loading

Logout succeed

Logout succeed. See you again!

ebook img

Topological phonon modes in filamentous structures PDF

file size4.2 MB
languageEnglish

Preview Topological phonon modes in filamentous structures

Topological phonon modes in filamentary structures Nina Berg, Kira Joel, Miriam Koolyk and Emil Prodan Department of Physics, Yeshiva University, New York, NY 10016 (Dated: January 7, 2011) Thisworkdescribesaclassoftopologicalphononmodes,thatis,mechanicalvibrationslocalizedat theedgesofspecialstructuresthatarerobustagainstthedeformationsofthestructures. Aclassof topologicalphononswasrecentlyfoundin2-dimensionalstructuressimilartothatofMicrotubules. The present work introduces another class of topological phonons, this time occurring in quasi one-dimensional filamentary structures with inversion symmetry. The phenomenon is exemplified using a structure inspired from that of actin Microfilaments, present in most live cells. The system discussed here is probably the simplest structure that supports topological phonon modes, a fact that allows detailed analysis in both time and frequency domains. We advance the hypothesis that thetopologicalphononmodesareubiquitousinthebiologicalworldandthatlivingorganismsmake 1 1 use of them during various processes. 0 2 PACSnumbers: 63.20.D-,87.10.Hk,87.16.Ka n a Condensed matter research has been profoundly normal functioning. Most of today’s chemo-therapies J marked by the discovery of a new phase of matter against cancer target Microtubules in an attempt to in- 6 called the topological insulating phase,1–4 which has al- hibittheirDI.20Forthisreason,understandingthemech- ready generated a plethora of amazing applications and anism of DI is one of the most active research areas in ] t changed the way we understand condensed matter.5,6 biomedical research. Ref. 11 showed that the phonon f o The hallmark of a topological insulator is the emergence spectrum of the dimer lattice of Microtubules displays s of electronic states along any edge cut into a sample of Dirac cones like electrons do in graphene. It also showed . t such material. Although insulators when probed deep that these Dirac cones can be split, leading to topologi- a inside the bulk, these materials conduct electricity along calphononmodes,whichwereindeedobservedinexplicit m their edges without any resistance. This property can- calculations for ribbon geometries. It was then hypothe- - not be destroyed by any chemical or mechanical treat- sized that the topological edge modes play a major role d n ment of the edge.7,8 The phenomenon is not restricted in the DI. o only to electronic systems. Electromagnetic waves can Topologicalphononmodesmayalsoberelevanttothe c display similar effects and it was shown that specially dynamics of Microfilaments, which control cell motility [ designed photonic crystals can support similarly robust by applying force on the cell membrane.18,21 They are 2 electromagnetic wave-modes along their edges.9,10 Like- made of the protein actin, arranged in a double-helical v wise, specially designed mechanical lattices can support formation.22 A pool of ATP-actin monomers is present 7 topological phonon modes.11 in the cell, and actin polymerization draws on this pool. 0 Edge and surface phonon modes are not rare occur- The ATP-monomers collide and bond with the ends of 4 5 rences in hard matter systems. However, most of these the existing filament branches, elongating them. The . modes are very sensitive to the deformations of the sys- bound ATP-actin hydrolyzes into ADP-actin almost in- 0 tems and they can be easily suppressed by various treat- stantly,releasingquantaofabout12kTenergy.23 Atthe 1 0 ments of the edges or surfaces. There is a special ef- same time, ADP-actin at the other end of the Microfila- 1 fect that occurs in the presence of a magnetic field, the ment network depolymerizes and returns to the pool as : phonon Hall effect,12,13 where robust vibrational edge ATP-actin. Eventuallycappingproteinsstopthegrowth v modes can be observed very much like the edge elec- of the branches.21 i X tronic states in the Quantum Hall Effect. The effect One un-explained issue is the way in which the Micro- r was recently proposed to have a topological nature,14 by filaments continue to grow while their ends push against a following an analysis similar to that of Ref. 11. As op- the cell membrane, as is the case when they generate posed to the phonon Hall effect, the emergence of the themotileforce.21 ItisdifficulttoexplainhowtheATP- topological phonon modes described in the present work monomers from the solution are still able to collide with (and in Ref. 11) does not require any external field and theendsofthefilaments. AccordingtotheElasticBrow- is a consequence of the special intrinsic properties of the nian ratchet model,21,24 the Microfilaments vibrate as structures. spring-likewiresandtheedgesadjacenttothecellmem- The lattice presented in Ref. 11, exhibiting topolog- brane bend laterally, exposing the ends to the pool of ical phonon modes, was inspired from the structure of ATP-actin. This allows additional actin monomers to Microtubules,15 a biomaterial synthesized by all living squeezeinandattachthemselvestotheendsofbranches, cells. Microtubules display a phenomenon known as dy- as illustrated in Fig. 1. The restoring force straightens namicinstability(DI),16–19 inwhichtheyrandomlygrow theMicrofilament,whichpushesagainstthecellwallgen- and shrink in length, a process that is essential for their erating the motile force. 2 Eq. 1. The ansatz of traveling waves: Cell Membrane PooMl oofn AoTmPe-rAsctin ^(^^( ξnα(t)=Re(cid:2)Aα(k)ei(ωt−kn)(cid:3), k ∈[−π,π] (2) ^ leads to the usual normal modes equation: ^( [Mˆ(k)−ω2]A(cid:126)(k)=0, (3) ^ Microfilament where M(k) = (cid:80) tm e ikm and A(cid:126)(k) is the K di- α,β m αβ − mensional vector encoding the amplitudes Aα(k). Let ω (k) and A(cid:126) (k), s= 1,...,K, be the solutions to Eq. 3. s s FIG. 1. (Color online) The ends of the Microfilaments oscil- The solutions at k=±π are identical. Also, A(cid:126) (k) are s latewhilepushingagainstthemembrane,exposingtheirends assumed to be normalized to one: A(cid:126) (k)·A(cid:126) (k)=1, for to the pool of available ATP-Actin. The ATP-Actin is then ∗s s all s= 1,...,K. abletoattachtotheexposedendsandcontinuethefilament’s One essential requirement is the existence of a gap in polymerization. the vibrational spectrum of the system, that is, an inter- val [ω ,ω ] empty of normal frequencies: ω (k) < ω + s WehypothesizethatthebendingoftheMicrofilaments for s =− 1,...,S and ωs(k) > ω+ for s = S +1,...,K−, is caused by topological edge modes, powered by the 12 with ω+ strictly larger than ω . We refer to the interval kTs released during hydrolysis of the ATP-actin. The [ω ,ω+] as the spectral gap. − present work demonstrates the existence of such modes −For each k, the K normal modes A(cid:126)s(k) generate a K- infilamentarystructuressimilartothatoftheMicrofila- dimensional complex space CK. The S modes with fre- ments. Asweshallseethroughexplicitsimulations,such quenciesbelowthespectralgapgenerateaS-dimensional edge modes do not allow the energy to dissipate into the subspace S, which we should view as an S-dimensional bulk of the filaments, and could indeed lead to vigorous hyperplane of the K-dimensional complex space. When shakeup of the ends of the structures, even when excited the k-number is changed, this hyperplane twists, much with weak stimuli. The phonon modes discussed in this as a Moebius band will in real 3-dimensional space. Our work are of a different type from those previously found task is to classify the twists of the S-dimensional hyper- in Microtubules, which required a 2D structure and spe- plane. cial interactions. We do not exclude that newly found modes may exist in Microtubules. The paper gives a general classification of filamentary A. General Arguments structureswithinversionsymmetryandprovidesasimple anddirectcriteriumtoidentifythosestructuressupport- We assume that the 1D harmonic lattice has inversion ing topological phonon modes. The paper also presents symmetry,whichimpliestheexistenceofak-independent anexplicitmechanicallatticethatdisplaysthisnewphe- matrix P such that nomenon, which is investigated through analytic calcu- PMˆ(k)P 1 =Mˆ(−k), (4) lations and computer simulations in both time and fre- − quency domains. where P is an unitary matrix that squares to indentity: PP =Iˆ, PP =Iˆ. (5) † I. A Z TOPOLOGICAL CLASSIFICATION OF 2 The inversion symmetry and the matrix P will be dis- THE STRUCTURES WITH INVERSION cussed in great detail for our explicit example. In the SYMMETRY following, we demonstrate that the harmonic lattices with inversion symmetry fall into at least two topolog- The topological classification of the electronic sys- ical classes. tems with inversion symmetry was recently discussed in The following analysis is standard in Quantum Refs. 25 and 26. Here we will adopt the 1 dimensional Mechanics,27butisdefinitelynotcommonforthepresent discussionpresentedinRef.25tothecontextofmechani- context. We need to define a parallel transport, that is, calwaves. Consideraperiodic1Dharmoniclattice,with a rule that tells us how to change a vector in the hy- K degrees of freedom ξ per repeating cell, governed by perplane S when k is modified so that it stays parallel. the following equations of motion: The construction of the parallel transport is not unique, however, the emerging topological classification is inde- ξ¨α =−(cid:80) tm ξβ , (1) n m,β αβ n+m pendent of how the parallel transport is defined.28 Let Pˆ(k)denotetheprojectorontotheS-dimensionalhyper- where t’s are coefficients specific to each structure (see plane generated by the normal modes with frequencies for example Eqs. 23 and 24). The equations of motion below the spectral gap: for any periodic system slightly perturbed from its equi- librium configuration can be cast into the form shown in [Pˆ(k)] =(cid:80)S [A(cid:126) (k)] [A(cid:126) (k) ] . (6) αβ s=1 s α s ∗ β 3 -! ! we conclude that det{Uˆ }2=1. Consequently, the deter- γ minant can take only two values: ! ! ’ det{Uˆ }=±1. (11) γ This is one of our main conclusions. It shows that the setofmatricesMˆ(k)satisfyingEq.4canbesplitintotwo categories C , the criterium being the value of det{Uˆ } γ for the corre±sponding monodromy. A matrix Mˆ(k) that FIG.2. (Coloronline)Theadiabatictransportiscarriedover was placed in one category can not be morphed into a the paths γ and γ(cid:48). matrix from the second category by a continuous defor- mation that keeps the spectral gap open. Indeed, under such deformation, Uˆ will change smoothly and, conse- γ This is a K×K matrix and S-dimensional hyperplane S quently, its determinant must change smoothly. Hence, is then simply given by Pˆ(k)CK. A parallel transport it cannot make sudden jumps between +1 and −1. If can be defined by the so called monodromy Uˆ(k,k0), de- the spectral gap closes, than Pˆ(k) becomes ill defined fined as the unique solution to the equation: and the monodromy Uˆ can no longer be defined. If the γ ∂ Uˆ(k,k )=i[Pˆ(k),∂ Pˆ(k)]Uˆ(k,k ), (7) gap opens again, the monodromy Uˆγ can emerge with a k 0 k 0 different determinant. with the initial condition Uˆ(k ,k )=Pˆ(k ). Once we In the following, we describe how one can determine computed this Uˆ(k,k ) for each0 k0∈[−π,π0], we can de- the signature of det{Uˆγ} through an elementary calcula- 0 tion. We have successively: fine the parallel transport as the map that takes an ini- tikni.atloPvthehycestiovcreacAl(cid:126)ltyo(,krt0Ah)(cid:126)=i(sk(cid:80)p)=aSsr=Uˆa1l(lckesl,Ak(cid:126)t0rsa)(Akn(cid:126)0s(p)koo0r)fttohgfeitvhheeysphtehyreppelcrahpnalenangaetekain0t de=t{Udˆeγt}{U=ˆ(dπe,t0{)UPˆ(Uˆπ(,00,)πUˆ)(P0−,−1}π.)} (12) a vibrational state of the system when the frequency is adiabatically changed. Taking into account that P 1=P and inserting the ap- − Sincethenormalmodesatk=±π areidentical,wecan propriate projectors, we obtain: identifythesetwok pointsandthinkthatk isdefinedon acircleasinFig.2. Ifwedoso,thenweseethatUˆ(π,−π) det{Uˆ }=det{Pˆ(π)Uˆ(π,0)Pˆ(0)PPˆ(0)Uˆ(0,π)Pˆ(π)P}. γ takes the hyperplane Pˆ(−π)CK into himself, becoming (13) an unitary matrix that we will call Uˆ , to relate it to Usingagaintheelementarypropertiesofthedeterminant γ the paths shown in Fig. 2. It is known from the non- and the fact that Uˆ(π,0)Uˆ(0,π)=Id we obtain: Euclidean geometry that the parallel transport along a closedpathwillnotnecessarilyreturnavectorintoitself. det{Uˆ }=det{Pˆ(0)PPˆ(0)}det{Pˆ(π)PPˆ(π)}. (14) γ Somethingsimilarhappenshere,thatis,themapUˆ does γ not return a vector into itself. Inotherwords,allweneedistocomputetheactionofin- The monodromy Uˆ has special properties when the version symmetry operation P at the special points k=0 γ inversionsymmetryispresent. Indeed,assumingk =−π, andk=π. Asweshallsee,forconcreteexamplesthiscan 0 a conjugation of Eq. 7 with P gives: be accomplish through straightforward calculations. ∂ {PUˆ(k,−π)P 1} k − (8) B. Existence of the edge modes =i[Pˆ(−k),∂ Pˆ(−k)]PUˆ(k,−π)P 1, k − with the initial condition PUˆ(−π,−π)P 1=Pˆ(π). This We show here that the systems with det{Uˆγ}=−1 are − likely to display edge phonon modes. For this, we imag- is just the equation for Uˆ(−k,π), which simply shows ine the following experiment. We take the infinitely long that PUˆ(k,−π)P 1 coincides with Uˆ(−k,π). Equiva- − chain and we synchronously weaken the interactions be- lently, we can think that P sends the path γ into the tween the 0th and 1st cell, and between the Nth and path γ(cid:48) of Fig. 2. Now obviously UˆγUˆγ(cid:48) equals identity, (N +1)th cell, and so on, such that when these inter- therefore: actions are set to zero, we obtain decoupled finite chain det{Uˆ PUˆ P 1}=1. (9) pieces of length N. We will call the action we just de- γ γ − scribed the decoupling process. During decoupling, we Using the elementary properties of the determinant, assume that the inversion symmetry is preserved. At any moment of the decoupling process, we can see det{AB}=det{A}det{B}, det{P 1}=det{P} 1, thealteredchainasanewperiodicchainwhoserepeating − − (10) cell contains N cells of the original chain. Therefore the 4 K++,l++ n (+) K+−,ln+− (-) K−+,l FIG.4. (Coloronline)IfK =K ,thestructureismapped ++ −− K−−,ln−− intoitselfbythesymmetryoperationsshowninthisdiagram. FIG. 3. (Color online) The structure consists of a periodic dimerintheplaneofthestructureandaroundthecenter array of dimers, connected by four different springs. The di- agram depicts the system at equilibrium. of mass, described by the angle φn. We assign the labels ±tothemassesontheupper/lowerrowsofthestructure. Using these labels, the springs between two dimers can wholediscussionofthelastsubsectionstillapplies. Ifone be uniquely labeled by αβ, depending on which masses computesthemonodromymatrixUˆ anditsdeterminant are connected by it. The corresponding spring constants γ for the new chain, he will find the following. At the be- will be denoted by Kαβ. ginning of the decoupling process, with the interactions Let us point out that if we chose K++=K , then untouched,det{Uˆ }=±1forchainsbelongingtoC cate- the system is symmetric to the operations des−cr−ibed in γ gories,respectively. Attheendofthedecouplingp±rocess, Fig. 4. These operations define the inversion symmetry Mˆ(k) becomes independent of k and consequently either of our system. Uˆ =Pˆ(−π)anddet{Uˆ }=1, orUˆ cannotbedefinedbe- γ γ γ cause the system became gapless. For a system in the A. The Equations of Motion C category, both scenarios imply that the spectral gap cl−oses during the decoupling. Thus, at least one pair of phononbandsmustemergeinthespectralgap,oneband We decided to discuss the equations of motion for the coming from the upper and and one from the lower edge system in detail, in order to assist those who want to ex- ofthespectralgap. Thesetwobandsmustmovetowards plorebeyondwhatispresentedhere. Withthenotations each other until they touch. In very special instances, introduced in Fig. 5, the positions of two masses of the which we were actually never able to observe, these two n-th dimer can be conveniently written as: bands may continue to move until they disappear from xα =x −αdsin(φ ); yα =αdcos(φ ). (15) thespectralgap. Butingeneral,thebandsendupinside n n n n n the spectral gap at the end of the decoupling process, on The equations of motion for the n-th dimer are: topofeachother. Thebandsbecomedispersionless,that is,completelyflat,andthemodescorrespondingtothese 2Mx¨ =F , 2Md2φ¨ =τ , (16) n n,x n n flat bands represent vibrational modes localized at the two ends of each finite piece of chain. This is in striking where F and τ represent the net horizontal force and n,x n contrast with the case of simple harmonic lattices, that the net torque on the n-th dimer. They are given by: is,periodicarraysofharmonicallyinteracting(pointlike) bodieswithoutinternalstructure,whereitwasconcluded Fn,x =(cid:80)α,β(cid:2)Fnα,βx−Fnβα1,x(cid:3) (17) in Ref. 29 that vibrational modes localized at the edges − and are very unlikely to occur in one dimensional structures. The vibrational modes discussed above are robust, in τ = (cid:80)(cid:2)(xα−x )(Fαβ −Fβα ) the sense that, no matter how the decoupling is done, n n n n,y n 1,y α,β − (18) these edge modes will always emerge during the decou- pling process. For example, a real lattice might become −ynα(Fnα,βx−Fnβα1,x)(cid:3) − strongly distorted near the edges when a finite piece is beingcutoutbut,eveninthiscase,westillexpecttosee where Fαβ are the horizontal/vertical components of n,x/y edge phonon modes for a system in the C category. the forces generated by the springs at the right side of − the n-th dimer: Fαβ =K (1−lαβ/lαβ)(xβ −xα) II. EXAMPLE OF A TOPOLOGICAL STRING n,x αβ 0 n n+1 n (19) Fαβ =K (1−lαβ/lαβ)(yβ −yα), n,y αβ 0 n n+1 n In this section we introduce our example. It is the structure shown in Fig. 3, made of an array of dimers, with: consistingoftwomassesM linkedbyarigidandmassless (cid:113) arm of length 2d. The adjacent dimers are connected lαβ = (xβ −xα)2+(yβ −yα)2 (20) n n+1 n n+1 n by four different ideal springs. We will allow only two degrees of freedom per dimer: a horizontal motion of being the distance between the α and β masses of the the center of mass, whose position will be marked by x n-thandn+1-thdimers,andlαβ beingtheun-stretched n 0 (y willbeconstrainedto0),andapivotalmotionofthe length of the αβ spring. n 5 φn 1 φn φn+1 form of the equations of motion: − ) )K++,l++ ) −ξ¨1 =−1(cid:80)Ωxx(ξ1 −2ξ1 +ξ1 ) n n 2 αβ n+1 n n 1 αβ − ,ln−+ K+−,ln+− −(cid:80)α[Ωxαxαcosφ0+Ωxαyαsinφ0]ξn2 (23) α K−−,ln−− +1(cid:80)α[Ωxx cosφ +Ωxy sinφ ](βξ2 +ξ2 ) xn 1 xn xn+1 2 αβ αβ 0 αβ 0 n+1 n−1 − and FIG. 5. (Coloronline) The diagramintroduces the notations used in the text. The array of dimers is shown at the equi- −ξ¨2 =−(cid:80)α[Ωxx cosφ +Ωxy sinφ ]ξ1 librium (faded) and at some arbitrary snapshot in time. x n αα 0 αα 0 n n α representsthepositionofthecenterofmassofthen-thdimer +1(cid:80)α[Ωxx cosφ +Ωxy sinφ ](ξ1 +βx1 ) andφn representstheangleofrotationofthen-thdimerrel- 2 α αβ 0 αβ 0 n+1 n−1 ativetotheverticalaxis. Intheequilibriumconfiguration,all φ are equal to φ . +(cid:80)(cid:8)[Ωxx cos2φ +Ωyy sin2φ ]+ n 0 αβ 0 αβ 0 αβ α[(Fαβ −Fβα )cosφ −(Fαβ −Fβα )sinφ ](cid:9)ξ2 2.5 (a) 2 (1) (b) 2d n,y n−1,y 0 n,x n−1,x 0 n !on 1.52 (2) 1.5 (2) −(cid:80)αββ[Ωxαxβcos2φ0+Ωyαyβsin2φ0](ξn2+1+ξn2−1). ati 1 (24) uls 1 (1) The coefficients have the following explicit expressions: P 0.5 0.5 0 0 Ωxx = Kαβ (cid:26)1− l0αβ (cid:20)1−(cid:16)∆xαβ(cid:17)2(cid:21)(cid:27) (25) -" k " -" k " αβ M lnαβ lnαβ FKIG. 6=. KThe p=ho2noanndba(nbd)sKfor (a=) KK−− == 0K.5++an=d K0.5 an=d Ωyy = Kαβ (cid:26)1− l0αβ (cid:20)1−(cid:16)∆yαβ(cid:17)2(cid:21)(cid:27) (26) K−+ =4. +− −− ++ −+ αβ M lnαβ lnαβ +− and Theaboveequationsofmotionhavebeenimplemented Ωxy =Ωyx = Kαβ l0αβ ∆xαβ∆yαβ, (27) numerically and the time evolution of the structure has αβ αβ M lnαβ (lnαβ)2 been investigated using a 4th order Runge-Kutta time with ∆x =xα −xβ and ∆y =yα −yβ. The dimers propagator. The results will be presented shortly. In all αβ n+1 n αβ n+1 n are assumed in their equilibrium configuration in these our calculations, we used length and time units so that last two equations. M =1, l0++ =l0−− =1 and d was set to 1. Tosimplifytheequations,weassumefromnowonthat none of the springs are under tension at the equilibrium configurationandthatthelαβ arechosensuchthatφ =0. 0 0 B. The Small Oscillations The ansatz ξi=Re{A ei(ωt kn)} leads to the following n i − normal modes equation Mˆ(k)A(cid:126) =ω2A(cid:126), with: To explain and understand the features seen in our timedomainsimulations,itisusefultocomputefirstthe Mˆ(k)=(cid:2)(cid:80) Kxx −(cid:80) Kxxcosk(cid:3)Iˆ αβ αβ α αα phonon spectrum of our structure, that is, the relation between the frequency and the wavenumber of the wave −σˆ1(1−cosk)(cid:80)ααKαxαx +σˆ2sink(cid:80)ααKαxxα (28) − propagating modes. Let us introduce the notation: −σˆ cosk(cid:80) αKxx , 3 α α α − ξ1 =x −xeq, ξ2 =dφ . (21) where σˆ ’s are the Pauli’s matrices: n n n n n i In the linear regime, that is, when the dimers are only σˆ1 =(cid:0)01 10(cid:1), σˆ2 =(cid:0)0i −0i(cid:1), σˆ1 =(cid:0)10 01(cid:1). (29) − slightly perturbed from their equilibrium configurations, The normal modes equation has two solutions ω (k) we have: 1,2 and A(cid:126) (k). 1,2 xα =xeq+ξ1 −αcos(φ )ξ2, yα =−αcos(φ )ξ2. (22) Let us start the discussion of these solutions from the n n n 0 n n 0 n special case when K =K and K =K . In this ++ + + Plugging these expressions in Eq. 16 and retaining only case, the normal modes equ−a−tion becom−es: − tshtreailginhetaforrtweramrdscinalξcu1laantidonξs2,,wafeteorbtteadiinoeudstbhuetloitnheearrwiziesde (cid:0)(cid:15)01 0(cid:15)2(cid:1)(cid:16)AA12(cid:17)=ω2(cid:16)AA12(cid:17), (30) 6 and consequently the system is topologically nontrivial 2 2 andweshouldobserveedgemodes. Notethatwhencom- !n 1.5 1.5 puting the determinants in Eq. 35, one needs to discard o the null eigenvalues. Pulsati0.51 0.51 twIefenweKkeepaKnd−+K+=+K, t+h−easynsdtecmonsstidilelrhaasdaiffneriennvceersbioen- symmetr−y−but in this case the symmetry is implemented 0 0 -" " -" " in the k-space by the identity matrix. Hence: k k det{Pˆ(0)PPˆ(0)}det{Pˆ(π)PPˆ(π)}=+1. (36) FIG.7. Thespectralgapopeningfor(a)K =K =0.5, −− ++ K =3 and K =5 and (b) K =0.3, K =0.7 and −+ +− −− ++ Consequently, the system is trivial and we should not K =K =4. −+ +− observe robust edge modes. To verify these predictions, we performed the follow- with ing numerical experiment. We considered a chain of 100 dimers linked in a circle configuration (the radius of the (cid:15)1 =(cid:80)αβΩxαxβ(cid:2)1−cosk(cid:3), circle is very large so any physical bending of the struc- (31) (cid:15) =(cid:80) Ωxx(cid:2)1−αβcosk(cid:3). turecanbeignored). InourtheoreticalargumentofSec- 2 αβ αβ tion IB we used a gedanken experiment involving an in- finite chain which was gradually sectioned in finite equal Thephononmodesdecoupleintoamode(corresponding pieces. In practice, we cannot simulate such an infinite to (cid:15) ) that involves displacements of the centers of mass 1 chain,butwecanstillstartfromaconfigurationwithno but no pivotal motion and a mode (corresponding to (cid:15) ) 2 edges (to avoid un-wanted phonon reflections), which is which involves pivotal motion and no displacements of preciselythecircleconfigurationmentionedabove. Then the centers of mass. weslowlyweakenedallfourspringconstantsbetweentwo Depending on the common values given to K and ++ dimers,bymakingthesubstitutionK →wK withwcon- K and to K and K , the phonon bands can as- su−m−e two distin+c−t behavio−r+s as shown in Fig. 6. We are tinuously varying from 1 to 0. When w =0, the circle is fully opened in a finite piece with two separated edges, primarily interested in the case (b) because, as exempli- exactly like in the gedanken experiment. If topological fied in Fig 7, when the bands cross each other in that phonon modes are present, we expect to see them grad- way, a small mismatch between K and K or be- + + ually emerging from the bulk spectrum as described in tween K and K will open a ga−p in the−spectrum, ++ Section 1B. thus realizing the la−s−t requirement of our general theory. For each w we have computed all 200 normal modes andweplacedtheirfrequenciesonaverticalaxes. Fig.8 shows the results of these calculations, which illustrate C. The Edge Spectrum how the frequencies of the normal modes change as w is varied from 1 to 0. In the topological case K = As already mentioned, if we set K++=K , the sys- K++ = 0.5 and K = 3 and K = 5 one ca−n−ob- tembecomessymmetrictotheinversionoper−a−tionshown servetwosolitaryno+rm−alfrequencie−s+separatingfromthe in Fig. 4 and the Mˆ(k) matrix becomes: bulk spectrum and moving towards each other. When Mˆ(k)=(cid:2)(cid:80) Kxx −(cid:80) Kxxcosk(cid:3)Iˆ the two edges are completely formed at w = 0, the two αβ αβ α αα (32) frequencies meet near the middle of the gap (the oscilla- +σˆ sink(cid:80) αKxx −σˆ cosk(cid:80) αKxx . tory motion of these modes is discussed in the next sec- 2 α α α 3 α α α − − tion). In contradistinction, no such modes are observed In the k-space, the inversion symmetry is implemented for the non-topological case K =0.7, K =0.3 and ++ by P =σ and one can explicitly verify that: K = K = 0.5. This exp−l−icit calculation confirms 3 + + ou−r general −theoretical predictions. σˆ Mˆ(k)σˆ =Mˆ(−k). (33) 3 3 Moreover, the projectors at the special points k =0 and D. Time Domain Analysis πcanbecomputedexplicitly. Assuming(cid:80) αKxx <0, α α α they are: − As already mentioned, the (non-linear) equations of Pˆ(0)= 1(Iˆ−σˆ ), Pˆ(π)= 1(Iˆ+σˆ ) (34) motion have been implemented numerically and the mo- 2 3 2 3 tionofthedimmershasbeenstudiedinrealtime30. Here, If (cid:80) αKxx > 0, the expressions will be switched. In wediscussthemanifestationoftheedgemodesinthereal α α α both cases,−we can explicitly verify that: time dynamics of the dimer chain. For this, we consid- ered a chain containing N=100 dimers plus two addi- det{Pˆ(0)PPˆ(0)}det{Pˆ(π)PPˆ(π)}=−1, (35) tional”edge”dimers. Wefixedtheveryleftdimertothe 7 ^^^(((^^^(((^^^ ^^^ ^(^ KK+++-==30..05,, KK--+-==05..50 KK+++-==40..03,, KK--+-==04..70 fffiiixxxfffieeieixxxdddeeedddfixed ^^^^((((^^^(((^^^^ ^^^(1)(((111)))(((111))) 5(((aaa)))(((aaa))) (a) ttt===ttt555===000555000000t=000500 5 (((aaa’’’()))(a((a’aa)’’’))) 0 0 -5 -5 m 0.2 0.2 u 0 0 r -0.2 -0.2 t c 0.5 0.5 e p 0 0 S -0.5 (b) t=1000 -0.5 (b’) 5(((bbb)))(((bbb))) ttt===ttt111===000111000000000000000 5 (((bbb’’’)))(((bbb’’’))) 0 0 -5 -5 0.2 0.2 0 0 -0.2 -0.2 t=2000 0.5 (c) 0.5 (c’) 0 0 1 w 0 1 w 0 -0.5 -0.5 5(((ccc)))(((ccc))) ttt===ttt222===000222000000000000000 5 (((ccc’’’)))(((ccc’’’))) 0 0 FIG.8. Eachverticalsequenceofdotsrepresentthefrequen- -5 -5 cies of the normal modes of a chain made of 100 dimers ar- 0.2 0.2 rangedinacircle. ThespringconstantsK ofthespringscon- 0 0 -0.2 -0.2 necting two dimers were gradually weakened by making the 0.5 0.5 substitutionK→wK andlettingwvaryfrom1to0. Thefre- 0 0 quencieswererecomputedformanywvalues. Panel(a)refers -0.5 -0.5 to the topological case, and panel (b) to the non-topological case. FIG. 9. (Color online) Top diagram: Representation of the dimer chain and the forced motion of the rightmost dimer. Main panel: The trajectories covered by the dimers after upward position while forcing the very right dimer into t=500, 1000 and 2000. Each sub-panel contains three plots, the following motion: representing, from the top to bottom, the actual trajectories of the dimers, the trajectory of the horizontal displacements xN+1 =A1sinωt, φN+1 =A2sinωt. (37) xn(t), and of the angular displacements φn(t). Plots (a) (b) and(c)representthebehaviorofthedimersinthetopological The rest of the N dimers were released from the equilib- case where K =K++=0.5 and K =3 and K =5. −− +− −+ rium with zero velocities (see Fig. 9). Plots (a(cid:48)) (b(cid:48)) and (c(cid:48)) represent the behavior of the dimers The resulting motion of the dimers has been plotted inthenon-topologicalcasewhereK =0.7,K =0.3and −− ++ every ∆t=3, and movies were generated for various pul- K =K =4. −+ +− sations ω. For a more complete representation, we chose to look at (1) the actual dimer positions, (2) only at the horizontaldisplacementx (t)ofeachcenterofmass,and to be in the middle of the spectral gap. The movie was n (3) only the angular displacement φ (t) of the dimers as allowed to run for three time intervals: 500, 1000, 2000. n a functions of time. In the following, we will make refer- The left panels in Fig. 9 simulate the situation illus- ence to the wave modes discussed in subsection IIC. The tratedinFig.8(a). Thisisthetopologicalcase,forwhich movies (see the supplemented material) reveal that, in- the spring constants were set to K =K =0.5 and ++ deed,ifωisbelowapproximately1.4(seeFig.6),onlythe K = 3 and K = 5 and an e−d−ge resonance is ex- + + wave propagating mode that involves the translation of pec−ted. Asonecan−see,onlytheamplitudesofthedimers thedimersisexcited,eventhoughA wasgiventhesame close to the right edge reach appreciable values and the 2 valueof0.03asA . Above1.4andbelowtheedgeofthe amplitudes are seen to decay exponentially away from 1 spectralgapweseebothwavemodesbeingexcited. Sim- the edge, demonstrating that we are indeed dealing with ilarbehaviorsareobservedabovethespectralgap. What an edge mode. Furthermore, one can see the amplitudes really interests us is what happens when ω takes values increasing as time progressed, the angular displacement inside the spectral gap. In order to generate a mean- of the second right dimer reaching an amplitude of ap- ingful plot, we let the movies progress without erasing proximately 0.4 after t = 2000, more than 10 times the theimagesalreadyplayedout. Theresultingplotsshows amplitude of the forced oscillation imposed on the first the trajectories followed by each dimer and, in particu- dimer. This reveals an important property of the edge lar, they reveal the amplitudes of the oscillating motion resonance, namelytheabilitytoabsorbandstoreenergy for each dimer at the time when the movie was stopped. in the proximity of the edge of the structure. In Fig. 9, the last dimer was forced into the motion de- TherightpanelsinFig.9simulatethenon-topological scribed in Eq. 37 with A =A =0.3 and ω=1.6, chosen case presented in Fig. 8(b), where the spring constants 1 2 8 were set to K = 0.7, K = 0.3 and K = K = aments. We hypothesized that the energy from the ATP ++ + + 4.0. In this ca−s−e we don’t expect an edge −mode and−in- hydrolysis in Microfilaments is stored in these robust vi- deed the amplitudes of the dimers near the edge remain brations and is then used to drive the motion described practically zero at all times. in the Elastic Brownian ratchet model. This opens an There is a small artifact in the plots of Fig. 9. Due interestingresearchdirection,whichisworthwhilepursu- to a non-stationary effect steaming from the relatively ingbecausewebelievethat,withthepresenttechnology, large amplitude used for shaking the end dimer, the av- well designed and focused experiments can reveal if the eragepositionsofthecentersofthedimersslowlydriftto Microfilaments have or have not edge modes. the left in time. Because of the way we generate Fig. 9, Although not very accurate, the model allowed us to this drift may give the impression of a finite oscillation present the concept of topological phonon modes in a amplitude for dimers away from the edges. We prompt very explicit and detailed exposition, without being de- the reader to watch the movie, where one can clearly see railed by unnecessary complications. The simplicity of that the oscillation amplitudes of the dimers away from the structure will allow detailed analyses of other inter- the edges are practically zero (the slow drifting motion esting questions, such as what happens when defects are is also visible). presentthroughoutthebulkofthechain,howistheedge excited by the hydrolysis of GTP actin or tubulin, how isdamping effectingthe picture, etc.. The structurepre- III. CONCLUSIONS sentedherecanbecomeaveryusefulpedagogicaltoolto introducetheconceptoftopologicalphononmodesinan Using a monodromy argument, we have demonstrated accessible and explicit way via computer simulations or that the filamentary structures with inversion symme- real lab observations. try fall into at least two topologically distinct classes. We have argued that one of the two classes contain sys- tems that should display robust topological edge modes. ACKNOWLEDGMENTS Thegeneraltheoreticalpredictionswereverifiedusingan explicit example of a mechanical structure that display This research was supported by a Cottrell award from robust edge modes. the Research Corporation for Science Advancement and ThestructurewasinspiredfromthatofactinMicrofil- by the office of the Provost of Yeshiva University. 1 C. L. Kane and E. J. Mele, Phys. Rev. Lett. 95, 226801 105, 225901 (2010). (2005). 15 A. Desai and T. J. Mitchison, Annu. Rev. Cell Dev. Biol. 2 C. L. Kane and E. J. Mele, Phys. Rev. Lett. 95, 146802 13, 83 (1997). (2005). 16 D. K. Fygenson, E. Braun, and A. Libchaber, Phys. Rev. 3 B. A. Bernevig, T. L. Hughes, and S.C. Zhang, Science E 50, 1579 (1994). 314, 1757 (2006). 17 J. Howard and A. A. Hyman, Nature 422, 753 (2003). 4 M.Ko¨nig,S.Wiedmann,C.Bru¨ne,A.Roth,H.Buhmann, 18 H.Y.KuehandT.J.Mitchison,Science325,960(2009). L. Molenkamp, X.-L. Qi, and S.-C. Zhang, Science 318, 19 A. Dimitrov, M. Quesnoit, S. Moutel, I. Cantaloube, 766 (2007). C. Pous, and F. Perez, Science 322, 1353 (2008). 5 M. Z. Hassan and C. L. Kane, Rev. Mod. Phys, to ap- 20 M. A. Jordan and L. Wilson, Nature Rev. Cancer 4, 253 pear(2010). (2004). 6 X.-L. Qi and S.-C. Zhang, Physics Today 63, 33 (2010). 21 T. D. Pollard and G. G. Borisy, Cell 112, 453 (2003). 7 E. Prodan, J. Math. Phys. 50, 083517 (2009). 22 K. C. Holmes, Nature 457, 389 (2009). 8 E. Prodan, J. Phys. A: Math. Theor. 42, 082001 (2009). 23 D. J. Gordon, Y. Yang, and E. Korn, J. Biol. Chem. 251, 9 F. D. M. Haldane and S. Raghu, Phys. Rev. Lett. 100, 7474 (1976). 013904 (2008). 24 A. Mogilner and G. Oster, Biophys. J. 71, 3030 (1996). 10 S.RaghuandF.D.M.Haldane,Phys.Rev.A78,033834 25 T. Hughes, E. Prodan, and B. A. Bernevig, (2008). arxiv:1010.4508(2010). 11 E. Prodan and C. Prodan, Phys. Rev. Lett. 103, 248101 26 A. M. Turner, Y. Zhang, R. S. K. Mong, and A. Vish- (2009). wanath, arxiv:1010.4335(2010). 12 C. Strohm, G. L. J. A. Rkken, and P. Wyder, Phys. Rev. 27 F. Wilczek and A. Zee, Phys. Rev. Lett. 52, 2111 (1984). Lett. 95, 155901 (2005). 28 J. Milnor and M. Stasheff, Characteristic Classes, Annals 13 A.V.InyushkinandA.N.Taldenkov,JETPLett.86,379 of Math. Studies, Vol. 76 (Princeton Univ. Press, 1974). (2007). 29 J. W. Jiang and J. S. Wang, Phys. Rev. B 81, 174117 14 L.Zhang, J. Ren, J. S.Wang, andB.Li, Phys.Rev. Lett. (2010). 30 See EPAPS Document No. XXX for a demonstration.

See more

The list of books you might like