Logout succeed
Logout succeed. See you again!

Testing foundations of modern cosmology with SKA all-sky surveys PDF
Preview Testing foundations of modern cosmology with SKA all-sky surveys
Testing foundations of modern cosmology with SKA all-sky surveys 5 1 Dominik J. Schwarz∗,1 David Bacon,2 Song Chen,1 Chris Clarkson,3 Dragan 0 2 Huterer,4 Martin Kunz,5,6 Roy Maartens,7,2 Alvise Raccanelli,8,9,10 Matthias Rubart,1 n Jean-Luc Starck11 a 1FakultätfürPhysik,UniversitätBielefeld,33501Bielefeld,Germany;2InstituteofCosmology J &Gravitation,UniversityofPortsmouth,PortsmouthPO13FX,UnitedKingdom;3Centrefor 5 1 Astrophysics,Cosmology&GravitationandDepartmentofMathematics&Applied Mathematics,UniversityofCapeTown,CapeTown7701,SouthAfrica;4DepartmentofPhysics, ] O UniversityofMichigan,AnnArbor,MI48109-1040,USA;5UniversitédeGenève,Département C dePhysiqueThéoriqueandCAP,CH-1211Genève4,Switzerland;6AfricanInstitutefor . MathematicalSciences,CapeTown7945,SouthAfrica;7PhysicsDepartment,Universityofthe h WesternCape,CapeTown7535,SouthAfrica;8DepartmentofPhysics&Astronomy,Johns p - HopkinsUniversity,3400N.CharlesSt.,Baltimore,MD21218,USA9JetPropulsion o Laboratory,CaliforniaInstituteofTechnology,PasadenaCA91109,USA;10CaliforniaInstitute r t ofTechnology,PasadenaCA91125,USA;11LaboratoireAIM,UMRCEA-CNRS-Paris,Irfu, s a SAp,CEASaclay,F-91191Gif-sur-YvetteCEDEX,France [ E-mail: [email protected] 1 v 0 ContinuumandHIsurveyswiththeSquareKilometreArray(SKA)willallowustoprobesomeof 2 themostfundamentalassumptionsofmoderncosmology,includingtheCosmologicalPrinciple. 8 3 SKA all-sky surveys will map an enormous slice of space-time and reveal cosmology at super- 0 horizonscalesandredshiftsoforderunity.Weillustratethepotentialofthesesurveysanddiscuss . 1 theprospectstomeasurethecosmicradiodipoleathighfidelity. Weoutlineseveralpotentially 0 5 transformationaltestsofcosmologytobecarriedoutbymeansofSKAall-skysurveys. 1 : v i X r a AdvancingAstrophysicswiththeSquareKilometreArray June8-13,2014 GiardiniNaxos,Italy ∗Speaker. (cid:13)c Copyrightownedbytheauthor(s)underthetermsoftheCreativeCommonsAttribution-NonCommercial-ShareAlikeLicence. http://pos.sissa.it/ Foundationsofmoderncosmology DominikJ.Schwarz 1. Introduction TheSquareKilometreArray(SKA)willallowustotestfundamentalassumptionsofmodern cosmology at redshifts of order unity and at an accuracy level matching and complementing the highfidelityobservationsofthecosmicmicrowavebackground(CMB). The Cosmological Principle states that the Universe is spatially isotropic and homogeneous. Thisholdsonsufficientlylargescalesandneedstobeinterpretedinastatisticalsense. Historically, itprovidedaverypowerfulmotivationtosingleouttheFriedmann-Lemaîtremodelsdespitealack ofknowledgeregardingtheinitialconditionsoftheUniverse. Cosmologicalinflation,proposedin the1980s,allowedtheUniversetostartfromareasonablysmallpatchofalmosthomogeneousand isotropicspace. Accordingtotheideaofcosmologicalinflation,suddenlyatleastonesmallpatch isinflatedtocontaintoday’sobservableUniverse. Inthecourseofinflation,anypreviouslyexisting anisotropyorinhomogeneityisexponentiallydiluted. However,unavoidablequantumfluctuations aresqueezedbytherapidexpansionduringinflationandbecometheseedsforlargescalestructure. TheresultisastatisticallyisotropicandhomogeneousUniverse(atleastlocally). These ideas are confirmed by the observed high degree of isotropy of CMB radiation, which enablesustodefineaCMBframebymeasuringatemperaturemonopole,T =2.2755±0.0006K 0 and dipole, T =3.355±0.008mK towards (l,b)=(263.99◦±0.14◦,48.26◦±0.03◦) (Hinshaw 1 et al. 2009). The concept of a spatially homogeneous Universe allows us to speak about a cosmic timeoranageoftheUniverse. BymeasuringtheCMBtemperatureT andthepresentexpansion 0 rateoftheUniverseH wecananchorthethermalhistoryoftheUniversetoitsexpansionhistory. 0 Radio surveys played an important role to establish that the Universe extends to redshifts beyond unity and that it is almost isotropic [see e.g. Ryle & Clarke (1961)]. Today, observations of the CMB confirm the predictions of cosmological inflation impressively (Planck collaboration 2014a; 2014b). However, it is unknown for how long (or how many e-foldings) inflation took place. In order to explain the observed spatial flatness of the Universe, about 50 to 60 e-foldings could be enough, but in many models it took much longer, i.e. the domain in which the statistical cosmological principle applies is expected to be much larger than the observable Universe. The quest to determine the duration of inflation, as well as the related question of the topology of the Universe,canonlybeansweredbyobservingthebiggestscales. Interestingly enough, the CMB exhibits unexpected features at the largest angular scales, among them a lack of angular correlation, alignments between the dipole, quadrupole and oc- tupole, hemispherical asymmetry, a dipolar power modulation, and parity asymmetries (Planck collaboration2014c;Copietal. 2013a;2013b). Understandingthestatisticalsignificanceofthese anomalies is a hot topic (Bennett et al. 2013; Starck et al. 2013; Rassat et al. 2014) since lack of statisticalisotropyorGaussianitycouldruleoutthestandardcosmologicalmodel. Astheprecision oftheseCMBmeasurementsislimitedbyourunderstandingoftheforegroundsandobservational uncertainties are already much smaller than the cosmic variance at those scales, it is very hard to identifythecauseoftheseanomalieswithoutanindependentprobeatthesamescales. However,basedontheobservedCMBanisotropiesanddespiteoftheseanomalies,deviations from statistical isotropy have to be small. The observational situation is less clear for the case of statistical homogeneity, as testing the assumption of isotropy is much simpler than testing homo- geneity(Maartens2011;Clarkson2012). 2 Foundationsofmoderncosmology DominikJ.Schwarz SKA will probe an enormous number of independent modes when studying the large-scale structure of the Universe and will measure superhorizon sized modes at redshifts of order unity (better than any existing or planned infrared, optical, or X-ray campaign). This will enable us to probe scales that have not been in causal contact since the first horizon crossing during inflation and that contain information that was frozen in during cosmological inflation. In contrast to the CMB, the radio sky provides a probe of those largest scales at a redshift of order unity (2D for continuumsurveysand3DforHIsurveys). SKAwouldenableseveraltestsofthefundamentalcosmologicalprinciples. Forexample,the restframesoftheCMBandlargescalestructure(LSS)maynotcoincideduetonovelsuperhorizon physics — for example, presence of isocurvature modes (Erickcek et al. 2008). SKA’s width and depth will enable a measurement of the kinematic dipole with respect to the LSS reference frame via the relativistic aberration and Doppler shift (“bunching up” of SKA sources in the direction of the dipole). This, when combined with the CMB’s own measurement of the kinematic dipole would, for the first time, enable the test of whether the two reference frames — that of the CMB andtheLSS—areoneandthesame,asdemandedbytheCosmologicalPrinciple. Here we describe how to use all-sky (3π) SKA continuum surveys to test statistical isotropy and to measure the cosmic dipole and other low-(cid:96) multipole moments. These issues are tightly connected to tests of non-Gaussianity and the topology of the Universe, the former aspect is de- scribed in Camera et al. (2015). All-sky SKA HI threshold surveys will additionally allow us to testthehomogeneityoftheUniverseatsuperhorizonscales–atestthathasneverbeforebeenper- formed. Statisticalhomogeneityandisotropyareassumedtoholdtrueinothercosmology-related contributionstothisbook(Bulletal. 2015;Raccanellietal. 2015). Testsofstatisticalisotropyand homogeneity will also allow (and force) us to dig deep into the systematics of SKA surveys and thushelptoputallcosmologicalandnon-cosmologicalresultsofSKAsurveysonfirmgrounds. The conceptually simplest probe of cosmology is differential number counts (de Zotti et al. 2010). If no redshift information is available, one can count the number of (extragalactic) radio sourcespersolidangleandfluxdensity. Besidesfluxcalibrationissues,thecosmologicalinforma- tion contained in differential number counts is limited by the diversity of radio sources and their luminosityanddensityevolution. Radiosourcesfallintotwoprincipalclasses,activegalacticnu- clei(AGN)andstarforminggalaxies(SFG).TheexquisiteangularresolutionofSKAsurveyswill allowustoresolvemostoftheAGNsandthustoobtainanextrahandlebasedonmorphology. An- otherpossibilitytoovercometherestrictionsfromevolutionistostudythedirectionalfluctuations ofdifferentialnumbercounts(Raccanellietal.2012;Chen&Schwarz2014),aswedonotexpect thatthepropertiesofradiosourceswouldsingleoutpreferreddirectionsintheUniverse. AllSKAforecastspresentedinthisworkassumethebaselinedesignandimagingcapabilities aspresentedinDewdneyetal.(2013);Brown(2014). 2. Cosmicradiodipole(EarlyScience,SKA1&SKA2) The CMB dipole is generally assumed to be due to our peculiar motion and thus defines a cosmic reference frame. However, the observation of the dipole in the microwave sky alone does notallowustotellthedifferencebetweenamotion-inducedCMBdipoleanddipolecontributions fromotherphysicalphenomena[e.g.themodelinErickceketal.(2008)]. 3 Foundationsofmoderncosmology DominikJ.Schwarz SKA3π surveys EarlyScience SKA1 SKA2 (centr.frequency,ang.res.) LOW(151MHz,10”) 1.0×108 (20 µJy) 2.4×108 (10µJy) 2.2×109 (1µJy) MID/SURB1(610MHz,1”) 7.8×107 (10 µJy) 1.9×108 (5µJy) 1.8×109 (0.5µJy) MID/SURB2(1.4GHz,0.5”) 3.8×107 (10 µJy) 9.7×107 (5µJy) 1.2×109 (0.5µJy) Table1: Expectedtotalnumberofradiosources(10σ)invariousfrequencybandsandsurveyinstruments, assumingtheSKAbaselinedesignandthecosmologyanddifferentialnumbercountsassimulatedinWilman etal.(2008). Inordertomatchobservationsat1.4GHz,thenumberofSFGhasbeenmultipliedbyafactor of 2.5 compared to the simulations for all frequency bands. The numbers in brackets denote the assumed rmsnoiselevels. Due to the effects of aberration and Doppler shift, the kinetic dipole must also be present in radioobservations(Ellis&Baldwin1984). Besidesthekineticdipole,wealsoexpectcontributions from the large-scale structure and from Poisson noise. Such a radio dipole has been looked for in radio source catalogues, such as NVSS (Blake & Wall 2002; Singal 2011; Gibelyou & Huterer 2012;Rubart&Schwarz2013)andWENSS(Rubart&Schwarz2013)andwasfoundwithinlarge error bars. While the direction of the observed radio dipole is consistent with the CMB dipole direction,itsamplitudeexceedsthetheoreticalexpectationsbyafactorofafew. SKAwillenable us to measure the radio dipole with high accuracy and to extract other low-(cid:96) multipole moments. Recently,thePlanckmissionreportedafirstdetectionoftheeffectsofaberrationandDopplershift athighmultipolemoments(Planckcollaboration2014d). However,thisobservationislessprecise thanthereportedmeasurementsoftheradiodipoleandallowsforaprimordialcontributiontothe CMBdipoleofcomparablesize. The SKA will allow us to compare d(cid:126) to d(cid:126) , since SKA will test a super-horizon sized radio cmb volume. Any statistically significant deviation will be exciting, while finding a match would put theconcordancemodelonfirmergrounds. SKA continuum surveys at low frequencies (<1GHz) should be ideal to probe the cosmic radio dipole already in the Early Science phase for two reasons. First, it is not necessary to cover the full area of the 3π surveys, since a sparse sampling spread out over all of the accessible sky shouldbesufficientforafirstestimate. Andsecond,afocusonlowfrequenciesandbrightsources willpickprimarilyAGNswhichhaveamuchhighermeanredshiftthantheSFG. Figure 1 illustrates the accuracy that we can hope to achieve for a measurement of the radio dipole based on a linear estimator (Crawford 2009; Rubart & Schwarz 2013). Our estimates are basedondifferentialnumbercountsfromsurveysinsmallanddeepfieldsandsimulations(Wilman et al. 2008). Our expectations for all-sky continuum surveys are summarized in Table 1. We find that the cosmic radio dipole can be measured at high statistical significance, even taking realistic datacutsintoaccount(e.g. maskingthegalaxyandverybrightextragalacticsources,ormorphol- ogy,spectralindexorfluxcuts). Amajorconcernmightbetheeffectoffluxcalibrationerrorsonthedipoleestimation. Thishas beenstudiedbymeansofsimulations. Theresultsofthisstudyareshowninfigure2. Weassume Gaussian flux density errors with variance σ(δ)S, where S denotes the expected flux density of a particular source and δ its declination. We consider the isotropic case in which σ(δ) = σ is isotropic and a declination dependent situation with σ(δ) = σ/cos(δ −δ ), δ being fixed by ∗ ∗ 4 Foundationsofmoderncosmology DominikJ.Schwarz precissionofradiodipoledirection;efficiency50(cid:37) CMB:z(cid:126)1100 es 30 e gr de 25 n i L C 20 (cid:37) SKAradiosky 9 us dCMdBradio and9 15 z(cid:62)1z(cid:60)1 (cid:37)CL 10 5 9 L, 5 C (cid:37) 0 0 9 104 105 106 107 108 109 1010 numberofobservedradiopointsources Figure 1: Left: All-sky (3π) SKA surveys (yellow and orange) will measure the cosmic radio dipole of differentialsourcecounts. SelectingAGNswillresultinasamplewithmedianredshiftz>1(orange)and thus allow us to measure the peculiar velocity of the solar system with respect to the large scale structure on superhorizon scales. These measurements will be compared to the CMB dipole and thus test for the existenceofabulkflowofourHubblevolumecomparedtotheCMBrestframe. Right: Angularaccuracy at 90, 95 and 99 % C.L. of the measurement of the cosmic radio dipole as a function of observed point sources. Thebluesetofcurvesassumesd =4d ,theredsetassumesd =d . Itisassumedthat radio cmb radio cmb only50%ofalldetectedradiosourcessurviveallqualitycuts(e.g. maskingfieldsthatcontainverybright sources). CombinedwithTable1wefindthatSKAEarlyScienceallowsdetectionofapossibledeviation fromtheCMBexpectationathighsignificance. SKA1willconstrainthecosmicradiodipoledirectionwith anaccuracybetterthan5degrees,SKA2withinadegree(at99%C.L.). 120 60 isotropic, x=1 isotropic, x=1 cosinus, x=1 cosinus, x=1 100 cosinus, x=1.5 40 cosinus, x=1.5 nt cosinus, x=0.5 cosinus, x=0.5 relative d in perceerror 24680000 Shot noise θabsolute error -- 242 0000 Shot noise 0 -60 -20 -80 0.01 0.1 0.01 0.1 sigma sigma Figure2: Left: Accuracy(inpercent)ofthemeasurementofthedipoleamplitudeasfunctionoffractional erroronfluxdensitycalibrationonindividualpointsources. Allpointsarebasedon100simulations. Right: Accuracy(indegrees)ofthemeasurementofthedipoledirection. Thehorizontallinesdenotetheerrordue toshotnoiseforadipoleestimatebasedon107sources(SKAEarlyScience). the latitude of the SKA site and |δ −δ |<70 deg. For two cases we find negligible influence of ∗ calibrationerrors: Ifthefluxcalibrationerroriscompletelyisotropicoriftheslopexofthenumber counts[N(>S)∝S−x]isequaltoone. Itturnsoutthatx=1isaspecialvalue, wherecalibration errors at the lower flux density limit have no influence on the dipole estimator. We conclude that directiondependentcalibrationeffectsmustnotexceedcertainlimitsasshownfigure2. Anothersignificantcontaminantofthekineticradiodipoleisthelocalstructuredipole. Wecan turnadisadvantageofcontinuumsurveys,namelythatweobserveseveralsourcepopulations,into anadvantageasfollows: ThelowermeanredshiftofSFGscomparedtoAGNsallowsustochange 5 Foundationsofmoderncosmology DominikJ.Schwarz 0.0035 1.4 GHz 151 MHz 0.003 0.0025 0.002 dobs 0.0015 0.001 0.0005 0 1 10 100 1000 10000 100000 lower flux density limit [µJy] Figure3: Amplitudeofstructuredipoleduetoalocalvoid,affectingthemeasurementsofthecosmicradio dipoleasafunctionoflowerfluxdensitylimitandfortwowavebandscenteredon151MHzand1.4GHz (fromRubartetal.(2014)). the mean depth of the survey by scanning different fluxes density limits and frequencies. This in fact allows for a tomographic survey of the radio dipole. For the example of a huge (∼100 Mpc) localvoidthiswasstudiedrecently(Rubartetal.2014). Figure3illustratesthiseffect. 3. Largeangularscales(SKA1&SKA2) It is not obvious that the isotropic distribution of light implies also the isotropy of space- time itself. The vanishing of the quadrupole and octopole moments of the CMB would imply the isotropy of space-time along the world line of the observer (Maartens 2011). While those low-(cid:96) multipoles are small compared to the monopole and dipole, they do not vanish exactly. We thus wecanatbestspeakaboutanalmostisotropicUniverse. Theradioskyoffersanotherindependent probeatz>1andatthelargestangularscales. Recent work has revealed the existence of CMB “anomalies" [for a review, see Copi et al. (2010)]. In brief, the angular correlation function in the WMAP and Planck temperature maps vanishesonscaleslargerthan60degrees,contrarytotheoreticalexpectation; moreover,theCMB quadrupole and octopole anisotropy patterns are aligned both mutually and with respect to the SolarSystemgeometry. Theseanomalieshavebeenwidelystudiedanddiscussed,buttheirorigin remainsunexplained. SKAwillprovideadeepandwidelarge-scalestructuredatasetthatwillenableseparatingthe effects of the early and late universe on the observed CMB anisotropy. For example, the SKA data could be used to reconstruct the late-time contribution to the CMB anisotropy via the inte- gratedSachs-Wolfeeffect,andthusprovideinformationaboutthetemporalevolutionoftheCMB anomalies. 3.1 Low-(cid:96)multipolemoments The analysis of low-(cid:96) multipoles from SKA continuum surveys can benefit from the meth- ods developed for the study of the CMB. Missing sky area is always a problem for low-(cid:96) mode measurements. For CMB studies, many methods were proposed to deal with a mask of missing data for both power spectrum estimation and phase recovery. For the power spectrum, one of the 6 Foundationsofmoderncosmology DominikJ.Schwarz 10−5 10−4 5×10−6 ggC2ℓ×10−6 ggℓ(ℓ+1)C / 2 πℓ10−5 10−6 10−6 5×10−7 2 5 10 20 2 5 10 20 ℓ ℓ Figure 4: Left: Low-(cid:96) multipoles of the angular power spectrum as expected for a SKA1 continuum survey. Right: The corresponding band power. The errors contain shot noise and cosmic variance. The figuresillustratethatstatisticallysignificantmeasurementsofmultipolemomentscanbeexpected. most used methods is MASTER (Hivon et al. 2002). It consists in first building a matrix which captures the coupling between the modes induced by the mask, and then inverting this matrix. In Figure4weplottheangularpowerspectrumofSKAgalaxiesforlow-(cid:96)mulitpoleswitherrorbars correspondingtoaSKA1continuumsurvey. Forphaserecovery,ormoregenerallyforlargescalemapreconstruction,manymethodshave been proposed based on Wiener filtering, l or l norm regularization, constraint realizations or 2 1 diffusion [see Starck et al. (2013) and references therein]. Based on these new methodological idea,Planckdatawereanalyzedwithamaskremoving27%ofthesky(Planckcollaboration2014c; Rassatetal. 2014). Foragivenobservedskyarea,theshapeofthemaskwillalsobeimportant. The importanceofrandomsamplingisalsodescribedinPaykarietal.(2013),andmanysmallmissing parts, randomly distributed, will always be much better for large scale studies than a compact big missingpart. Asforthedipole,SKAwilltremendouslyimprovetheprecisionandqualityoflow-(cid:96)multipole momentsandthusallowustoprobestatisticalisotropy,scaleinvarianceandgaussianity. 3.2 Angular2-pointcorrelationfunction Theangulartwopointcorrelationisapowerfultooltomeasuretheprojectedlarge-scalestruc- turedistributionoftheUniverse. Itallowsustoprobecertainfundamentalassumptionslikescale- invariance of the primordial perturbations, Gaussianity and the isotropy of the Universe (by com- paringtwo-pointcorrelationsonsub-samplesoftheobservedsky). Thetwo-pointcorrelationatlargeangularscalescontainsmanyinterestingaspects: Firstly,the matterfluctuationsatlargescalesareinthelinearregime. Secondly,generalrelativisticeffectsand cosmologicalevolutionpreferlargescales. AGNsareverygoodcandidatestoprobethis,sincethey are isotropically distributed on the sky and most of them have a significant (z>1) cosmological distance. Inordertoaccuratelyinvestigateultra-largescalecorrelations,thetheoreticalframework of differential number counts based on general relativity will be needed (Maartens et al. 2013; Raccanellietal.2014,2013;Chen&Schwarz2014). In contrast to galaxy redshift surveys within the local Universe (z(cid:28)1), all linear order rela- tivisticcorrections,whichincludetheDopplereffect,lensing,andgeneralizedSachs-Wolfecontri- 7 Foundationsofmoderncosmology DominikJ.Schwarz butions,areofrelevance. Thespreadofluminositiesofradiosourcesincontinuumsurveyswashes outmuchoftheclusteringsignal,andthegeneralrelativisticcorrectionsarealsosuppressed. How- ever,SKAHIsurveysinwhichthesourceredshiftswillbeknownwillresolvetheseeffects. WiththeassistanceofLymanalphadata,onecanmodeltheluminosityfunctionandevolution. WiththeSKAmorphologydataweexpecttobeabletoidentifydifferenttypeofsources. Thiswill allow us to study cross correlations between star forming galaxies and AGNs. We could also cross correlate with the CMB and different types of radio sources, which have different redshift distributions. These aspects are treated in more detail in other contributions to this volume (Camera et al. 2015; Bull et al. 2015; Raccanelli et al. 2015). Let us just stress here the importance of re- establishingthealmostscale-invariantpowerspectrumatsuperhorizonscalesatz∼1,whichwill bepossiblebymeansofSKAall-skysurveys. 4. CopernicanPrincipleandhomogeneity(SKA1&SKA2) The Copernican Principle is the assumption that we are not distinguished observers in the Universe. If we observe an isotropic cosmos, then distant observers should also see a similarly isotropiccosmos. ThisimpliesthattheUniversesatisfiestheCosmologicalPrincipleandishomo- geneousonlargescales. Aviolationofhomogeneityinprincipleoffersanalternativeexplanation to the acceleration of the Universe (Célérier 2000), but simple inhomogeneous models without darkenergyareincompatiblewithcurrentdata(Bulletal.2012). However,radialhomogeneityis onlyweaklyconstrainedinΛCDM(Valkenburgetal.2014). Anydeviationswouldimplyaradical changetothestandardmodelandscale-invariantinitialconditions, makingitavitalconstrainton thestandardmodel. SKA HI intensity mapping on super-Hubble scales offers powerful new ways to test homo- geneity. By comparing the radial and transverse scale of baryon acoustic oscillations we can test isotropyoftheexpansionratearounddistantobservers(Maartens2011;Februaryetal.2013;Clark- son 2012). This places direct constraints on radial inhomogeneity about us, when redshift-space distortions,lensingandotherlarge-scaleGReffectsareaccountedfor. Anisotropicexpansionrates act on the sound horizon at decoupling so that by redshift z it has evolved into an ellipsoid with semi-axes δz(z) L (z)= , L (z)=d (z)δθ(z), (4.1) (cid:107) (1+z)H (z) ⊥ A (cid:107) given the observed radial and angular scales δz(z),δθ(z). L (z)=L (z) in a homogeneous uni- (cid:107) ⊥ verse. Inaninhomogeneousuniversed (z)dependsonthetransverseHubbleratealongthelineof A sight,whichwillbedifferentfromtheradialHubblerateH (z),providingatestofhomogeneity. (cid:107) When combined with accurate distance data from SNIa, consistency relations can be used to check deviations from homogeneity in a completely model independent way (Clarkson et al. 2008). Inahomogeneousuniverse,irrespectiveofdarkenergyortheoryofgravity,theHubblerate h(z)=H(z)/H anddimensionlesscomovingdistanceD(z)=(1+z)H d (z)satisfy((cid:48)=d/dz) 0 0 A C(z)=1+h2(cid:0)DD(cid:48)(cid:48)−D(cid:48)2(cid:1)+hh(cid:48)DD(cid:48)=0, (4.2) 8 Foundationsofmoderncosmology DominikJ.Schwarz sothatC(z)(cid:54)=0impliesviolationoftheCopernicanPrinciple. WeexpectthatSKA1willbeable toconstrainC(z)to0±0.05forz<1.5,basedonanaiveerrorpropagationfromBulletal.(2014). Amorecarefulforecasthasyettobedone. Directconstraintsonradialinhomogeneitycanbegiven combining with all available data sets which will significantly improve current constraints which aremuchweakerthanthoseforisotropy(Valkenburgetal.2014). Finally,theCopernicanPrincipleallowsforthepossibilityofafractaluniverse,butthisisnot predicted by the concordance model – which predicts a fractal dimension of 3 on large scales – anydeviationswouldimplynewphysics. Itisthereforeimportanttomeasurethefractaldimension of the distribution of radio sources at superhorizon scales. Such a test has been performed using the SDSS and the WiggleZ surveys, finding an approach to a three-dimensional distribution at ∼100 Mpc scales (Hogg et al. 2005; Scrimgeour et al. 2012). A dramatic improvement will be possiblebasedonSKAHIthresholdsurveys. 5. Summary The Cosmological Principle provides the foundation for modern cosmology, and our under- standingoftheevolutionoftheUniverseaswellasallparameterconstraintsfromtheCMB,super- novae or large scale structure rely on this assumption. Testing the Cosmological Principle is thus offundamentalimportanceforcosmologygenerallyaswellasforthecosmologicalinterpretation oftheSKAdataitself. Asthischaptershows,SKAwillbeabletogreatlyincreaseourconfidence thatourcosmologicalframeworkmakessense(orleadtoascientificrevolutionifnot). We argue that SKA all-sky surveys will allow us to measure the cosmic radio dipole almost as precisely as the CMB dipole. SKA1 will constrain the cosmic radio dipole direction with an accuracy better than 5 degrees, SKA2 within a degree (at 99% C.L.). This measurement could finally firmly establish or refute the commonly adopted assumption that the CMB and the overall LSSframesagree, andwillhaveimpactonavarietyofcosmologicalobservations, fromthelocal measurement of H to the calibration of CMB experiments. A tomography of the cosmic radio 0 dipolemightrevealadetailedunderstandingoflocalLSS. In addition, studying the large-angular scales in SKA continuum and HI surveys might help resolvethepuzzleofCMBanomaliesandtestthecosmologicalprinciple,includingtestsofstatis- ticalhomogeneity. Furtherlarge-scalestructureissues, especiallynon-Gaussianityandrelativistic corrections,arediscussedinCameraetal.(2015). The ideas presented in this work only provide a flavor of SKA’s potential to answer funda- mental cosmological questions. Some of those ideas can already be tested by means of the SKA pathfinderexperimentsASKAP,MeerKATandLOFAR,buttheycannotcompetewithSKA’ssur- veyspeedandsensitivity. ThusSKAwillbeaunprecedenteddiscoveryandprecisionmachinefor moderncosmology. Acknowledgments DJS, SC and MR are supported by the Deutsche Forschungsgemeinschaft by means of the Research Training Group 1620 “Models of Gravity”. MR acknowleges financial support from the Friedrich Ebert-Stiftung. AR is supported by the Templeton Foundation. Part of the research 9 Foundationsofmoderncosmology DominikJ.Schwarz described in this work was carried out at the Jet Propulsion Laboratory, California Institute of Technology,underacontractwiththeNationalAeronauticsandSpaceAdministration. References Bennett,C.L.,Larson,D.,Weiland,J.L.,etal.2013,ApJS,208,20 Blake,C.,&Wall,J.2002,Nature,416,150 Brown,R.2014,“SKA1ImagingSciencePerformance”,DocumentnumberSKA-TEL-SKO-DD- XXXRevisonADraft2 Bull, P., Camera, S., Raccanelli, A., et al. 2015, in “Advancing Astrophysics with the Square KilometreArray”,PoS(AASKA14)024 Bull,P.,Clifton,T.,&Ferreira,P.G.2012,Phys.Rev.D,85,024002 Bull,P.,Ferreira,P.G.,Patel,P.,&Santos,M.G.2014,ArXive-prints,arXiv:1405.1452 Camera, S., Raccanelli, A., Bull, P., et al. 2015, in “Advancing Astrophysics with the Square KilometreArray”,PoS(AASKA14)025 Célérier,M.-N.2000,A&A,353,63 Chen,S.,&Schwarz,D.J.2014,ArXive-prints,arXiv:1407.4682 Clarkson,C.2012,ComptesRendusPhysique,13,682 Clarkson,C.,Bassett,B.,&Lu,T.H.-C.2008,PhysicalReviewLetters,101,011301 Copi,C.J.,Huterer,D.,Schwarz,D.J.,&Starkman,G.D.2010,Adv.Astron.,2010,92 —.2013a,ArXive-prints,arXiv:1310.3831 —.2013b,ArXive-prints,arXiv:1311.4562 Crawford,F.2009,ApJ,692,887 deZotti,G.,Massardi,M.,Negrello,M.,&Wall,J.2010,A&ARev.,18,1 Dewdney, P., Turner, W., Millenaar, R., et al. 2013, “SKA1 System Baseline Design”, Document numberSKA-TEL-SKO-DD-001Revision1 Ellis,G.F.R.,&Baldwin,J.E.1984,MNRAS,206,377 Erickcek,A.L.,Carroll,S.M.,&Kamionkowski,M.2008,Phys.Rev.D,78,083012 February,S.,Clarkson,C.,&Maartens,R.2013,JCAP,3,23 Gibelyou,C.,&Huterer,D.2012,MNRAS,427,1994 Hinshaw,G.,Weiland,J.L.,Hill,R.S.,etal.2009,ApJS,180,225 10