loading

Logout succeed

Logout succeed. See you again!

ebook img

The Telegraph Magazine - 06 August 2022 PDF

pages76 Pages
release year2022
file size18 MB
languageEnglish

Preview The Telegraph Magazine - 06 August 2022

6AUGUST2022 h p a r g e Will creating l e T new versions of ; 0 2 extinct animals : 8 3 save the world... : 7 1 orcreatea 2 2 0 mammothproblem? 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . X X - C 1 0 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 1 0 0 1 : t n e m u c o D h p a r g e l e T ; 9 2 : 8 0 : 6 1 2 2 0 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . M T - C 2 0 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 2 0 0 1 : t n e m u c o D 2 The Telegraph Magazine 6augusT 2022 h p a r g e 0 6 . 0 8 2 0 2 2 l e T ; 3 0 : 2 2 : 6 1 REGULARS FEATURES 2 2 0 2 g MY SATURDAY Dreamingbig…Plans u A Strangesandwichesand areafoottobringback . 1 everydaychardonnay thewoollymammoth 0 JENNY ECLAIR IO DODDS : e P.5 P.6 t a D ; ) m AGONY UNCLE Thewomanbalancing m Solvingyourproblems cultureandcommerce 0 0 RICHARD MADELEY atGlyndebourne . 0 P.63 BEN LAWRENCE 7 2 P.14 x 0 THE WAY WE 0 . LIVE NOW Anursereflectsonthe 0 3 Deliverusfromdeliveries nightmareofher 2 ( CHRISTOPHER HOWSE manslaughterconviction : t & GUY KELLY ANTONIA HOYLE a m P.74 P.26 r o F ; f STYLE FOOD d p . X X - C Printscharming, Touchedbyfire:theart 3 clashingandcolourful ofcookingoutdoors 00 A STEPHEN DOIG GENEVIEVE TAYLOR - 2 P.55 P.37 2 8 0 6 0 Takeabow:dressingfor Whattodowithyour - 1 open-airentertainments glutofbroadbeans - M LISA ARMSTRONG MARK HIX T M P.58 P.43 T COUNTRY FOR OLD MEN D - OD C O C OMIW Toboldlygo…lipsticks Thehealingpowerofgettingbacktonature Lunchdownon 03 E:NA toperkyouup ANDREW BAKER JeremyClarkson’sfarm 10 PAG JAN MASTERS P.20 WILLIAM SITWELL : THIS P.61 P.53 nt ETZ. me M u USTIN HEADOFMAGAZINEADVERTISING,CLAIREJUON:claire.juon@mailmetromedia.co.uk.INTERNATIONALACCOUNTSALESMANAGER,JASONHARRISON:[email protected] oc R:J ©TELEGRAPHMAGAZINE2022.PUBLISHEDBYTELEGRAPHMEDIAGROUPLIMITED,111BUCKINGHAMPALACEROAD,LONDONSW1W0DT(020-79312000)ANDPRINTEDBYWALSTEAD. D OVE COLOURREPRODUCTIONN:OTRELIETGSRAAGPEHNPTRSOADCUCCEPTTIOSNL.IANBOITLITTOYBFEORSOLLODSSSEOPRADRAATMEALGYEFTROOMCOTLHOEUDRATILRYANTESPLAERGERNACPIHE.SWOHRILAENYEVOETRHYERREMASAOTNEARIBALLESCUABRMEIWTTIELLDBTEOTTAHKEENM,ANGEAIZTIHNEERTHEDAILYTELEGRAPH C 6August 2022 the telegrAph MAgAzine 3 h p a r g e l e T ; 9 1 : 4 5 : 5 1 2 2 0 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . M T - C 4 0 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 4 0 0 1 : t n e m u c o D 4 The Telegraph Magazine 6augusT 2022 Jenny Eclair h p a My Saturday r g e l e T ; 9 4 : 2 1 : 8 1 2 2 11am We potter around East related injury on stage and had 20 Dulwich,oneofthoseLondonvil- tohaveanoperationonthetopof g u A lageswhereeveryone’s my spine. I’m looking for- . 1 gotacockapooandsits wardtogoingbackontour 0 : around eating crois- inSeptemberwithmyshow e t sants.Ibuyaplant,Geof Sixty! (FFS!) [for tickets, a D ; tries to hide the fact visit jennyeclair.com]. I ) m he’sboughtacake.Wemetwhen get panicky when I don’t earn m 0 Iwasinmy20s:hecameintothe money. I sit in a fug of self- 0 . place where I was waitressing, doubt,‘OhGod,it’sallover,I’m 0 7 2 andIinstantlyrecognisedsome- goingtohavetosellthehouse.’ x thinginhim.Wegotmarriedfive 0 years ago because my financial 6.30pm I’m a chardonnay girl. .0 0 advisorsaidwehadto–theword Idrinkeverydayandcooktwice 3 2 ( ‘husband’makesmegawp. a week – I’ll have a sudden : t rush of blood and make a a Thecomedianand m 1pm Lunchisaleftover-Bolognese risotto.Bakingisanathemato or author,62,onBolognese F sandwich–Icanputanythingin me,butI’vegotaggrandchild ; f sandwiches,busridesand d a sandwich. I think eating out onthewaysomaybeI’llsud- p . herchardonnayhabit isawasteofmoney.Ialwaysend denlybecomebakingmad. X X - upwishingIwashomeinmyPJs C 5 3.30am First wee of the day havingfishpiefromSainsbury’s. 8pm I am horribly hooked on 0 0 A thenbacktosleep. LoveIsland.I’mveryantisocial: - 2 2.30pm We cruise to the Royal if I’m not entertaining a crowd 2 8 7.30am Secondwee.Igetcross Academyonthebus–Ilovemy ofpeople,I’munlikelytobeout. 60 0 aboutitbecauseIwantanother over-60s travel pass. We go to - 1 hour in bed. I live with a man galleries every weekend, and I 10.30pm I’m listening to The M- T [her husband, the designer paintformymentalhealth.Some Whalebone Theatre by Joanna M T ES D AG Geof Powell] who also doesn’t women want expensive hand- Quinn. I have dry eye disease, - M C ETTYI likegettingupearly,sowedon’t bags;Ispendmoneyonartmate- so I read on paper very little 5C G 0 MY, surfaceuntilnine. rials–andmyteeth. andsaveallmyeyejuiceforthe 0 BB.ALA computer. My new book, The :1 EWE 9am Breakfast is toast, 5pm A walk around Writing on the Wall, is young nt R e CLAI cream cheese, mashed PeckhamRye.I’mmon- adultfictionsetin1975,whichis um BY c W avocadoandslicedhard- strously unfit because when I was 15 – there’s a shop- o VIE D ER boiledegg,withmayo. I incurred a cartwheel- liftingbitthat’sbasicallyfact. NT I 6August 2022 the telegrAph MAgAzine 5 Wordsby IO DODDS h p a r g e l e T ; 5 4 : 8 0 : 8 1 2 2 0 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . M T - C 6 0 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 6 0 0 1 A beastly dilemma : t n e m u c o D 6 The Telegraph Magazine 6augusT 2022 Illustrationby JUSTIN METZ h p a r g e l e T ; 7 4 : 1 1 : 8 1 2 2 0 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . M T - C 7 0 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 7 0 0 1 : Soon, prehistoric woolly mammoths may again wander the icy reaches t n e m of Siberia. But are the scientists researching so-called ‘de-extinction’ in u c o it for conservation and human benefit, or to turn a mighty big profit? D 6August 2022 the telegrAph MAgAzine 7 Thecompanyarguesthatsufficientherdsof theseanimalscouldmitigateclimatechange byrecreatingthelostArcticgrasslandsofthe h p Ice Age. In March, just five months after a r launching,itraised$60million(£48million) g frominvestors,ledbyJurassicWorldexecu- e l tiveproducerThomasTull,withpriorbackers e T includingcryptocurrencytycoonsCameron andTylerWinklevossandarch-conservative ; 2 venturecapitalistPeterThiel,whoseehuge 5 : financialpotentialinthegene-editingandarti- 3 ficialbirthtechniquesthatColossalintendsto 1 : develop. ‘Extinction is a colossal problem 8 1 facingtheworld,andColossalisthecompany that’sgoingtofixit,’thefirm’swebsiteprom- 2 2 ises.‘We’reprobablytheonlyspeciesonEarth 0 2 that’s capable of saving the other species if they’re truly endangered,’ Colossal’s g u co-founderandleadscientistGeorgeChurch– A . aveteranHarvardgeneticsprofessor–tellsme. 1 F Meanwhile,inAustralia,theUniversityof 0 orBenNovak,itstartedwithadead : e sheep. The horned beast’s head had t a hung on the wall of the museum at D TheodoreRooseveltNationalParkin ; ) NorthDakotaforaslongashecouldremember, m m commemorating the president who was the fatheroftheAmericanconservationmovement. 0 0 Novakhadgrownupnearby,inahousehis . 0 fatherbuiltontheedgeofSouthDakota’sBad- 7 lands,wherehewentouthikingeveryday 2 lookingforfossils.Oncehesawtwogolden x eagleswiththeirtalonslockedtogether,spiral- 0 lingintheair.Soheneverpaidmuchattention 0 . toadeadbighornsheep–therewereplentyof 0 3 liveonesroamingthepark,alongwithbisonso 2 numeroustheyoftenblockedtheroad. ( : Then,whenNovakwasaround14or15years t a old,helookedatthelittleplaque,whichsaid m thebighornsheephadbecomeextinctinthe r o areaandbeenreintroduced,ashadthebison F ; andelk.Thatrealisation,Novaksays,helped f spurhimtodevotehislifetorecreatingextinct d p species–chieflythepassengerpigeon,which . M wasoncesonumerousintheeasternUSthat T itsflocksweresaidtoblockoutthesun,but - C whichdiedoutincaptivityin1914. 8 0 ‘Peoplelivedwiththosebirds,peoplegotto 0 see those birds, and then people in history NovakisleadscientistatRevive&Restore, Melbournehasjustsetupalaboratorydedi- A - robbedmefromgettingtohavethesameincred- a charity founded in 2012 by the counter- catedtoreplicatingthethylacine,orTasmanian 2 2 ibleexperience,’saysNovak,now35,wholives culturalwriterStewartBrand,basednearthe tiger,thankstoaAUD5million(£2.8million) 8 inNorthCarolinawithhisyoungtwins.‘When majesticMuirWoodsnorthofSanFrancisco.In donationinMarchfromAussiecryptocurrency 0 6 oneofthethingsthatthrillsapersonisgoing 2020,itclonedthehighlyendangeredPrzew- entrepreneur Russell Wilson. That month, 0 - outandseeingwildlife,it’simpossiblenotto alski’shorseandblack-footedferretfromdead leadscientistProfessorAndrewPaskpublished 1 feellikeyou’vebeenpersonallyrobbedbythe animalswhosecellswerefrozeninthe1980s. a new ‘high-quality’ genetic sequence for - M extinctionsofthepastfewdecades.’ Novak’sdream,though,istorecreatethepas- thewolf-likecarnivorousmarsupial,which T M TodayNovakispartofagrowingmovement sengerpigeon.Havingsequenceditsgenome, became extinct in 1936 after authorities T tryingtobringaboutthe‘de-extinction’oflost heisworkingtoeditexistingpigeongenesand imposed a bounty on the supposed sheep- D - speciesthroughgeneticengineering.Thesesci- devisewaysofinsertingnewDNAintoagrow- savager.‘Ifanyonecanachievede-extinction,it C C entistsandactivistsaimto‘re-stabilise’Earth’s ingembryo–neverbeforedoneforbirds. willbemonumental,’saysPask.‘Itwillchange 8 ecosystems by restoring key species whose Butthereareotherswhodreamevenbig- thewayweviewextinction,changethewaywe 0 0 ecologicalrolehasneverbeenreplaced.Inthe ger.Acrossthecountry,inTexas,Colossal viewanimalconservation.’ 1 process,theyhopetoinspireanewgeneration Biosciences,afor-profitstart-up,istryingto Yetde-extinction–andColossal’sworkin : ofconservationistsanddevelopadvancedtech- bringbackthewoollymammoth.Ithasprom- particular–hassparkeddebateamongscien- t n nologiesthatcouldhelppreserveexistingspe- isedtoproduceageneticallymodifiedAsian tistsandconservationists,notleastbecause e m ciesinthefaceofclimatechange–andchange elephantthatisascloseaspossibletoitshairy most extinct species cannot ever be truly u thefaceofhumanmedicine. forebearwithinthenextsixyears. revived.Theirsuccessorswillbenovelcrea- c o tures,carefullyeditedfromexistingstockwith D Above:VictoriaHerridge(left)andGeorgeChurch(secondright)examineamammoth’sforefootinSiberia emerginggenetechnologiesandreleasedinto 8 The Telegraph Magazine 6augusT 2022 Belowright:Dolly,theworld’smostfamoussheep,wasclonedandbornin1996 InMelbourne’snewhi-techlab,mischie- vously named the Thylacine Integrated thewildwiththehopeofchangingtheireco- whichwerekilledoffbyhumansinthe17th Research and Restoration Lab (or TIGRR), h p systems–raisingquestionsabouthowitwill century,wereactuallyatypeofpigeon–and sixpostdoctoralstudentsandtwopermanent a r work,whobenefitsandwhoisincontrol. helpedmakeShapirooneoftheworld’sfore- staffersarecultivatingalivingpopulationof g ‘Itwouldbebettertobehonestwithpeople mostexpertsinancientDNA. marsupial stem cells, analysing their RNA e l aboutwhatyou’redoing,andyou’renotcreat- TodayShapiroisaprofessorattheUniversity andputtingthemindifferentconditionstotest e T ing a mammoth,’ says Victoria Herridge, a ofCaliforniaSantaCruz(UCSC),aboardmem- whethertheycouldonedaybeusedtopro- mammothpalaeontologistandbroadcasterat berforRevive&Restore,andanadvisorto ducethylacineproxyembryos.Theyrenttime ; 1 theNaturalHistoryMuseuminLondon,who Colossal,helpingitidentifywhichgenesmake on powerful supercomputers to probe the 5 : turned down a seat on Colossal’s advisory thedifferencebetweenamodernelephantand geneticdifferencesbetweenthylacinesand 3 board last year for ethical reasons. ‘You’re amammoth.Sherecentlysequencedawhole othermarsupials,learningwhichDNAedits 1 : notreviving,you’renotrestoring,you’renot dodo genome from a sample in Denmark couldbestbridgethegapbetweenthem. 8 1 de-anything-ing…youarecarryingoutabio- andevenwroteabookcalledHowToClonea Muchofthatworkisbasedonfoursurpris- engineeringexperimentwhich,ifyourgoal Mammoth,her‘long-formanswer’toendless inglywell-preservedDNAsamplesfromthree 2 2 is[met],willcreatechangeataglobalscale.It questionsfromjournalists.BenNovak,who babythylacinesthathadlainforyearsinaMel- 0 2 becomesaquestionof:whogetstotamper studiedwithheratUCSC,describesherasthe bournemuseumarchive,foundinthepouch withtheclimatesystemoftheplanet?’ motherofdefiningde-extinction. ofafemalewhowasshotaroundacenturyago g u Ironic,then,thatshedoesn’treallybelievein andpreservedinethanolratherthanformalde- A . Backin2000,inatinyroomintheOxford it.‘I’mnotopposedtode-extinction,Ijustdon’t hyde(whichbreaksupDNA).Havingsampled 1 UniversityMuseumofNaturalHistory,Beth thinkit’spossible,’sheexplains.Findingaper- thebabiesin2000,AndrewPaskwaslaterable 0 Shapiro carefully drilled into a dodo’s leg fectsampleofDNAisimpossibleforanimals : e bone.Ithadtakensomeconvincingforher that died out before modern preservation t a managertoletthisyoungAmericanPhDstu- methodssuchascryogenicfreezing.Evenifwe D dentattheirreplaceablesample.‘Ihaddrilled hadone,Shapiroarguesthatanygivenspecies ; ) intomanybones,butnoneofthemwerethat istheproductnotonlyofitsDNAbutitsenvi- m m precious,’recallsShapiro.‘We’rebothsitting ronment,theconditionsofitsgestation,and therefeelingverynervous.ButIknewthatI thewayitisraised,noneofwhichcanberepli- 0 0 hadtriedeverythingelse.Thiswasgoingto cated.‘IfyouarewillingtoacceptanAsianele- . 0 bemyonlyshotatgetting[dodo]DNA.’ phantthathasthefewgenesthatmakeitbetter 7 At the time, de-extinction was already abletosurviveinacoldplaceasamammoth, 2 becomingatopicofscientificdebate.Theclon- then that’s pretty possible. But if you want x ingofDollythesheepin1996hadprovedthat somethingthatisgenetically,behaviourally, 0 itwaspossibletoreplacetheDNAinanunfer- andpsychologicallyidenticaltoamammothin 0 . tilised mammal egg cell with genes from everyway?That’snevergoingtohappen.’ 0 3 anotherindividual,socouldn’tthisbedone Why,then,spendsomuchtimeandmoney 2 withextinctDNAtoo? onde-extinction?Whynotinstead–asmany ( : Shapirowasn’ttryingtoanswerthatques- arguingagainstthesetechnologiessuggest– t a tion.Herquestwassimplytolearnmoreabout focusonconservingexistingendangeredani- m thedodo’sgenome,whichwaschallenging mals?‘Wearecurrently in massextinction,’ r o enough.Geneticcodefallsapartquicklyafter pointsoutAxelMoehrenschlager,azooconser- F ; deathunlesspreserved,leavingancientDNA vationdirectorwhohelpedwritetheInterna- f brokenintotinyfragments,soShapirohadto tionalUnionforConservationofNature’s(IUCN) d p wearafullbodysuit,ahairnet,afacemask, guidelinesonrevivingextinctspecies.‘Andso . M andglovestoavoidcontaminatingsamples shouldn’twedoeverythingwecantosavethe T withherownmaterial. speciesthatremain,thatneedourhelp,andthat - C The Oxford sample did not yield a full wehavethecapabilityofsavingifweapplysci- 9 0 geneticsequence,butitdidshowthatdodos, enceandpolicieswithcourageousaction?’ 0 A - ‘If we can achieve 2 2 8 0 6 0 - 1 - de-extinction, M T M T D - C C it will be 9 0 0 1 D EA : DH t E n MR monumental’ e O m S,T u GE c A o YIM D ETT G 6August 2022 the telegrAph MAgAzine 9 h p a r g e l e T ; 3 2 : 4 5 : 5 1 2 2 0 2 g u A . 1 0 : e t a D ; ) m m 0 0 . 0 7 2 x 0 0 . 0 3 2 ( : t a m r o F ; f d p . M T - C 0 1 0 A - 2 2 8 0 6 0 - 1 - M T M T D - C C 0 1 0 1 : t n e m u c o D 10 The Telegraph Magazine 6augusT 2022

See more

The list of books you might like