfirmed. 2. ResultsandDiscussion 2.1. SelectingaSuitablePositioninCK2αforaSpecificFluorophoreLabeling ProteinlabelingofthetargetCK2isanimportantbasisforseveralmethodsbasedonfluorescence detectionwiththeaimtodiscoverandinvestigateinhibitorsorbindingpartners.Performingalabeling reactionofCK2byfluoresceinisothiocyanate(FITC),whichisreactivetowardsnucleophilesincluding aminesidechains,revealedalossofphosphorylationactivityinthisstudy. ThekinaseactivityofCK2onthesubstratepeptideRRRDDDSDDDwasdeterminedbyacapillary electrophoresisassay[23],whichisbasedonadifferentmigrationtimeofthephosphorylatedproductin contrasttotheunphosphorylatedsubstratethroughadifferenceincharge.Threeindependentbatches oflabeledCK2-FITCwereinvestigatedandexhibitedslightornophosphorylationactivity. Atypical activity measurement as obtained with one of these batches indicating a minimal phosphorylation activity of CK2-FITC in comparison to the unlabeled CK2 after 30 min of incubation time with the substrate peptide is shown in Figure 1. These results led to the conclusion that unspecific protein modificationsasobtainedwithFITChaveanegativeinfluenceonCK2activity.CK2αcontains23lysines. Pharmaceuticals 2016, 9, 36 3 of 15 Pharmaceuticals2016,9,36 3of15 conclusion that unspecific protein modifications as obtained with FITC have a negative influence on CKP2ha armctaicveuittiyca. lCs 2K0126α, 9 c, o36n tains 23 lysines. Modifications of lysine residues in the sequence of CK2α 3b oyf 15 ModificationsoflysineresiduesinthesequenceofCK2αbyFITCcouldhaveresultedinheterogeneously FITC could have resulted in heterogeneously labeled products as well as in differences in the CK2α labelecdonpcrloudsiuocnt sthaast wunelslpaesciifnicd pirffoetreeinn cmesodiniftihcaetiCoKns2 αas toobftlauionreodp whoitrhe FrIaTtiCo .hAavceo au npelignagtiovfe FinITflCuetnocKe 6o8n, to fluorophore ratio. A coupling of FITC to K68, which is located at the ATP binding site [24], could whichCiKs2lo accattievditya.t CthKe2AαT cPonbtianidnisn 2g3s liytesi[n2e4s]., Mcooudldififcoartieoxnasm opf lleyisninteer freerseidwuietsh itnh ethbei nsedqinugenocfet hoef CcoK-f2aαc tboyr for example interfere with the binding of the co-factor ATP in CK2α subunit and hence the loss of ATPiFnITCCK 2coαusludb huanviet arensduhlteendc ient hheetleorsosgoenfeeonuzyslmy alatibcealecdti vpirtyo.dIuncatsd adsi twioenl,l aasl aibne dliinffgerreenaccetiso nino tfhKe 1C9K12oαf enzymatic activity. In addition, a labeling reaction of K191 of the regulatory CK2β dimer by FITC theretgo uflluatoorroyphCoKre2 βradtiiom. Aer cboyupFlIiTnCg ocfo uFIlTdCh atov eK6h8in, wdehriecdh tish eloicnatteerda catti othne wAiTthP tbhiendCinKg2 αsitseu [b2u4]n, ictoaunldd could have hindered the interaction with the CK2α subunit and hence lead to a reduction of hencefolre aedxatmoaplree dinutcetrifoenreo wfeitnhz tyhme abtiincdaicntgiv oitfy .the co-factor ATP in CK2α subunit and hence the loss of enzymatic activity. enzymatic activity. In addition, a labeling reaction of K191 of the regulatory CK2β dimer by FITC could have hindered the interaction with the CK2α subunit and hence lead to a reduction of enzymatic activity. Figure 1. Comparison of the phosphorylation activity of the heterotetrameric CK2 before and after Figure1. ComparisonofthephosphorylationactivityoftheheterotetramericCK2beforeandafter reaction with FITC. The CE-based assay as described before by Gratz et al. [23] was used to determine reactionwithFITC.TheCE-basedassayasdescribedbeforebyGratzetal.[23]wa susedtodetermine the CK2 activity. Electropherogram of the phosphorylation of the substrate peptide RRRDDDSDDD theCFKi2guarcet iv1.i tCy.oEmlpecatrriosopnh eorfo tghrea pmhoosfpthhoerpyhlaotisopnh aocrtyivlaittyio onf otfheth heesteurbosttertaratempeeripct iCdKe2R bReRfoDreD aDnSdD aDftDer (114 µM) by unlabeled (I, 2.6 µg) and fluorescein-conjugated CK2 (II, 2.6 µg) after an incubation time of (114 µreMac)tiboyn wunitlha bFeITleCd. T(Ih,e2 C.6E-µbga)seadn adssflauy oarse dsceescinri-bceodn bjuegfoartee dbyC GKra2tz(I eIt, a2l..6 [2µ3g] )waafst eurseadn toin dceutebramtiionne 30 min is shown. Substrate (S) and product (P) peaks were detected after 3.7 min and 4.3 min, respectively. timetohfe 3C0Km2 ainctiivsitsyh. oEwlenct.roSpuhbersotrgartaem( So)f tahned phporsopdhuocrtyl(aPt)iopne oafk tshew seurbestdraettee cpteepdtiadfet eRrR3R.7DDmDinSDaDnDd 4.3Am s(i1np1,e4rc eµisfMipce) l cbatybiv euelnliynla.gb eolfe dth (eI, e2n.6z µygm) aen adt falu doirsetsicnecint -pcoonsijutigoante cdo CuKld2 o(IvI,e 2r.c6o µmg)e a tfhteers aen e ifnfecuctbsa.t Tiohne t immee tohfo d 30 min is shown. Substrate (S) and product (P) peaks were detected after 3.7 min and 4.3 min, respectively. of Chin et al. [25] enables a site-specific incorporation of the unnatural amino acid para azAidosppehceinfiyclalalabneilnineg (poAftzhFe) einntzoy pmreotaetinasd. istinctpositioncouldovercometheseeffects.Themethodof A specific labeling of the enzyme at a distinct position could overcome these effects. The method ChinetTalh.e[ 2in5]coernpaobrlaetsioans iotef -psApezcFi fiinction cCoKrp2αor, awtihoincho fcathne euasninlya tbuer amloadmifiineod awciidthp aa frlauaozroidpohpohreen byyl acllaicnkin e of Chin et al. [25] enables a site-specific incorporation of the unnatural amino acid para (pArezaFc)tiinonto, cporuoltde ianvso.id a negative effect on the phosphorylation activity of human protein kinase CK2. azidophenylalanine (pAzF) into proteins. FoTr htheei innccoorrppoorraattiioonn ooff tphAe uzFnninattuorCalK a2mαin,wo ahciicdh, tcyarnoseiansei lYy2b3e9 imn othdei fiseeqduwenitche oaffl CuKo2rαo pwhaosr cehboysecnli. ck The incorporation of pAzF into CK2α, which can easily be modified with a fluorophore by click reaTchtiiosn p,ocsoiutilodn asvhooiwdsa an seugfafitciiveente fdfiescttanocne tthoe thpeh oAsTpPh obrinydlaitnigo nsiatec tainvdit ytoo tfhheu imntaernacptrioonte sinitek iwniatshe tCheK 2. reaction, could avoid a negative effect on the phosphorylation activity of human protein kinase CK2. ForCtKh2eβi nscuobrupnoirt.a Itnio andodfittihoen,u an tnyartousrinael aams cihnoosaecni dfo,rt ysurobssitniteuYtio2n39 hians tshtreuscetuqruaeln scimeoilfarCitKy2 tαo pwAazsFc hanodse n. For the incorporation of the unnatural amino acid, tyrosine Y239 in the sequence of CK2α was chosen. it is located at the periphery of the α-subunit structure (Figure 2) and hence supposed to have ThispositionshowsasufficientdistancetotheATPbindingsiteandtotheinteractionsitewiththe This position shows a sufficient distance to the ATP binding site and to the interaction site with the minimal effects on the correct folding of the protein. CK2βCsKu2bβu snuibt.uInnita. dInd aitdiodnit,ioant,y ar otysirnoesianse cahs ocsheonsefno rfosru sbusbtisttuittuiotinonh ahsasst srtuructcuturarlals ismimilialarritityyt too ppAAzzFF aanndd itisloitc aiste ldocaatttehde apte rthipeh pereyripofhtehrye αo-fs uthbeu nαi-tsustbruunctiut rsetr(uFcitguurree (2F)igaundre h2e)n acendsu hpepnocsee dsutpophoasveed mtoin himavael effectmsionnimthael ecfofrercetsc tofno ltdhein cgororfetcht efopldrointegi nof. the protein. Figure 2. Ribbon diagram illustrating the structure of heterotetrameric human protein kinase CK2. For this purpose CK2 structure (PDB identification number 1JWH) was processed with the UCSF Chimera 1.10.2 software package [26]. The catalytic CK2α subunit binds to the regulatory CK2β Figure 2. Ribbon diagram illustrating the structure of heterotetrameric human protein kinase CK2. Figsuurbeu2n.itR. Dibibmoenridzaiatigorna mof itlwluos tβra-stuinbgunthites sist rmucetduiraeteodf bhye tae rzoitnect rfainmgeerri. cThhuem naonn-phyrodtreoilnyskaibnlaes AeTCPK 2. For this purpose CK2 structure (PDB identification number 1JWH) was processed with the UCSF Foranthaliosgpuuer apdoesneoCsiKne2 5s´t-r[uβc,γtu-irmeid(PoD]trBipihdoesnpthifiactea t(iAonMnPuPNmPb)e ris1 bJWouHnd) wina tshep rAoTcePs sbeinddwinigt hpothckeeUt oCfS F Chimera 1.10.2 software package [26]. The catalytic CK2α subunit binds to the regulatory CK2β Choimnee craata1l.y1t0i.c2 αs-osuftbwuanrite. Apa tcykroagsiene[ 2in6] p.oTsihtieonc a2t3a9l y(Yti2c3C9)K w2aαs scuhobsuenni ttob bined resptloactehde brye gthuel autnonryatuCrKal2 β subunit. Dimerization of two β-subunits is mediated by a zinc finger. The non-hydrolysable ATP subaumniinto. aDciimd perAizzaFt iinotno oCfKt2wαo. β-subunitsismediatedbyazincfinger. Thenon-hydrolysableATP analogue adenosine 5´-[β,γ-imido]triphosphate (AMPPNP) is bound in the ATP binding pocket of analogueadenosine5’-[β,γ-imido]triphosphate(AMPPNP)isboundintheATPbindingpocketof one catalytic α-subunit. A tyrosine in position 239 (Y239) was chosen to be replaced by the unnatural onecatalyticα-subunit.Atyrosineinposition239(Y239)waschosentobereplacedbytheunnatural amino acid pAzF into CK2α. aminoacidpAzFintoCK2α. Pharmaceuticals2016,9,36 4of15 2.2. IncorporationofpAzFintoCK2α The unnatural amino acid pAzF could be incorporated in the CK2α-subunit in E. coli by the use of an orthogonal amber suppressor tRNA, which incorporates the unnatural amino acid at an amberstopcodon(UAG)[27]. Therefore,site-directedmutagenesiswasappliedtomodifythegene encodingCK2α,resultinginthereplacementofthecodonforY239(TAT)bytheamberstopcodonTAG. ThecorrespondingplasmidwastermedpCK2αY239Stop.ThebiosynthesisofthemutatedCK2α-pAzFwas controlledbytheT7-promotor.E.coliBL21(DE3)cellsweretransformedwiththeplasmidpCK2αY239Stop andasecondplasmidcalledpEVOL-pAzF,directingtheexpressionofthegenesfortheambersuppressor tRNAandanaminoacyl-tRNAsynthetase[25].Theaminoacyl-tRNAsynthetaseacylatesthetRNAwith theunnaturalaminoacidpAzF,incaseitissuppliedtothegrowthmedium.TheambertRNArecognizes theamberstopcodonUAG,followedbytheincorporationofpAzFintotheCK2αaminoacidsequence. ExpressionoftheambertRNAwasundercontrolofaconstitutivepromotor.Twosimilargenesofthe aminoacyl-tRNAsynthetaseareencodedbythepEVOLplasmid,whichresultedinhigheryieldsofthe mutatedproteinsasdescribedbeforebyYoungetal.[28]. Expressionofoneoftheaminoacyl-tRNA synthetaseswasundercontrolofaconstitutivepromoter,whereasexpressionoftheotherwasinducible byarabinose. TomaintainbothplasmidsinonecellofE.coli,theywereequippedwithtwodifferent originsofreplication,ColE1forpCK2αY239Stopandp15AforpEVOL-pAzF.InadditionpCK2αY239Stop encodedacarbenicillinresistance,whereaspEVOL-pAzFencodedachloramphenicolresistance.Onlyif bothplasmidswerepresent,translationoftheamberstopcodonUAGwouldbepossible,resultingin theincorporationoftheunnaturalaminoacidpAzFintotheaminoacidsequenceofCK2α. First,theinfluenceoftheexpression-inducingagentsisopropyl-β-D-thiogalactopyranoside(IPTG) and arabinose on the gene expression of both plasmids, pCK2αY239Stop and pEVOL-pAzF, was investigated together with the effect of presence and absence of the unnatural amino acid pAzF inthegrowthmedium. Foreachcombinationthebacterialcellswereboiledandtheproteinswere separated by SDS-PAGE (Figure 3). In the presence of the inducer IPTG and in absence of the unnaturalaminoacidpAzFatruncatedCK2α-isoformwithamolecularweightof28kDaappeared, because the aminoacyl-tRNA synthetase could not acylate the orthogonal tRNA with pAzF. As a consequencetheproteintranslationwasterminatedattheamberstopcodonUAG.Thelackoffull lengthCK2α-pAzFalsoindicatesthattherewasnoreadthroughacrosstheamberstopcodoninthe sequenceofpCK2αY239Stop[29]. Full-lengthCK2αwithamolecularweightof40kDacouldonlybe detectedwhenbothinducers,IPTGaswellasarabinoseandinadditiontheunnaturalaminoacid pAzF were present (Figure 3, lane 8). The addition of the inducer arabinose was not essential for thebiosynthesisoffull-lengthCK2α,becauseofthesecondcopyoftheaminoacyl-tRNAsynthetase controlledbytheconstitutivepromotoronthepEVOLplasmid(Figure3,lane6). Theseresultsindicate thatbothplasmidswerepresentandthattheunnaturalaminoacidpAzFwassuccessfullyincorporated inthecatalyticsubunitCK2αincaseitwaspresentinthegrowthmedium. 2.3. PurificationandClickChemistryofCK2α-pAzF It was intended to use a bioorthogonal click reaction to modify purified CK2α-pAzF with a fluorophoreandtoconfirmtheaccessibilityoftheazidogroupoftheincorporatedpAzF.Inorder to obtain CK2α-pAzF in larger amounts, bacterial cells were grown in 1.2 L minimal medium to themidlogphase. TheunnaturalaminoacidpAzF(1mM)wasaddedtothecellsuspensionand geneexpressionwasinducedbytheadditionofIPTG(1mM)andarabinose(0.2%)for4hat30˝C. Aftercultivation,E.colicellswereharvestedanddisruptedbysonication. Subsequentlythecelllysate wascentrifugedandCK2α-pAzFwaspurifiedbyP11phosphocellulosechromatographyaccording toGrankowskietal.[30]. Alineargradientof300mMto1500mMNaClwasusedtoeluatebound proteins.FractionsofCK2α-pAzFwerereceivedataconcentrationofapproximately600–700mMNaCl andanalyzedbySDS-PAGE.Finally,CK2α-pAzFwasobtainedinaconcentrationofapproximately 130 µg/mL and a total yield of 2.7 mg. CK2α-pAzF was concentrated by ultrafiltration to a final concentrationof1.1mg/mL. Pharmaceuticals2016,9,36 5of15 Pharmaceuticals 2016, 9, 36 5 of 15 Figure 3. SDS-PAGE analysis of gene expression and incorporation of pAzF into CK2α. The addition Figure3.SDS-PAGEanalysisofgeneexpressionandincorporationofpAzFintoCK2α.Theaddition or the omission of the unnatural amino acid pAzF, the inducers IPTG and arabinose to E. coli ortheomissionoftheunnaturalaminoacidpAzF,theinducersIPTGandarabinosetoE.coliBL21(DE3) BL21(DE3) cells with the plasmids CK2αY239Stop and pEVOL-pAzF, expressing the mutated CK2α cellswiththeplasmidsCK2αY239StopandpEVOL-pAzF,expressingthemutatedCK2α(IPTG)andthe (IPTG) and the amber suppressor tRNA (constitutive)/aminoacyl-tRNA synthetase (constitutive/ ambersuppressortRNA(constitutive)/aminoacyl-tRNAsynthetase(constitutive/arabinose),were arabinose), were proven in a volume of 1 mL minimal medium for each case. Cells were boiled for 20 proveninavolumeof1mLminimalmediumforeachcase. Cellswereboiledfor20minat95˝C min at 95 °C and protein lysates were separated on 10% acrylamide. The apparent molecular mass of andproteinlysateswereseparatedon10%acrylamide.Theapparentmolecularmassofthemarker the marker proteins is shown in lane M. Full-length CK2α (40 kDa) could be synthesized in lane 6 and proteinsisshowninlaneM.Full-lengthCK2α(40kDa)couldbesynthesizedinlane6and8,i.e.,when 8, i.e., when all components were present. Because of the stop codon UAG and the lack of pAzF, the allcomponentswerepresent. BecauseofthestopcodonUAGandthelackofpAzF,thetruncated truncated CK2α (28 kDa) appeared in lane 2 and 4. CK2α(28kDa)appearedinlane2and4. For the confirmation of the successful incorporation of pAzF, a Strain Promoted Azide-Alkyne CyFcoloratdhdeitcioonn fi(SrmPAaAtioCn) roefatchtieonsu wccaess psfeurfloirnmcoerdp woritahti oa ndiobfepnAzyzlcFy,caloSotrcatyinneP-rfloumorootpehdoArez i[d31e]-.A Tlhkiys ne Cycclliocka drdeaitcitoionn (iSsP oAnAlyC f)earseiabcleti oinn thwea psrepseernfcoer mofe dpAwzFit hin athde iabmeninzoy laccyicdl osoecqtuyennec-efl uofo rCoKp2hαo.r eTh[e3 1]. Thfiusnccltiicoknarel aacztiidoon igsroounply offe athseib liencionrpthoreatperde suennnceatuorfapl AamzFinion athcied apmAiznFo raecaicdtss einq uae n1c,3e-doifpoClKar2 α. cycloaddition with the DBCO-fluorophore to the specifically labeled CK2α. In this study two ThefunctionalazidogroupoftheincorporatedunnaturalaminoacidpAzFreactsina1,3-dipolar different fluorophores were used for the click reaction, dibenzylcyclooctyne-fluor 545 (DBCO545) cycloaddition with the DBCO-fluorophore to the specifically labeled CK2α. In this study two and dibenzylcyclooctyne-Sulfo -Cy5 (DBCO-Sulfo -Cy5) (Figure 4). The SPAAC reaction between the different fluorophores were used for the click reaction, dibenzylcyclooctyne-fluor 545 (DBCO545) purified CK2α-pAzF (130 µg/mL in buffer P50) and the respective DBCO-fluorophore (50 µM) was anddibenzylcyclooctyne-Sulfo-Cy5(DBCO-Sulfo-Cy5)(Figure4). TheSPAACreactionbetweenthe performed for 1 h in the dark at room temperature (RT). When using SDS-PAGE, CE-measurements purifiedCK2α-pAzF(130µg/mLinbufferP50)andtherespectiveDBCO-fluorophore(50µM)was or flow cytometry, the DBCO-fluorophore coupled CK2α was directly applied. For MST performedfor1hinthedarkatroomtemperature(RT).WhenusingSDS-PAGE,CE-measurementsor measurements, an additional ultrafiltration step (vivaspin500 columns, Sartorius, Göttingen, flowcytometry,theDBCO-fluorophorecoupledCK2αwasdirectlyapplied. ForMSTmeasurements, Germany) was performed in order to remove the unbound fluorophore. anadditionalultrafiltrationstep(vivaspin500columns,Sartorius,Göttingen,Germany)wasperformed The resulting CK2α-DBCO545 was analyzed by gel electrophoresis. As a control purified full inordertoremovetheunboundfluorophore. length CK2α without mutation and hence also without incorporated pAzF, which was incubated wiTthh DeBreCsOul5t4in5 gasC wKe2lαl, -wDaBsC aOna5l4y5zewd aisn acnomalpyazreidsobny. Tgheel pelreoctterionp bhaonrde soifs .CAK2sαa-DcoBnCtOro5l4p5 ucoriufiledd bfeu ll lenvgisthuaClizKe2dα byw ait LhEoDut-ilmluumtaintiaotonr a(4n7d0 hnemn)c aenadl ssohowwietdh othuet eixnpceocrtpeodr faluteodrepscAenzcFe, iwntheincshityw (aFsigiunrceu 5bBa)t.e d witLhacDkBinCgO fl5u4o5reasscweneclel, owf athsea cnoanlytrzoeld CiKn2cαo mwiptharoiusto nin.cTohrpeoprarotetdei npAbzaFn dcoonffiCrmKe2dα -tDheB CbiOoo5r4t5hocgoounldal be visSuPaAlizAeCd cblyicka rLeEaDct-iiolnlu. mThine agteolr w(4a7s0 anlsmo )staanindesdh wowithed Ctohoemeaxspseiec tberdillfliaunotr ebsluceen Gce25i0n tfeonr svitiysu(aFliigzautrieon5 B). Lacokf ianllg pflroutoerines bcaenndcse (oFfigthuerec 5oAn)t.r olCK2αwithoutincorporatedpAzFconfirmedthebioorthogonal SPAACclickreaction. ThegelwasalsostainedwithCoomassiebrilliantblueG250forvisualizationof allproteinbands(Figure5A). Pharmaceuticals2016,9,36 6of15 Pharmaceuticals 2016, 9, 36 6 of 15 Pharmaceuticals 2016, 9, 36 6 of 15 Figure 4. SPAAC click reaction of CK2α-pAzF with the two dibenzylcyclooctyne-fluorophores Figure 4. SPAAC click reaction of CK2α-pAzF with the two dibenzylcyclooctyne-fluorophores DBDCBOFCi5gO4u55r4e5 a4an.n ddSP DADBABCCCO O-cSl-uiSclkufo l rf-eoCayct5-iC,o rnye 5sop,fe crCteiKvsp2eαley-c p(tRiAv1z e=Fl Ny w-ti(etRhrm tihn=ea lt swNeoq-t uederinmbceeinn ozafy lClcKysce2lqαouo-pcetAnyczneFe,- fRlou2f o=r CoCp-Kthe2ormαre-ispn Aal zF, sequence of CK2α-pAzF). For both cases, beside the regi1oisomer 1,4 as shown in the reaction scheme, R =DCB-tCeOrm54i5n aanlds eDqBuCeOn-cSeulofof -CCKy52, αre-sppAecztFiv)e.lyF o(Rr1 b= oNt-htecrmasiensa,l sbeeqsuiednecet hofe CrKe2gαio-pisAozmF,e Rr2 1= ,C4-taesrmshinoawl n in 2the regioisomer 1,5 can be obtained as well. sequence of CK2α-pAzF). For both cases, beside the regioisomer 1,4 as shown in the reaction scheme, thereactionscheme,theregioisomer1,5canbeobtainedaswell. the regioisomer 1,5 can be obtained as well. Figure 5. SDS-PAGE analysis of the SPAAC click reaction between CK2α-pAzF and the fluorophore Figure 5. SDS-PAGE analysis of the SPAAC click reaction between CK2α-pAzF and the fluorophore Figure5.SDS-PAGEanalysisoftheSPAACclickreactionbetweenCK2α-pAzFandthefluorophore DBCO545. Protein solutions were separated on 10% acrylamide. In lane M, the apparent molecular DBCO545. Protein solutions were separated on 10% acrylamide. In lane M, the apparent molecular DBmCaOmss5a s4os5f o.thfP etrh omet emarinakreksroe prl urpotritooetinenisns wsi sie sg rgievivseeennp. .P aPruuarrtiieffidieeddo anann1dd0 cc%oonnaccceernnyttrlraaatmteedidd C CeK.K2I2αnα-lp-apAnAzeFzM F(1 (,11t 1µh geµ)g ai)np i ppnar persereennstecmen caoenl daen cudl ar maasbssaeobnfscetenh ceoefm oDfa BDrkCBeOCrO5p45r54o 5itn ei nian asf ifinisnagal lic vcoeonnncc.eenPntutrraraittfiiiooennd ooaffn 55d00 cµµoMMn c aaerrnee t srshahotoewwdnnC i niKn l2 alαnane-p e2 A 2a znaFdn d(l1a l1naenµ 1eg, )1r,ie nsrpepserpceteisvcetenilvyce.e lya.n d absAesnA ccsoe ncootrfnotDlr oBpl CuprOuifr5iief4id5e dfiu nflula lll efilnenngagtlhthc Co CnKKc2e2ααn t((r22a..8t8 i oµµngg))o wwfii5tt0hhooµuuMtt iinnacrcoeorrpsphoororawatetnedd ip npAAlzaFzn Fwe wa2saa san lasdols loian ncineucb1ua,bteraedtse wpde itwchti itvhe ly. AsDcBoDCnBOtCro5O4l55p4 (u5la r(nilfiaene 3ed) 3. f)(u.A (lA)l P)l erPnortogettiehninsC sw Kwe2erαree s (st2taa.i8inneµeddg w)wwiitthhit CChoooouommtiaanssscsioieer b pbrorilirllilaaitanentd tb blpulAue eGz GF252w05.0 a(.Bs ()Ba Vl)s iVosuiisanulicazulaibtziaaottnie oodnf wofi th DBthCeOt hf5leu4 fo5lur(eolsracenesecnet3n p)t. rp(oArtoe)tienPi nrbo abtnaendind os ofw fC CeKKr2e2ααs-t-DaDiBnBCeCdOO5w544i55t hbbyyC LLoEEoDDm--iailllslusumimeinbinaraitlotlori ar( n4(47t07b 0nl uMneM).G ).2 50.(B)Visualizationof thefluorescentproteinbandofCK2α-DBCO545byLED-illuminator(470nM). 2.42. .P4.r oPorfo ooff oPfh Pohsopshpohroyrlyaltaitoino nA Actcitvivitiyty o of fC CKK22αα--ppAAzzFF//CCKK22αα--DDBBCCOO554455 2.4. ProTofhToehf pePu hprouisfripiefhdieo drCy KClaK2tαi2oα-np-pAAAzctFziF vw iwtayass ot feteCsstKteed2d α oo-nnp ApphhzoFoss/CpphhKoo2rrαyyl-laDattiBiooCnn Oa ac5cti4tvi5vitiyty t otowwaradrsd tsh teh seu sbusbtrsattrea tpee ppteipdtei de RRTRRhRDeRDDpDuDSrDiDfiSDDedDD CDbK yb 2ycα acp-apiplAlilalzrayFry ew elealecsctrttroeopspthehodorreoessniissp [[h223o3]]s..p AAhsso drdyeeslsaccrtriiibobenedda a cabtboivovivet,ey ,t httohe wep haprohdsopsshptohhreoyrlsayutlebadtse tpdrar optedroupdcetup ctti de RR RDDDSDDDbycapillaryelectrophoresis[23]. Asdescribedabove,thephosphorylatedproduct andtheunphosphorylatedsubstratecouldbeseparatedbytheirdifferenceincharge. Theprecisely Pharmaceuticals 2016, 9, 36 7 of 15 Pharmaceuticals2016,9,36 7of15 and the unphosphorylated substrate could be separated by their difference in charge. The precisely ddeetteeccttaabbllee ssiiggnnaall ffoorr tthhee pphhoosspphhoorryylalatteedd pprroodduucct twwaass uusseedd ttoo ddeetteerrmmininee ththee aacctitvivitiyty oof fththee kkininaassee. . AAfftteerr ppuurriiffiiccaattiioonn,, CCKK22αα--ppAAzzFF ((22..66 µµggi inn2 20000µ µLL))e exxhhibibitietedda anna actcitvivitiytyo fo3f .30.404ˆ ×1 100´−55 µµmmooll//mmiinn, ,wwhhiicchh iiss aallmmoosstt iiddeennttiiccaall ttoo tthhee aaccttiivviittyy ooff 33..6666 ˆ× 1100´−5 5µµmmool/lm/mini nofo fththe euunnlalbabeleelded ppuurirfiifieedd CCKK22αα (0(0.2.2 µµgg iinn 220000 µµLL)),, aass rreeppoorrtteedd bbeeffoorree bbyy GGrraattzz eett aall.. [[2211]].. TThhiiss iimmpplliieess tthhaatt tthhee iinnccoorrppoorraattiioonn ooff tthhee uunnnnaattuurraall aammiinnoo aacciidd ddiidd nnoott ssuubbssttaannttiiaallllyy aalltteerr tthhee kkiinnaassee aaccttiivviittyy.. IInn aaddddiittiioonn,, tthhee iinnfflluueennccee ooff tthhee uunnnnaattuurraall aammiinnoo aacciidd ppAAzzFF ffoolllloowweedd bbyy tthhee cclliicckk rreeaaccttiioonn wwiitthh DDBBCCOO554455 oonn tthhee iinntteerraaccttiioonn wwiitthh tthhee CCKK22ββ ssuubbuunniitt wwaass iinnvveessttiiggaatteedd.. TThheerreeffoorree tthhee pphhoosspphhoorryyllaattiioonn aaccttiivviittyy ooff tthhee llaabbeelleedd CCKK22αα--DDBBCCOO554455 aalloonnee aanndd iinn aaddddiittiioonn ooff ppuurriiffiieedd CCKK22ββ wweerree qquuaannttiiffiieedd bbyy ccaappiillllaarryy eelleeccttrroopphhoorreessiiss ((FFiigguurree 66)).. FFoorrt hthisisp puurprpoosese,,p puurirfiifeidedr ergeuglualtaotroyryC KC2Kβ2-βs-usbuubnuintiwt wasaasd addeddetdo tCo KC2Kα2-αD-BDCBOC5O4554i5n ina a1 :11:1ra rtaioti.o.T ThheeC CKK22h hoollooeennzzyymmee,,c coonnssiissttiinngg ooff CCKK22αα--DDBBCCOO554455 aanndd CCKK22ββ,, wwaass aallmmoosstt 88 ttiimmeess mmoorree aaccttiivvee iinn ccoommppaarriissoonn ttoo tthhee CCKK22αα--DDBBCCOO554455 ssuubbuunniitt aalloonnee.. TThhiiss iiss iinn aaccccoorrddaannccee wwiitthh tthhee rraattiiooss iinn tthheea accttivivitiiteiesso offt htheeu unnlalbaebleeldedC KC2Kh2o hlooeloneznyzmyemaen adnCdK C2Kα2aαlo anleonase daess dcreisbcerdibbeedf obreefo[3r2e] [a3n2d] ainnddi cinadteiscathteesf tohrem faotrimonaotifotnh eofC tKhe2 ChoKl2o ehnozlyomenezwymithe pwuitrhif ipeudrCifKie2dβ CaKn2dβC aKn2dα C-DKB2CαO-D5B45C.O545. FFiigguurree 66.. PProrooof foof fiinntteerraaccttioionn bbeettwweeeenn CCKK22ββ aanndd tthhee CCKK22αα--DDBBCCOO--ssuubbuunniitt.. TThhee aaccttivivitiyty ooff CCKK22αα--DDBBCCOO554455 [[˝□]] aalloonneea annddb ybya daddidtiiotinono fopfu priufireifdieCdK C2βK2[(cid:4)β ][■w]a wsaans aalynzaelydzbeyd CbEy aCsEsa ya.ssTahye.r eThweerree wsiegrnei fisicgannitfidcaifnfet rdeinfcfeerseinncaecst iinv iatyct(invi=ty3 (,ne r=r 3o,r ebrarrosr ˘baSrEs M± S,E**M*p, *<**0 p.0 <0 001.0,0u0n1p, auinrepdaitrteeds tt) .test). IInn tthhee nneexxtt sstteepp,, tthhee aaccttiivviittyy ooff tthhee hheetteerrootteettrraammeerriicc CCKK22 ((αα2ββ2) )ininccluluddiningg ppAAzzFF bbeeffoorree aanndd aafftteerr 2 2 the SPAAC click reaction with the fluorophore DBCO545 was tested (Figure 7). The phosphorylated theSPAACclickreactionwiththefluorophoreDBCO545wastested(Figure7). Thephosphorylated substrate (RRRDDDSDDD) was determined after 15, 30 and 45 min. It turned out as shown in Figure 7B, substrate (RRRDDDSDDD) was determined after 15, 30 and 45 min. It turned out as shown in that there was no significant difference in the phosphorylation activity between the labeled and the Figure7B,thattherewasnosignificantdifferenceinthephosphorylationactivitybetweenthelabeled non-labeled CK2 holoenzyme (p > 0.05). This demonstrates that there was no variation of kinase andthenon-labeledCK2holoenzyme(p>0.05). Thisdemonstratesthattherewasnovariationof activity—at least for this peptidic substrate—after performing the SPAAC click reaction with the α- kinaseactivity—atleastforthispeptidicsubstrate—afterperformingtheSPAACclickreactionwith stuhbeuαn-istu. Tbuhnisi ti.nTdhiciastiensd fiocra tthese ffoirrstth teimfier stthtei mmeodthifeicmatoiodnifi ocfa tCioKn2αof wCiKth2 αa fwluiothroapflhuoorer owpihthooreutw loitshso ouft activity by click chemistry. lossofactivitybyclickchemistry. 22..55.. IInntteerraaccttiioonn ooff SSuurrffaaccee--DDiissppllaayyeedd CCKK22ββ aanndd CCKK22αα-D-DBBCCOO554455 IInn aann aaddddiittiioonnaall eexxppeerriimmeenntt,, EE.. ccoollii BBLL2211((DDEE33)) cceellllss ddiissppllaayyiinngg tthhee CCKK22ββ ssuubbuunniitt ((OODD55778 8== 11)), , wwhhiicchh wwaass eennaabblleedd bbyy AAuuttooddisispplalayy,w, wereerein icnucbuabtaedtedw iwthitphu priufireifdieCdK C2Kα-2DαB-DCBOC5O455f4o5r f1ohr 1a th3 7at˝ 3C7a °nCd asnudb sesquubesnetqlyuaennatllyy zeadnbalyyfzleodw cbyyto mfleotwry (Fcyigtuomree8t)r.yT h(eFsiguurfraec e-8d).i spTlahyee dssuorrfbaicteo-lddisephlyadyreodg ensaosrebi[t3o3l] dseehrvyeddroagseannaosen -[b3i3n]d sinergvceodn tarso la. Anohnig-bhienrdminega ncoflnutororel.s cAe nhciegihnetre nmsietyan(m flFu)owreosuceldncine diinctaetnesaitsyp (emciFfi)c wbionudlidn ginadffiicnaittey ao fspCeKc2ifαic-D bBinCdOin5g45 a.fEfi.nciotlyi coefl lCsKdi2sαpl-aDyBinCgOC5K452β. E(.m coFl:i 3c8e0ll0s) dshisopwlaeydinagsi CgnKif2iβca (nmtlFy: h3i8g0h0e)r sfhluoowreesdc ena cesiignnteifnicsaitnyttlyh anhitghheecro nflturoolrceeslclesndcies pilnayteinngsitsyo rbthitaonl dtehhey dcroongternoal sece(lmlsF :d1is0p8)l.ayTihnigs insdoricbaitteodl dtheehyspdercoigfiecnbaisned i(nmgFo:f 1C0K82).α T-DhBisC iOn5d4i5cattoedth ethseu rsfapceec-idfiics pblainydedinCgK o2fβ C-sKub2uαn-Dit.BTChOe5in4n5 otvoa ttihvee lysularbfaecleed- dCiKsp2lαayinedc oCmKb2iβn-astuiobnuwniitt.h TAhue tiondniospvlaatyivaeplyp elaarbsetloedb eCaKn2aαd ivna ncotamgebifnoartfiloonw wcyittho mAeuttroyd-bisapseladys acrpepeenainrsg taos sbaye saton idaednvtaifnytainghei bfiotorr sfloofwth ecyCtKo2mαe/trCyK-b2aβseindt esracrcetieonni.ng assays to identify inhibitors of the CK2α/CK2β interaction. Pharmaceuticals2016,9,36 8of15 Pharmaceuticals 2016, 9, 36 8 of 15 Pharmaceuticals 2016, 9, 36 8 of 15 Figure 7. Phosphorylation activity of the heterotetrameric CK2 with or without coupling to DBCO545 . Figure7.PhosphorylationactivityoftheheterotetramericCK2withorwithoutcouplingtoDBCO545. (A) Comparison of the phosphorylated product between the holoenzyme including CK2α-DBCO545 (A)FCigoumrep 7a. rPishoonspohfotrhyelaptihoons apchtiovriytyla otfe tdhep rhoedteurcottebteratwmeeerinc CthKe2h woliothe norz ywmitheoinuct lcuoduipnlginCg Kto2 DαB-DCBOC5O455. 45 (I, 2.6 µg) and CK2α-pAzF (II, 2.6 µg) is shown in an electropherogram after 30 min incubation with (I,2(A.6) µCgo)manpdarCisKon2 αo-fp thAez pFh(IoIs,p2h.6orµygl)atiesds hporwodnuicnt baentweleeecntr othpeh heroologeranmzymaftee irn3c0lumdiinngi nCcKu2bαa-tDioBnCwOi5th45t he the substrate RRRDDDSDDD. Substrate (S) and product (P) peaks were detected after 3.7 min and 4.3 min, sub(Is,t 2ra.6t eµRgR) aRnDdD CDKS2DαD-pDA.zSFu (bIIs,t 2ra.6t eµ(gS)) ias nsdhopwrond iunc atn(P e)lepcetraokpshwereorgerdaemte acftteedr a3f0t emri3n. 7inmcuinbaatniodn4 w.3itmh in, respectively. (B) The activities of the holoenzymes consisting of CK2α-pAzF [□] as well as CK2α- restpheec stuivbesltyr.a(tBe R)TRhReDaDctDivSiDtiDesDo.f Stuhbeshtroaltoee (nS)z aynmde psrcoodnuscist t(iPn)g poeafkCsK w2eαr-ep dAezteFct[e˝d] aasftwere 3l.l7a msCinK a2nαd- 4D.3B mCOin5, 45 DBCO545 [■] were analyzed after 15, 30 and 45 min for each sample by CE. Mean values ± standard [(cid:4)]rewspeerectaivneallyy.z (eBd) aTfhteer a1c5t,iv3i0tiaens dof4 5thme ihnoflooreneazcyhmseasm copnlesibsytinCgE o.Mf CeKan2αv-aplAuezsF ˘[□s]t aans dwaredll earsr oCrKs2oαf-the errors of the means (SEM) from three independent experiments are given (not significant, p > 0.05). meDanBsC(OS5E4M5 )[■fr]o wmerteh raeneailnydzeedp eanftdeer n1t5e, x3p0 earnimd e4n5 tmsainre fogriv eeanch(n soatmspiglen ibfiyc aCnEt., Mp>ea0n.0 v5a).lues ± standard errors of the means (SEM) from three independent experiments are given (not significant, p > 0.05). Figure 8. Proof of interaction between surface-displayed CK2β and CK2α-DBC O545-subunit. CK2β, which was translocated on the surface of E. coli by Autodisplay, was incubated for 1 h at 37 °C with Figure 8. Proof of interaction between surface-displayed CK2β and CK2α-DBCO545-subunit. CK2β, Figpuurreif8ie.dP rsopoecfiofifcainlltye rlaabcetiloedn CbeKt2wαe-DenBCsuOr5fa4c5e. -Tdhies pblianydeindgC aKff2inβitayn odf CCKK22βα a-DndB CCKO25α4-5D-sBuCbOu5n4i5t. (CreKd2, β, which was translocated on the surface of E. coli by Autodisplay, was incubated for 1 h at 37 °C with whmicFh =w 3a8s0t0r)a nwsalso caantaeldyzoend tbhye sfluorwfa ccyetoofmEe.trcyo.l iAbsy aA nuotno-dbiisnpdlianyg, wcoanstrinolc,u sbuartfeadcef-doris1plhayaetd3 7so˝rCbitwoli th purified specifically labeled CK2α-DBCO545. The binding affinity of CK2β and CK2α-DBCO545 (red, purdiefiheyddsrpoegceinfiacsael l[y33l]a bwealse dusCeKd 2(gαr-eDyB, mCOF 5=4 150.8T).h ebindingaffinityofCK2βandCK2α-DBCO545(red, mF = 3800) was analyzed by flow cytometry. As a non-binding control, surface-displayed sorbitol mF=3800)wasanalyzedbyflowcytometry. Asanon-bindingcontrol,surface-displayedsorbitol dehydrogenase [33] was used (grey, mF = 108). 2.6d. eChlyicdkr oCgheenmaissetr[y3 3o]f wCKas2uβ-sAedT (ognre tyh,em SFur=fa1c0e8 o).f E. coli 2.6. CIlnic ka dCdheitmioisnt rtyo o ft hCeK 2spβ-eAciTfi coanl ltyh e lSaubreflaecde oCf KE2. αco lsiu bunit, Autodisplay [34] was used for a site- 2.6d.iCrelicctkedC hmemodisitfricyaotifoCnK o2fβ t-hAeT CoKn2tβh esSuubrufnacite bofy Ea. fclouloirophore on the surface of E. coli. The subunit In addition to the specifically labeled CK2α subunit, Autodisplay [34] was used for a site- CK2β was chosen for the translocation on the surface, because the β-subunit first forms dimers, and dirIenctaeddd mitioodniftiocathtieons poefc itfihcea CllKy2laβb seulebdunCiKt 2bαy sau fbluuonriot,pAhuorteo doinsp tlhaey s[u34rf]awcea sofu Ese. dcofloi.r Tahseit esu-dbiurencitt ed subsequently CK2α is bound to yield the formation of heterotetrameric CK2. Tyrosine Y108 of the β- moCdKifi2βca wtiaosn cohfotsheen CfoKr 2thβe sturabnusnloitcabtyioan floun othroep shuorfraeceo,n btehcaeussuer tfhaec eβo-sfuEb.ucnoilti .fiTrshte fosrumbsu ndiitmCerKs2, βanwd as subunit was chosen for the incorporation of the unnatural amino acid pAzF. Besides the structural chosusebnsefqourethnetlytr CanKs2loαc iast iboonunond ttho eysieulrdf athcee, fboermcaautsioenth oef βhe-steurboutentirtafimrestrifco CrmKs2.d Timyreorssin,aen Yd10su8 bosfe tqhue eβn-tly similarity of tyrosine in comparison to pAzF as described above, the corresponding position is located CKs2uαbuisnibt owuansd chtoosyeine lfdort htehef oinrmcoartpioornatoiofnh eotfe trhoete utrnanmateurriacl CaKm2in.oT yarcoids ipnAezYF1.0 B8eosifdtehse tβhe-s sutrbuucntuitrawl as at the periphery of the β-subunits structure. Y108 has a sufficient distance to the dimerization site of chosismenilafroirtyt hofe tiynrcoosirnpeo irna ctioomnpoafritshoenu ton npaAtzuFr aals admesicnriobeadci adbpovAez, Fth.eB ceosridreessptohnedsintrgu pcotusirtaiolns iims liolcaartietyd of CK2β and to the interaction site with CK2α, which is supposed to facilitate a modification with a at the periphery of the β-subunits structure. Y108 has a sufficient distance to the dimerization site of tyrosine in comparison to pAzF as described above, the corresponding position is located at the fluorophore by click reaction without structural restrictions. CK2β and to the interaction site with CK2α, which is supposed to facilitate a modification with a peripheryoftheβ-subunitsstructure. Y108hasasufficientdistancetothedimerizationsiteofCK2β The plasmid pCK2β-AT, which contains the gene encoding the CK2β autotransporter fusion fluorophore by click reaction without structural restrictions. andtotheinteractionsitewithCK2α,whichissupposedtofacilitateamodificationwithafluorophore protein (CK2β-AT), previously described by Gratz et al. [21], was used for the incorporation of the The plasmid pCK2β-AT, which contains the gene encoding the CK2β autotransporter fusion byclickreactionwithoutstructuralrestrictions. unnatural amino acid pAzF followed by the SPAAC click reaction. Consequently, site-directed protein (CK2β-AT), previously described by Gratz et al. [21], was used for the incorporation of the muTthaegepnleassims widasp CusKe2dβ t-oA mT,owdihfyic thhec ognetnaei nesnctohdeingge nCeKe2nβc-oAdTi,n rgestuhletinCgK i2nβ thaeu troetprlaancesmpoerntte roff uthseio n unnatural amino acid pAzF followed by the SPAAC click reaction. Consequently, site-directed proctoedinon( CfoKr Y2β10-A8 T(T)A, pCr)e bvyi othues laymdbeers csrtoibpe cdodboyn GTAraGtz. Tehtea clo.r[r2e1s]p,owndaisngu pseladsmfoird wthaes innacmorepdo prCatKio2nβ-of mutagenesis was used to modify the gene encoding CK2β-AT, resulting in the replacement of the theunnaturalaminoacidpAzFfollowedbytheSPAACclickreaction. Consequently,site-directed codon for Y108 (TAC) by the amber stop codon TAG. The corresponding plasmid was named pCK2β- mu tagenesiswasusedtomodifythegeneencodingCK2β-AT,resultinginthereplacementofthe cod on for Y108 (TAC) by the amber stop codon TAG. The corresponding plasmid was named Pharmaceuticals2016,9,36 9of15 Pharmaceuticals 2016, 9, 36 9 of 15 pCK2β-ATY108Stop andencodedacarbenicillinresistance. ThebiosynthesisofCK2β-AT-pAzFwas agaAinTYc10o8nStotpr oalnledd ebnycothdeedT 7a- pcraorbmeonticoirl.liEn .rceosliisBtaLn2c1e(. DTEh3e) bcieolslsynwthereesitsr aonf sCfoKr2mβe-AdTw-pitAhzbFo wthaps laagsmainid s, pCcKo2nαtrYo2l3le9Sdt opbya ntdhep TE7V-pOrLo-mpoAtozrF., aEs. dcoelsi cBriLb2e1d(DaEb3o)v ece.llTs hweefruel ltlreanngsftohrmCKed2 βw-fiuths iobnothp roptlaesinmcidosu, ld onlpyCbKe2αsyY2n39tShtoep sainzded pEinVOcaLs-epAboztFh, apsl adsemscirdibsewd earbeovper.e Tsehne tfuinll olennegtche lClKa2nβd-faufstieornt phreoatedind ictoiounldo ofnblyo th indbuec seyrnst(hIePsTizGed/ ainra cbaisneo bsoet)h. pFliansamlliyd,su wnneraet uprraesleanmt iinn oonaec icdellp aAnzdF awftears threeq audidreitdiotno obf eboptrhe sinednutcinersth e gro(wIPtThGm/aerdabiuinmosaes).w Feinlla.lIlny, ourdnnerattuoraaln aalmyzineot haecisdu cpcAeszsFf uwlains croerqpuoirreadti otno obfep pArezsFeinnt CinK t2hβe dgirsopwlatyhe d attmheedcieulmls uasr fwaceell,. tIhne oSrPdAerA toC acnliaclkyzree athceti osuncwceasssfpuel rinfocromrpeodrawtioitnh owf hpoAlzeFc einll sCoKf2Eβ .dcioslpi.laAyseda acto tnhter ol, baccteelrl isaulrcfaeclles, tdhies pSlPaAyiAnCg cCliKck2 βrewacittihono uwtatsh peeirnfcoormrpeodr watietdh wunhnoalet ucerlalls aomf Ei.n coolai.c Aids oa ncotnhteroslu, rbfaaccteerwiael re appcelilelsd dtiospthlaeyisnagm CeKp2rβo cwedituhoreu.t the incorporated unnatural amino acid on the surface were applied to the same procedure. ThedensityofbothcellpopulationswassettoanOD =1andincubatedwiththefluorophore 578 DBCO5T4h5e( 5d0enµsMity) foof rb1ohtha cteRllT p.oApfutelartitohnres ewwasa ssheti ntog asnte OpDs,5c78e =ll s1 wanedre inscuubbsaetqeude wntitlhy tahnea fllyuzoerdopbhyoflreo w DBCO545 (50 µM) for 1h at RT. After three washing steps, cells were subsequently analyzed by flow cytometry (Figure 9). It could be shown that there was a significantly higher fluorescence for the cytometry (Figure 9). It could be shown that there was a significantly higher fluorescence for the E. E.colicellsdisplayingCK2β-AT-DBCO545(mF=1495)incomparisontothecontrolcells(mF=120). coli cells displaying CK2β-AT-DBCO545 (mF = 1495) in comparison to the control cells (mF = 120). The bioorthogonal click reaction with proteins on the surface of bacterial cells could be used for The bioorthogonal click reaction with proteins on the surface of bacterial cells could be used for methods, based on fluorescence detection. Moreover this approach could overcome the need of methods, based on fluorescence detection. Moreover this approach could overcome the need of purifyingproteinsforbindingstudies. purifying proteins for binding studies. FigFuigreur9e. S9.P SAPAACACre arecaticotinono foCf CKK2β2β-A-ATT-p-pAAzzFFa annddD DBBCCOO554455 oonn tthhee ssuurrffaaccee ooff EE. .ccoolil.i .CCeelllsl s(O(ODD578 = 1=) 1) 578 displaying CK2β-AT-pAzF were incubated with the fluorophore DBCO545 (50 µM) for 1h at RT. After displayingCK2β-AT-pAzFwereincubatedwiththefluorophoreDBCO545(50µM)for1hatRT.After three washing steps, E. coli displaying CK2β-AT-DBCO545 (red, mF = 1495) were analyzed by flow threewashingsteps,E.colidisplayingCK2β-AT-DBCO545(red,mF=1495)wereanalyzedbyflow cytometry. As a control, surface translocated CK2β-AT without incorporated unnatural amino acid cytometry. Asacontrol,surfacetranslocatedCK2β-ATwithoutincorporatedunnaturalaminoacid pAzF was applied and treated identically (grey, mF = 120). pAzFwasappliedandtreatedidentically(grey,mF=120). 2.7. Application of CK2α-pAzF for MST Measurements 2.7. ApplicationofCK2α-pAzFforMSTMeasurements The specifically labeled CK2α can be used for different approaches based on fluorescence deTtehcetisopne. ciMficicarlloysclaablee lethdeCrmK2oαphcoarnesbies u(sMedSTfo)r dreifpfereresennttasp par oraeclhateisveblays endeown flaupoprleicsacetinocne dine tetchteio n. Midcreotesrcmalienathtieornm oofp hdoisrseoscisia(tMionS Tc)ornesptarenstes n(tKsDa) reolfa tbivinedlyinng ewpaartpnperlisc a[t1io3]n. iHnetrhee, dtheete rcmhainnagtei oonf of distshoecrimatoiopnhcoorenssitsa onft sa( Kfluo)roefsbceinndt ipnrgotpeainrt ninedrsu[c1e3d] .bHy ethree, bthinedcihnagn ogfe aonf tuhnelrambeolpedh oinretesirsacotfioanfl upaorrtensecre nt D proiste dineteinctdeudc. eInd tbhyis tshtuedbyi nMdSinTg moefasaunreumnelanbtse lwederein uteserdac ttoio dnetpearmrtinneer tihsed deistesoctceiadt.ioInn ctohnisstastnut doyf tMheS T mewaseullr-kemnoewnnts inw veirterou CsKed2 stuobdstertaetrem αiSn1-ecatsheeind [3is5s]o wciiathti oCnK2cαo n(Fstiagnutreo 1f0t)h. e well-known invitro CK2 substraTtehαe SP-cAaAseCin c[l3ic5k] rweaitchtiConK w2αas( Fpiegruforerm10e)d. as mentioned before using the fluorophore DBCO- S1 SuTlfhoe-CyS5P.A SAubCseqculiecnktlyr,e daciftfieornentw caosncepnetrrfaotriomnes dof hasummanen αtSi1o-cnaesdeinb reafnogreingu fsrionmg 0t.h76e nflMu toor o12p.h50o re DBµCMO -Swuelrfeo -Cadyd5.edS utbos eaq uceonntslyta,ndti ffveorelunmtceo nocf enCtKra2tαio-DnsBCofOh-Suumlfaon-Cαy5 -c(6a5se innMra).n gAin gdiffrfoermen0c.e7 6inn M S1 to t1h2e.5rm0oµpMhowreesries oafd dtheed αt-osuabcuonnits tiann dtevpoelnudmeencoef oCf Kth2eα -αDS1B-cCaOse-iSnu clofon-cCenyt5ra(t6io5nn Mwa)s. Adedteicffteerde nanced in thecromnfoiprmhoedre αsiSs1-coafstehine aαs- sau bbiundniintgin pdaretpneenr dofe nCcKe2oαf (tFhigeuαre 1-c0aAs)e. iTnhceo dnicfefenrternacteio inn wthaes fldueotreecstceedncaen d S1 levels between the unbound and the bound state resulted in a sigmoidal plot (Figure 10B) and confirmedα -caseinasabindingpartnerofCK2α(Figure10A).Thedifferenceinthefluorescence S1 enabled the determination of a KD value of 631 ± 86.2 nM. This dissociation constant of CK2α and levelsbetweentheunboundandtheboundstateresultedinasigmoidalplot(Figure10B)andenabled human αS1-casein has not been described before. The KD of CK2 with a bovine casein mixture, thedeterminationofaK valueof631˘86.2nM.ThisdissociationconstantofCK2αandhuman however, has been meaDsured by surface plasmon resonance spectroscopy, which was in the same α -caseinhasnotbeendescribedbefore. TheK ofCK2withabovinecaseinmixture,however,has S1order of magnitude as the KD for CK2α and huDman αS1-casein as obtained here [36]. This seems to beenmeasuredbysurfaceplasmonresonancespectroscopy,whichwasinthesameorderofmagnitude indicate that the CK2α click chemistry in combination with MST measurements provides a as the K for CK2α and human α -casein as obtained here [36]. This seems to indicate that the convenDient method for the idenSt1ification and characterization of new interaction partners or CK2αclickchemistryincombinationwithMSTmeasurementsprovidesaconvenientmethodforthe inhibitors. identificationandcharacterizationofnewinteractionpartnersorinhibitors. Pharmaceuticals2016,9,36 10of15 Pharmaceuticals 2016, 9, 36 10 of 15 FiguFrigeu1r0e. 1I0n. teInratecrtaioctnioonf oCf KC2Kα2-αD-BDCBOCO-S-uSulflofo-C-Cyy55a anndd hhuummaann ααSS11--ccaasseeiinn. .TToo aa ccoonnsstatannt taammouonutn tofo f CK2CαK(26α5 (n6M5 n)Mα) α-Sc1a-csaesineinw wasasti ttritartaetdedi nind dififfeferreenntt ccoonncceennttrraattiioonnss,, rraannggiinngg frfroomm 00.7.76 6nnMM tot o121.25.05 µ0MµM. . S1 (A)(TAh)e Tnhoer mnoarlmizaeldizfledu oflrueoscreenscceenscieg nsiaglnsaolfs tohfe ththee trhmerompohpohreosriessoisf o1f5 1d5i fdfeifrfeenretndti lduitluiotniosnosf oαf αS-1c-acsaesienini n S1 presienn pcreeosefnthcee oCfK th2eα CsuKb2uαn siutbwuenriet rweceorerd reedco.r(dBe)dT. h(Be)K Thve aKluD evoaflu6e3 1of˘ 63816 .±2 8n6M.2 wnMas wdeatse drmetienremdinfreodm D from three independent experiments using NT Analysis 1.5.41 software (NanoTemper Technologies threeindependentexperimentsusingNTAnalysis1.5.41software(NanoTemperTechnologiesGmbH, GmbH, München, Germany). München,Germany). 3. Materials and Method 3. MaterialsandMethod 3.1. Bacterial Strain and Culture Conditions 3.1. BacterialStrainandCultureConditions Escherichia coli BL21(DE3) was used for the biosynthesis of proteins. Cells were routinely EscherichiacoliBL21(DE3)wasusedforthebiosynthesisofproteins.Cellswereroutinelycultivated cultivated in lysogeny broth (LB) supplemented with chloramphenicol (30 mg/L) and/or carbenicillin inlysogenybroth(LB)supplementedwithchloramphenicol(30mg/L)and/orcarbenicillin(50mg/L) (50 mg/L) depending on the antibiotic-resistance factor(s) encoded on the DNA plasmid(s). For the dependingontheantibiotic-resistancefactor(s)encodedontheDNAplasmid(s). Forthecultivationof cultivation of cells with surface-displayed proteins, additionally 10 µM ethylenediaminetetraacetate cellswithsurface-displayedproteins,additionally10µMethylenediaminetetraacetate(EDTA)and (EDTA) and 10 mM 2-mercaptoethanol were added to the LB medium. E. coli, which were used for 10mthMe i2n-cmoerprcoarpattiooenth oafn tohlew uenrneaatudrdael damtointhoe aLciBd mpAedziFu, mw.eEre. croolui,twinheliych gwroewren uins emdifnoirmtahle minecdoirupmo r(aptHio n ofth7,e 3u4n mnaMtu Nraal2HamPOin4o, 2a2c imdMpA KzHF,2wPOer4,e 1r0o0u µtiMne lCyagCrlo2,w 1n minMm MingiSmOa4l, 3m0e µdgiu/mmL( pthHia7m,i3n4e,m 0M.1%N Na2HH4PCOl, 4, 22m0.M2%K gHlu2cPoOse4,, 2120 0nMµM FeC(IaICI)lC2,l31). mBaMcteMrigaSl Oce4l,ls3 w0µerge/ gmroLwthni aatm 3i7n e°C,0 w.1%ithN shHa4kCinl,g0 (.220%0 grplumco) suen,t2il2 annM Fe(IOIID)C57l83 )o.f B0a.6ct ewriaasl creeallcshwede.r ePrgortoewinn eaxtp3re7ss˝iConw withas shinadkuincegd( 2b0y0 trhpem a)dudnittiiolna noOf Diso57p8roopfy0l.-6β-wD-as reacthhieodg.alParcototepiynraenxopsriedses (iIoPnTGw)a tso ian dfiunacle dcobnycetnhtreaatidodn iotifo 1n moMf i saonpdr/oorp ayrla-βbi-nDo-sthe i(o0g.2a%la).c topyranoside (IPTG)toafinalconcentrationof1mMand/orarabinose(0.2%). 3.2. Design of pCK2αY239Stop and pCK2β-ATY108Stop Plasmids 3.2. DesignofpCK2αY239StopandpCK2β-ATY108StopPlasmids For the generation of the mutant pCK2αY239Stop, the plasmid pT7-7CK2α was used as template. SiFteo-rdtirheectgeedn meruattaiognenoefsitsh ewmasu ptearnftorpmCeKd2 bαyY 2t3h9eS toups,e tohfe tphela QsmuiicdkCpTh7an-7gCeK p2rαotowcaosl (uSstreadtaagsenteem) apnladt e. Sitet-hdeir ectfeodllomwuintagg enpersiimsewrsa, s pwerhfoerrem edthbey thmeuutasteedo f thceodQouni ckCish ansgheowpnro tocino l (Sbtoraldtafagceen: e) 5a′n-d theCfoCllToCwAinCgCpArAimCeTrGs,AwThCeCreTAthAeTmTuGtTaCteAdTcGoTdConCAisTsGho-3w′ ninboldface: 51-CaCnTd CACCAACTGATC5C′-T AATCTAGTTGCGAATCGATTCGCAACTAGA-3T1TaAnGdG51A-CTACTAGGGTTAGCGATTGGAAGCGA-3A′.T PTlAasGmGidA TpCCAKG2αTYT23G9StGop TwGaAs GoGbt-a3i1n.ePdl.a Tsmhei d pCKd2eαsiYg2n39 aStnodp wcoanssotrbutactinioend .oTf htheed peslaigsmnaidn denccoondstirnugc tfioorn thofe tahuetpoltarasmnsipdoerntecro dfuinsigonfo prrthoeteainu tpoCtrKan2sβp-AorTte r fusihoans palrroetaediny bpeCeKn 2dβes-AcrTibehda sina dlreetaadily eabrelieenr [d21e]s.c Friobre tdhei ncodnesttrauilcteiaornl ioefr p[C21K]2.βF-AorTYt1h08eStocpo, nthsetr pulcatsimonido f