Logout succeed
Logout succeed. See you again!

Ultrafast ultrasonic imaging coupled to rheometry: principle and illustration PDF
Preview Ultrafast ultrasonic imaging coupled to rheometry: principle and illustration
Ultrafast ultrasonic imaging coupled to rheometry Ultrafast ultrasonic imaging coupled to rheometry: principle and illustration ThomasGallot,1,a) Christophe Perge,1 Vincent Grenard,1 Marc-Antoine Fardin,1 Nicolas Taberlet,1 and S´ebastien Manneville1,b) Universit´e deLyon, Laboratoire dePhysique, E´coleNormaleSup´erieure de Lyon, CNRSUMR5672, 46All´eed’Italie, 69364 Lyon cedex 07, France. (Dated: 30 January 2013) We describe a technique coupling standard rheology and ultrasonic imaging with promising applications to characterizationofsoftmaterialsundershear. Planewaveimagingusinganultrafastscannerallowstofollow the local dynamics of fluids sheared between two concentric cylinders with frame rates as high as 10,000 images per second, while simultaneously monitoring the shear rate, shear stress, and viscosity as a function 3 oftime. The capacitiesofthis “rheo-ultrasound”instrumentareillustratedontwoexamples: (i) the classical 1 case of the Taylor-Couette instability in a simple viscous fluid and (ii) the unstable shear-banded flow of a 0 2 non-Newtonian wormlike micellar solution. n PACS numbers: 07.64.+z,43.58.+z,83.85.-c a J 9 I. INTRODUCTION geometries13,14. Shear is generally applied by a rotating 2 toolattachedto a measuringdevice involvinganairor a ] Soft matter is a flourishing field that involves an ever magnetic bearing. The most common shear cell geome- ft increasing number of characterization tools. Among tries are (i) the cone-and-plate,where the sample is con- o them, techniques that allow one to follow the dynam- fined between a rotating cone and a fixed plate, (ii) the s ics of complex fluids under shear are required to bet- plate-and-plate, where the sample is confined between . at ter understand the coupling between the shear flow and a rotating plate and a fixed plate, and (iii) the Taylor- m the material microstructure, i.e. its organization at the Couette geometry,where the sample is confinedbetween supramolecularscale1. Indeed,non-Hookeanand/ornon- a fixed outer cylindricalcup and an inner rotating cylin- - d Newtonian features in soft materials typically arise from drical bob. Rheological data captured by a rheometer n the modification of the microstructure due to deforma- include the shear strain γ, the shear rate γ˙ =dγ/dt and o tion and flow. In turn, microstructural changes lead theshearstressσ experiencedbythematerial,whichare c to modifications of the fluid viscosity and hence of the respectively computed from the position of the rotating [ flow field. For instance, the alignment and elongation tool, its rotation speed and the torque exerted on the 1 of polymer molecules by shear are well known to lead tool. Standard rheological protocols consist in applying v to a reduction of the viscosity, known as shear thin- either a constant γ˙ (σ resp.) and to measure the cor- 7 ning, in polymeric solutions. In some cases, due to this responding σ (γ˙ resp.), from which the apparent shear 5 feedback mechanism between flow and microstructure, a viscosity η =σ/γ˙ is deduced as a function of time, or to 9 6 homogeneous shear flow may become unstable and give impose an oscillating γ or σ, from which the viscoelas- ′ ′′ . wayto a heterogeneousflow constitutedofseveralbands tic moduli G and G , known as the elastic and viscous 1 of different local viscosities. Such a phenomenon, re- moduli, are respectively computed as the in-phase and 0 3 ferred to as shear banding in the literature, turns out quadrature-phase component of the measured response. 1 to be widespread among very different classes of materi- For all cell geometries the proportionality factors that : als, ranging from colloidal gels, emulsions, and pastes to link the rotation speed and the torque to the shear rate v self-assembled surfactant and polymer systems2–4. Yet, and to the shear stress are calculated based on various i X shearbandingisjustoneamongseveralexamplesofcom- assumptions on the flow and on the material. In par- r plexflowsfoundinsoftmaterials,whichmayalsodisplay ticular, both the flow and the material are assumed to a fractures in the bulk or apparent slip at the bounding remainhomogeneous. The readeris referredto standard walls5–12. The complete understanding of the physics of rheologytextbooksformoredetails13,14. Ourmainpoint such dynamical and heterogeneous phenomena calls for is that rheological measurements are essentially blind to space- and time-resolved investigations of the flow prop- localmicrostructuraland/orflow heterogeneitiessince it erties in well controlled geometries. provides only spatially averaged observables. Therefore Rheometryisthemostwidespreadtooltocharacterize complementary tools are needed to investigate complex the flow properties of a soft material in well-controlled flows such as the shear banding or fracture flows men- tioned above. In the last two decades a number of combined tech- niques have been introduced to go beyond standard a)Now at Department of Earth, Atmospheric and Planetary Sci- rheology and get simultaneous local information on ences,MassachusettsInstituteofTechnology,77MassachusettsAv- enue,Cambridge,MA02139-4307, USA. the microstructure and on the flow field. These have b)Also at Institut Universitaire de France; Electronic mail: been recently reviewed in3. Let us mention local [email protected] structural characterization under shear through light15, Ultrafast ultrasonic imaging coupled to rheometry 2 neutron16 and X-ray17 scattering or through birefrin- gence measurements18,19, as well as local velocity mea- surements through optical particle tracking20–22, ultra- sonic velocimetry23, or magnetic resonance imaging24. Among them the ultrasonic speckle velocimetry tech- nique (USV) developed by one of us led to a number of important findings on shear banding flows thanks to its fasttemporalresolution25,26. The aim ofthe presentpa- peristoextendourpreviousone-dimensionaltechnique23 to a combination of rheometry and ultrafast ultrasonic imagingleadingtoatwo-dimensionaltime-resolvedchar- acterizationofthe shearflow ofsoftmaterials. In Sec. II wedescribetheexperimentalsetupusedtoacquiresimul- taneously global rheological data and ultrasonic images of the sheared material with emphasis on the technical features of our ultrasonic technique and on the process- ingoftheacousticdata. InSec.IIItheinstrumentisfirst calibrated at low shear rates on a Newtonian fluid, a di- lute suspensionofhollowglassspheres. We further show that it can be used to image the toroidal vortices that appearabovethe criticalshearratecorrespondingtothe onset of the classical Taylor-Couette instability. Finally Sec.IVillustratesthecapabilitiesofthe techniqueinthe caseofasemidilute surfactantsolutionknowntopresent both shear-banding and viscoelastic instabilities27. II. EXPERIMENTAL SET UP Our apparatus consists of a custom-made ultrasonic scannercoupledtoacommercialrheometer. Itisderived from our previous one-dimensional ultrasonic velocime- try technique23. Figure 1(a) shows the general design of the various instruments involved in our technique. Be- low we briefly discuss the rheometer and the rheological cell,whicharebothstandardinthefieldofcomplexfluid characterization. Then we focus in detail on the ultra- sonic imaging system. FIG. 1. Sketch and picture of the experimental setup. A. Rheological measurements (a) Three-dimensional general view. (b) Top view of the gap oftheCouettecelltogetherwiththepathoftheacousticbeam The rheometer is a state-of-the-art stress-imposed and the various axes and angles defined in the text. (c) Pic- rheometer with a magnetic air bearing (TA Instruments ture showing the water tank with the ultrasonic transducer ARG2). It is equipped with a custom Taylor-Couette facing a smooth, transparent Taylor-Couette geometry with cell of height 50 mm. The radius of the inner rotating dimensions (R1 = 23 mm and R2 = 25 mm) smaller than that used in thetext. bob made of PEEK is R = 48 mm while the fixed cup 1 made of PMMA has a radius R = 50 mm, yielding a 2 gap e=R −R =2 mm. In a cylindrical geometry the 2 1 shearstressσ is notperfectly constantacrossthe gap: it shear rate across the gap. This concentric cylinder cell ratherdecreasesas1/(R +r)2,whereristhedistanceto terminated by a cone-and-plate type of geometry at the 1 theinnerbob. Inourcasethisleadstoadecreaseofσ by bottomisreferredtoasaMooney-Couettecellintherhe- δσ/σ ≃2e/R ≃8%fromthe(inner)bobtothe(outer) ology literature13,14. Moreover it is well-known that the 1 cup,whichcanbereasonablyneglectedsothatthestress physical-chemical properties of the cell walls may affect field canbe taken as quasi-homogeneous. Also note that drastically both global rheological properties and local the bottom ofthe innerbob ismachinedasa coneofan- flow behaviors8,11,28,29. In particular wall roughness can ◦ gle 2.3 and truncated at50 µm fromits tip, so that the be used to avoid slippage of the sample on the rotating shear rate below the rotating bob matches the average boband/oronthefixedcup. Herea“smooth”(polished) Ultrafast ultrasonic imaging coupled to rheometry 3 bob is used together with a “rough” (sand-blasted) cup. than 10 MHz. In the present paper only pulsed emis- The cell is immersed in a large water tank (total vol- sion is used to drive a high-frequency transducer array ume of 2.2 L) connected to a water bath (Huber Min- as described below. istat 230-CC-NR) that keeps the temperature constant The receiver is composed of a 12-bit linear analog- to within 0.1◦C [see Fig. 1(a,c)]. This water tank is also to-digital converter with a sampling frequency f = s used to provide acoustic coupling with a fair impedance 160 MHz and a bandwidth of 1 to 30 MHz, an ultra-low matching between the sample contained in the cell and noise amplifier with a maximum gain of 80 dB, and a theultrasonictransducerarray(seebelow). Thetemper- SDRAM memoryof32Msamples. The input impedance ature at which the present experiments are conducted is is 50 Ω. A real-time processor board is also featured, 20.2◦C everywhere except in Sect. IV. Finally the thick- whichallowsforareal-timeprocessingofultrasonicdata ness of the cup is 5 mm everywhere except for a rect- (notusedinthepresentwork)andforfasterdatatransfer angular region milled to provide a minimal thickness of to the computer. The ultrasonic scanner is programmed 1 mm and thus prevent a too strong attenuation of the under Matlab and the acquired data are stored on the ultrasound when travelling across the cup. PC hard drive for post-processing as described below in When illustratingthe technique inSecs.III andIV we Sec. IIC. shallonlyusetherheometerinthe“shearstartup”mode The ultrasonic probe used in the present work is a whereby a given steady shear rate is imposed starting custom-made linear array of 128 piezoelectric transduc- fromrestattimet=0andthesubsequentstressresponse ers designed by Imasonic. The transducers are 200 µm σ(t) is monitored. Howeverit is clear that the technique wide and spaced by 50 µm, resulting in a total active canbeadaptedtosteadyshearfromanyinitialshearrate length of 32 mm. They work at a central frequency other than zero, to “step strain” experiments where a f =15MHzwithabandwidthat-6dBofabout8MHz. givenstrainis imposed at t=0, to “creepand recovery” The wavelength in water is thus λ = c/f ≃ 100 µm, experiments where the shear stress is controlled rather with c=1480ms−1 the sound speedin waterat 20◦C.30 than the shear rate, or even to oscillatory shear experi- In the elevation direction, i.e. in the direction perpen- ments. In allthe experiments discussedbelow the target dicular to the imaged plane, the transducers have an shearrateisreachedbyourstress-imposedrheometerus- aperture D = 10 mm with a cylindrical shape of radius ingafeedbacklooponthebobrotationspeed. Notethat, 30 mm (see sketches in Fig. 1). This leads to a focus- althoughthecharacteristictimeofthefeedbackloopisof ing in the elevation direction at a distance F = 30 mm theorderof10ms,itmaytakeamuchlongertimebefore from the probe and over a focal spot whose length l f the target shear rate is actually reached by the rheome- and width w at -6 dB can be estimated respectively as f terduetothecouplingbetweenthegeometryinertiaand l ≃8λF2/D2 ≃7 mm and w ≃λF/D ≃300 µm. f f the fluid viscoelasticity. With the Couette geometry de- In the following the region of interest, namely the gap scribed above, we found this time to be of the order of of the Couette cell, will be centered in the focal spot 0.5 s in water [see Figs. 7(b) and 8(b)] and about 3 s in and will be thus consideredas a thin rectangular slice of viscoelastic wormlike micelles [see Figs. 9(b)]. height 32 mm, length e = 2 mm, and thickness 300 µm. Inordertodetectanon-zerodisplacementofthesheared ◦ material, the transducer array is set at an angle φ ≃5 0 B. Ultrasonic scanner and probe relative to the normal of the outer cup. After refrac- tion in the cup, the actual angle of incidence within the sample, noted φ, is close to but different from φ Our ultrasonic scanner is built upon a custom-made 0 as shown in Fig. 1(b). This parameter will be precisely multichannelelectronicsdesignedforphased-arrayappli- determined through the calibration procedure described cations by Lecoeur Electronique. It consists of 128 inde- in Sect. IIIA. pendent channels, each made of a transmitter and a re- ceiver. Thetransmittercanbeeithera“spike”transmit- terthatemitsshortpulsesoftunablevoltage(from10to C. Ultrasonic data processing 230V) andwidth (from 25ns to 3 µs, falltime less than 10ns)andwhosesequenceintimeisprogrammablewith amaximumpulserepetitionfrequency(f )of20kHz, 1. Plane wave imaging PRF or a fully programmable analog transmitter that gener- ates power-amplified arbitrary waveforms with a band- Standard ultrasonic imaging schemes use a series of width of 10 MHz and a maximum peak-to-peak ampli- emissions focused at different locations in the sample tude of 100 V. In the latter case a 4 Mb memory is used andfromwhicha singleimage is reconstructed. Doppler to store the waveform which is sampled at 80 MHz and imaging can then be performed to measure one compo- converted by a 12-bit linear digital-to-analog converter. nent of the flow velocity32. In more recent ultrasonic Analog transmitters allow for transmitting highacoustic velocimetryapproachessuccessiveimages are storedand power at central frequencies up to 10 MHz while pulsed cross-correlatedas in optical Particle Imaging Velocime- emissionisusedwheneveralargeremittingbandwidthis try(PIV)toinferthetwo-dimensionaldisplacementfield needed, e.g. for ultrasonic imaging at frequencies larger between two images. In general this “EchoPIV” tech- Ultrafast ultrasonic imaging coupled to rheometry 4 0 (a) (b) 5 10 ) m 15 m ( z 20 25 30 38 39 40 41 42 38 39 40 41 42 t (µs) t (µs) FIG.2. (a)Rawspecklesignalsi(t,z)recordedafterasingleplanewaveemissionasafunctionoftimetandtransducerposition z along the array. (b) Corrected speckle signal s˜i(t,z) after removal of the fixed echoes in si(t,z) (see text). The dashed lines at t=38.7 and 41.5 µs indicate the limits of the gap as inferred from the calibration procedure described in Sect. IIIA. The signalsarecodedusinglinearcolorlevels. ExperimentperformedinaNewtoniansuspensionofhollowglassspheresat1wt.% in water and sheared at γ˙ =10 s−1 (see also supplementary movie 1)31. nique is based on a standard scanner and yields a max- real-time thanks to graphical processing units36. The imum frame rate of about 200 Hz which is enough for pulse repetition frequency f , hence the frame rate, PRF biomedical imaging and diagnosis33 but too slow to fol- is only limited by the total time-of-flight from the ultra- lowtransientphenomenaorfastdynamicsinsoftmatter. sonic probe to the inner bob and back to the probe. In High-resolution imaging systems with working frequen- the present experimental setup the total travel distance cies as high as 30 MHz now allow for “micro EchoPIV”: is about 60 mm, which corresponds to a time-of-flight of Poiseuille flows in stenotic vessel-mimic phantoms of di- about 40 µs and to a maximum frame rate of 25 kHz. ameter0.6mmandbloodflowinsmallanimalshavebeen In our case, the aim is to follow the deformation and imagedwithaspatialresolutionof60µmandframerates flow of soft materials. The backscattered ultrasonic sig- up to 100 Hz34. nal either arises from the fluid microstructure itself or Ourimagingtechniquereliesontheuseof“planewave is obtained artificially by seeding the sample with mi- imaging” as introduced by Sandrin et al35 in order to crospheres that play the role of acoustic contrast agent. increase the temporal resolution of standard ultrasonic In both cases we call this signal an “ultrasonic speckle” imaging by a factor of 10 to 100. A single emission of a andthe correspondingvelocimetrytechnique “ultrasonic plane wave is generated by firing all the transducers si- specklevelocimetry”(USV).Notethataseedingconcen- multaneously. The signal sent to the transducers is con- trationofafewvolumepercentgenerallyprovidesagood stituted ofa singlepulse ofamplitude 100V.The echoes signal-to-noise ratio and does not constitute any signif- backscatteredby the sample are amplifiedwith a gainof icant limitation of USV when compared to EchoPIV37. 60dB,recorded,andstoredontheon-boardmemoriesof Still plane wave imaging leads to a strong loss of lateral the various electronic channels. The pulsed plane wave resolution, which is minimized in the following by a re- emissionisrepeatedN times witharepetitionfrequency ception beam-forming, so that speckle tracking in USV f , which constitutes one “sequence.” Identical se- is usually performed only on the axial component of the PRF quences can be repeated up to N = 512 times. The velocity. seq numberofpulsesN persequenceislimitedto8,192emis- sions and by the total memory of 32 Msamples available per channel. Once the full series of imaging sequences 2. From raw speckle data to ultrasonic images is completed, the ultrasonic data are downloaded to the PC for post-processing. a. Raw speckle signal. - The ultrasonic speckle Suchplanewaveimaginghasbeenusedtofollowshear backscattered from the sample to the transducer array waves into the human body and infer useful informa- results from the interference of all scattering events of tion on local elastic properties, a technique known as the incident plane wave by the scatterers across the in- “transient elastography,” which was recently taken to sonified slice (32 mm × 2 mm × 300 µm). If one can Ultrafast ultrasonic imaging coupled to rheometry 5 neglect echoes that are multiply scattered along their 0 propagation, there is a direct correspondence between (a) the time-of-flight of the ultrasound and the position of 5 the scatterer32. Note that, as in any imaging technique, multiple scattering constitutes a strong limitation of the 10 presentinstrument,especiallyinthecaseofconcentrated ) m suspensions, for which a specific analysis of the multiply m 15 scatteredsoundshouldbe undertaken38. Inthe opposite ( case of a sample that is transparent to ultrasound, seed- z 20 ing the material with acoustic contrast agents allows for a good control of the scattered signal. 25 In any case the signal recorded on a given reception channel is the sum of the echoes from scatterers at vari- 30 ous locations in the imaging plane. An example of such a raw ultrasonic “speckle” signal recorded in a dilute ) . aqueous suspension of polydisperse hollow glass spheres .u 0.1 (b) a (Potters Sphericel, mean diameter 6 µm, mean density ( 0 1.1 g.cm−3) is shown as a function of both space and ) m time in Fig. 2(a). Here, the time t corresponds to the −0.1 m time at which the pressure signal is sampled by the re- 28.5 29 29.5 30 30.5 9 ceiver, with the origin t=0 being the time at which the . 4 incident pulse is sent. In other words t is the ultrasonic 1 0.1 (c) time-of-flightfromandbacktothetransducerarray. The = 0 verticalcoordinatezdenotesthepositionalongthetrans- z ducer array, the origin being taken at the upper end of ,−0.1 y the array,whichis about6 mmfromthe topofthe Cou- ( i 30.25 30.3 30.35 30.4 30.45 S ette cell [see Fig. 1(a)]. This two-dimensional represen- tation of the radio-frequency (RF) backscattered signals y (mm) s(t,z), also referred to as a “B-scan” in the ultrasound literature, clearly shows the echoes of the incident plane wave on the outer cup and on the inner bob as vertical FIG. 3. (a) Beam-formed image Si(y,z) computed from the corrected speckle signal of Fig. 2(b) and shown as a function lines at t ≃ 38.7 and 41.5 µs respectively. In between ofy,thedistancetothetransducerarray,andz,theposition the bob and the cup, the RF signal is constituted of a superposition of spherical wavefronts that correspond to along the array. Si is normalized by its maximum value and coded in linear color levels. (b) Two successive beam-formed the backscattered echoes from the glass spheres within speckle signals Si(y,z) (in black) and Si+1(y,z) (in red) for the gap. a given position z = 14.9 mm along the transducer array. b. Procedure for removing fixed echoes. - A close Si andSi+1 correspondtotwodifferentplanewaveemissions investigation of a series of N successive RF signals separatedbyδt=2ms. (c)EnlargementofSi(y,z)(inblack) {si(t,z)}i=1...N corresponding to N successive incident andSi+1(y,z)(inred)overawindowofwidth∆y=2λclose to the inner bob [indicated as a dashed box in (b)]. This ev- plane waves reveals that the spherical wavefronts from idences a noticeable displacement of the speckle to the right the glass spheres, which move along with the scatterers as they are carried away by the shear flow, are mixed when going from Si to Si+1. The dashed lines at y = 28.7 and 30.7 mm indicate the limits of the gap as inferred from withotherwavefrontsthatremainfixedundershear(see the calibration procedure described in Sect. IIIA. Same ex- supplementary movie 1 with N = 200)31. These fixed periment as in Fig. 2 (see also supplementary movie 2)31. echoes are due to waves diffracted by the edges of the transducer array which get reflected on the various sur- faces surrounding the Couette cell (free surface, bottom tractingthespecklesignalhs (t,z)i averagedoverN suc- i i of the water tank, Couette cell, etc.). Most of these re- cessive signals to each individual signal s (t,z): i flectionsoccurbeforethemainplanewaveentersthegap of the Couette cell (t ≃ 38.7 µs) but the corresponding s˜(t,z)=s (t,z)−hs (t,z)i . (1) i i i i cylindrical echoes may extend over the whole temporal window of interest, as seen in Fig. 2(a) (see also sup- The result obtained from Fig. 2(a) with a series of N = plementary movie 1)31. Moreover the roughness of the 200 pulses separated by δt = 2 ms (i.e. a pulse repeti- outer cup as well as small defects in the inner bob may tion frequency f =500 Hz) is shown in Fig. 2(b). In PRF also generate fixed spurious echoes. this case, the Newtonian suspension is sheared at a con- As in biomedical imaging where fixed echoes due to stantshearrateγ˙ =10s−1. Shearisstartedlongenough artery walls may lead to large artifacts in blood speed before collecting the ultrasonic data so that the flow is detection32,39,wegetridofthesespuriousechoesbysub- laminar and stationary. Figure 2(b) shows that our pro- Ultrafast ultrasonic imaging coupled to rheometry 6 0 (a) (b) 5 δy (µm) 10 6 ) m 15 m ( 4 z 20 25 2 30 0 28.5 29 29.5 30 30.5 28.5 29 29.5 30 30.5 y (mm) y (mm) FIG.4. (a)Displacementmapδyi(y,z)computedfromtwosuccessivebeam-formedimagesSiandSi+1separatedbyδt=2ms. (b) Displacement map hδyi(y,z)ii averaged over 199 correlations between 200 successive images. Thedashed lines at y=28.7 and30.7mmindicatethelimitsofthegapasinferredfromthecalibrationproceduredescribedinSect.IIIA.Sameexperiment as in Fig. 2. cedure for removing fixed echoes is very efficient. It re- differfromthatofwater. Inanycasethe actualdistance mains so as long as all scatterersacrossthe gapmove by r in the sample to the inner bob will be inferred from y asignificantquantityoverthetotaldurationofthepulse throughacalibrationstepdescribedinSect.IIIA.More- sequence so that the (moving) backscattered wavefronts overthesummationinEq.(2)istakenover30valuesofz 0 cancel out in the average. In some cases where the fluid around z. This fastens the data processing without sig- may remain fixed in parts of the gap (e.g. in yield stress nificantly degrading the image resolution. It can also be fluids that show shear localization), the average is taken notedthatbackscatteredechoesarerecordedbeyondthe ona differentseriesofincidentpulses performedunder a positionoftheinnerbob(i.e. fort>41.5µsinFig.2and highshearrate,sothatthewholesampleflows. Sincethe for y > 30.7 mm in Fig. 3). These echoes correspond to USV algorithm has already been described as a tool for thescatteringofthe reflectionofthe incidentplanewave flow visualization in other contexts40,41, we briefly recall on the bob23. Therefore only points with y . 30.8 mm the main steps of image formation and processing in the are consideredin Eq. (3). The beam-formed image com- following and emphasize only the aspects specific to the putedfromFig.2(b)isshowninFig.3(a)andthelineat case of cylindrical Couette flow imaging. z =14.9mm oftwosuccessiveindividual imagesS (y,z) i c. Computation of beam-formed images. - In this and S (y,z) are shown in Fig. 3(b) and (c) (see also i+1 data processing step based on wave propagation in a supplementary movie 2 for a series of N = 200 succes- single scattering regime, an ultrasonic image S (y,z) is siveimagesseparatedby 2ms inashearedsuspensionof i formed from a corrected speckle signal s˜(t,z) by using hollow glass spheres)31. i standard parallel beam forming35: Si(y,z)= s˜i(t(y,z,z0),z), (2) 3. Displacement field Xz0 Thespeckledisplacementalongtheydirectionatpoint where y is the distance from the transducer array along (y,z) between two successive pulses i and i+1 is com- the ultrasonicpropagationaxis(or“axialdistance”)and puted by looking for the maximum of the following cor- y+ y2+(z−z )2 relation coefficient as a function of δy23,40: 0 t(y,z,z )= (3) 0 p c y+∆y/2 istheultrasonictime-of-flightfromascattererlocatedat C (y,z,δy)= S (y′,z)S (y′+δy,z), (4) i i i+1 (y,z) in the gap to the transducer located at height z0, y′=yX−∆y/2 c denoting the sound speed in water. Note that Eq. (3) neither accounts for the sound speed in the outer cup where ∆y = 2λ ≃ 200 µm. An example of correlation whichis madeoutofPMMA(c ≃2500m.s−1)nor window of width ∆y is shown in Fig. 3(b) and (c). For PMMA from the fact that the sound speed in the sample may agiven(y,z),the value ofδy thatmaximizesC (y,z,δy) i Ultrafast ultrasonic imaging coupled to rheometry 7 4 (a) 4 (b) 40 4 m/s) 3 m/s) 3 (%) m 2 m 2 v2 v(y,i v(y 30 δv/ 1 1 ) 0 s 0 1 2 / m r (mm) 0 0 28.5 29 29.5 30 30.5 28.5 29 29.5 30 30.5 m20 y (mm) y (mm) ( v FIG. 5. (a) Axial velocity profiles vy,i(y,z) computed from the two successive beam-formed images Si and Si+1 used in 10 Fig. 4(a) and shown for z = 7.4 ((cid:7)), 15.1 (•), and 22.4 mm ((cid:4)). (b)Axialvelocity profiles vy(y,z)=hvi(y,z)ii averaged over199correlationsbetween200successiveimages. Thegrey lineshowsthebestlinearfitofthefulldatasetaveragedover 0 z. The dashed lines at y = 28.7 and 30.7 mm indicate the 0 0.5 1 1.5 2 limits of the gap as inferred from the calibration procedure r (mm) described in Sect. IIIA. Same experiment as in Fig. 2. FIG. 6. Tangential velocity profiles v(r) deduced from the calibration procedure [Eq. (5) and (6)] with y = 28.66 mm 0 ◦ is computed from a second-order polynomial interpola- and φ = 5.2 for different applied shear rates: γ˙ = 5 (•), tion of C and yields the axial displacement δy of the 10 ((cid:3)), 15 (•), and 20 s−1 (H). Data are averaged over 199 i i successivecorrelationsandovertheverticaldirectionz. Error speckle between pulses i and i+1. In practice, to avoid bars show the standard deviation over z. Grey lines are the any redundancy in the velocity data, such a displace- theoreticalpredictionsforaNewtonianfluid[Eq.(10)]. Inset: ment δy (y,z) is computed only for locations within the i relative deviation δv/v computed as the standard deviation gapsuchthat y =y +k∆y/3,where y correspondsto k 0 0 of v(r,z) over z relative to its mean valuev(r). Experiments thebeginningofthegaponthecupsideandk isaninte- performed in a Newtonian suspension of hollow glass spheres ger. This yields about30 measurementpoints acrossthe at 1 wt. % in water. gap of the Couette cell separated by roughly 65 µm. A displacement map computed from two successive beam- formed images S and S is shown in Fig. 4(a). The III. CALIBRATION AND TEST IN A NEWTONIAN i i+1 velocitygradientisclearlyvisibleevenifthelevelofnoise FLUID isratherlargebecauseonlytwosuccessivepulsesarecon- sidered. A. Calibration procedure Figure 4(b) presents the displacement map obtained In order to recover the velocity field in sheared com- by averaging δy (y,z) over the N −1=199 correlations i plex fluids, it is necessary to calibrate the axial velocity correspondingtothesequenceof200pulsesshowninsup- plementary movies 1 and 231. This 0.4 s time-average data vy. Such a calibration procedure has already been described in detail in Ref.23 and allows one to infer the results in a very small level of noise with a typical vari- precisevalueoftheincidence angleφandthe exactposi- ation of less than 5 % from one channel to another (see tiony ofthecupwall. Inbrief,thecalibrationprocedure alsoinsetofFig.6). As expectedthe flow is laminarand 0 mustbe performedin aNewtonianfluid atalow enough homogeneous over the whole height of the Couette cell. shear rate to ensure that the flow is laminar and purely Axial velocity maps are easily deduced from the dis- tangential so that v = (0,v ,0) and v simply measures θ y placement field by v (y,z) = δy (y,z)/δt, where δt = the projection of the orthoradial velocity component v . y,i i θ 1/f isthetimeintervalbetweentwosuccessivepulses. Inourgeometryandforadiluteaqueoussuspension,this PRF By “axial velocity” v we mean the projection of the correspondstoγ˙ .40s−1. Linearfitsofthev vsy data y y local velocity vector v = (v ,v ,v ) on the ultrasonic averaged over N ≃ 200 pulses and over the vertical di- r θ z propagation axis y [see Fig. 1(b)]. This obviously as- rection z for different values of γ˙ yield the position y 0 sumesthatthescatterersfollowthe fluidvelocityfieldas of the cup wall with an uncertainty of about 20 µm [see passive tracers. Three individual axial velocity profiles the fit in Fig. 5(b) for γ˙ = 10 s−1]. Moreover the angle ◦ v (y,z)deducedfromFig.4(a)aregatheredinFig.5(a) of incidence φ is estimated within ±0.1 by looking for y,i for three different heights along the transducer array, the value of φ that best matches the expected velocity while Fig. 5(b) shows the corresponding time-averages profiles for various applied shear rates23. v (y,z)=hv (y,z)i . Oncey andφarecalibrated,theaxialvelocityv (y,z) y i i 0 y Ultrafast ultrasonic imaging coupled to rheometry 8 is easily converted to a an apparent tangential velocity t = 0. In the remainder of this paper t shall denote v(r,z),whererdenotesthedistancetotherotatinginner the time after start up of shear (rather than the ultra- bob, through the relationships: sonic time-of-flight as in Sect. II). Here one sequence of N =8,000pulsesisusedwithf =1kHz. Figure7(a) PRF r = R2+(y−y )2−2R (y−y )cosφ−R , (5) showsafewvelocitymapscorrespondingtoaveragesover 2 0 2 0 1 q 50 successive pulses every 25 ms (see also supplemen- R +r v(r,z)= 1 v (y,z). (6) tary movie 3)31. The shear rate and shear stress signals y R sinφ 2 recordedsimultaneouslybytherheometerarealsoshown In the small-gap approximation e/R ≪ 1, the previous inFig.7(b). Sincethe flowclearlyremainshomogeneous 1 equations reduce to: along the vertical direction during the whole transient, we average the velocity data along z and plot a few ve- r ≃e−(y−y )sinφ, (7) 0 locity profiles and time series hv(r,z,t)i in Fig. 7(c). z vy(y,z) Asexpected,thevelocityprofileisfullydevelopedonly v(r,z)≃ . (8) sinφ fort&τ, whereτ ≡e2/ν ≃1s is the viscousdissipation time on the size of the entire gap. At earlier times, a Onceagainitiscrucialtoemphasizethatv(r,z)deduced boundary layer develops at the rotating inner bob and from Eqs. (6) and (8) indeed corresponds to the ortho- propagates towards the fixed outer cup. Note that the radial component v of the velocity field v only when θ velocity time series v(r,z,t) in Fig. 7(c) resemble but the flow is purely tangential. In the general case of do not follow exactly the simple error function solution a three-dimensional flow with non-zero radial and ver- for a boundary layer on an infinite flat plate started im- tical components v and v , the USV measurement is r z pulsively42,43. The existence of the outer bob, the cur- v ≃ v sinφ+v cosφ in the small-gap approximation. y θ r vature and closure of the streamlines, and the complex Therefore the velocity v defined by Eqs. (6) and (8) is input function for the velocity of the bob all havea non- insensitive to the vertical component but may contain a negligible impact on the transient flow. The complexity significant contribution from the radial component: oftheinputfunctionγ˙(t)intheinsetofFig.7(b)isdueto v (r,z) the fact thatwe areusing anintrinsically stress-imposed r v(r,z)≃vθ(r,z)+ . (9) rheometer working in strain-imposed mode through a tanφ feedbackloop. Inparticularthefactthattheshearstress Figure 6 presents the result of the calibration proce- presents a strongundershootinto negativevalues canbe dure in a suspension of hollow glass spheres at 1 wt. % attributed to the coupling between the rheometer feed- in water. The ultrasonic data are acquired using a sin- back on the applied torque, the strong inertia of our gle sequence of N = 200 pulses with a pulse repetition home-made geometry, and the fluid response. Experi- frequency that is tuned depending on the applied shear ments performed with a smaller,lighter bob would show rate γ˙ according to fPRF = 50γ˙. Whatever the applied a faster convergence of the applied shear rate to its tar- shear rate, the velocity profiles almost perfectly coincide get value with much smaller oscillations. Working with with the theoretical predictions for a Newtonian fluid: a strain-imposed rheometer would allow a better access totheactualfluidresponsetoastep-likeshearratefunc- 2 R2 −1 tion. v(r)=v 1+ r (cid:16)R1+r(cid:17) ≃v 1− r , 0(cid:18) R1(cid:19) R2 2−1 0(cid:16) e(cid:17) (cid:16)R1(cid:17) (10) C. Taylor-Couette instability in a Newtonian fluid where v is the velocity of the inner bob imposed by the 0 rheometer. The last term in Eq. (10) results from the Wehaveseenintheprevioussectionthataslongasthe small-gap approximation for which v0 ≃ γ˙e. The only velocity field remains purely orthoradial, the measure- significant deviations from the predictions are observed ments at different axial positions do not bring any more close to the outer cup (r ≃ 2 mm) where the velocity information than one-dimensional velocimetry: the ve- is slightly overestimated. Such an artifact can be at- locity maps in Fig.7(a) are essentially invariantalong z. tributedtoourprocedureforremovingfixedechoeswhich The situation changes radically at higher imposed shear prevents us from measuring vanishingly small velocities rates when this invariance is broken, revealing the full close to the cup. potential of our new technique. For a Newtonian fluid sheared in between concentric cylinders Taylor showed that the purely orthoradial base flow becomes unstable B. Shear start-up in a Newtonian fluid and gives way to a cellular pattern in which the fluid travels in helical paths around the cylinders in layers In order to highlight the time-resolved capabilities of of counter rotating vortices–now known as Taylor vor- our rheo-ultrasonic technique, we turn to measurements tices44. Inthesimplestcasewhereonlytheinnercylinder performed during flow build-up in a Newtonian suspen- is rotating and the gap is small, the vortex flow devel- sion after shearing at γ˙ = 20 s−1 is started at time ops for Ta & 41, where Ta ≡ e/R Re is the Taylor 1 p Ultrafast ultrasonic imaging coupled to rheometry 9 (a) t=0s t=0.075s t=0.15s t=0.225s t=0.375s t=0.7s t=1.275s mm/s 0 5 30 10 ) m 15 20 m ( 20 z 10 25 30 0 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 r (mm) (b) (c) 40 0.2 21 40 3 m/s)30 m20 Pa)2 σ(Pa) 0 20˙γ(1/s) m/s)30 v(1000 0.5 1 ( m20 t(s) σ ( −0.2 19 1 00 00..55 11 v t(s) 10 0 0 0 0.5 1 0 0.5 1 1.5 2 t (s) r (mm) FIG.7. Start-upofshearinaNewtoniansuspensionofhollowglassspheresat1wt.%inwaterandshearedatγ˙ =20s−1inthe laminar regime. (a) Velocity mapsv(r,z,t)at differenttimest indicated on thetoprow. Each map correspondstoan average over 50 pulses sent every millisecond (see also supplementary movie 3)31. (b) Stress response σ(t) recorded simultaneously to thevelocitymaps. Thesymbolsindicatethetimescorrespondingtotheimagesshownin(a). Inset: magnificationofthestress responseσ(t)(inblack)togetherwiththeinstantaneousshearrateγ˙(t)(inred)imposedbytherheometer. (c)Velocityprofiles hv(r,z,t)iz averagedoverthewholeheightofthetransducerarrayandshownatt=0((cid:3)),0.075(⋄),0.15(△),0.225(▽),0.375 (◦), 0.7 (⊳), and 1.275 s (⊲) consistently with (a) and (b). The grey line shows the velocity profile expected for a Newtonian fluid in thelaminar regime [Eq. (10)]. Inset: time evolution of hv(r,z,t)iz at r=0.01, 0.46, 0.98, 1.43, and 1.95 mm from top to bottom. number (textbooks often use Ta2) and Re ≡ γ˙τ is the supplementary movie 531. This behavior corresponds to Reynolds number. In the geometry used in our exper- the“wavyvortexflow”regime,theoutcomeofthesecond iments, the threshold of the instability therefore corre- instability of the Taylor-Couette system when only the sponds to γ˙ ≃50 s−1, which we indeed observe. inner cylinder is rotating45. For shear rates closer to c Figure 8(a) shows consecutive velocity maps for a the threshold γ˙c, we also observed steady vortex flows start-up of shear at γ˙ = 80 s−1 (see also supplemen- (the so-called “Taylor vortex flow” regime, for γ˙c < γ˙ . tary movie 4)31. The first few instants are still invariant 66 s−1, as expected45). along z and resemble the transientflow described in sec- Figure8(a)showsthatthemainorthoradialflowisde- tion IIIB. However, for t & 1.5 s, the symmetry is pro- formed by the influence of the secondary vortex flow46. gressively lost with the emergence of well defined undu- Typically, at locations along z that correspond respec- lations along z. The onset of the vortex flow can also be tively to the outflow/inflowboundary of vortices(strong detected on the transient rheological data in Fig. 8(b). outward/inward radial flow), the main flow is pushed Indeed, the transition from the purely orthoradial flow outward/inward. Figure 8(c) gives examples of such de- to the vortex flow brings in an additional flow resistance formed individual velocity profiles at the locations of an characterized by an increase in the apparent viscosity outflow boundary (white symbols), an inflow boundary η(t)=σ(t)/γ˙(t) recorded by the rheometer, which is ev- (black symbols) and in between (gray symbols). Thus, ident on the inset of Fig. 8(b) for 1.5.t.2.5 s. for each wavelength of the undulations on the velocity Iftheflowisobservedonlongertimescales,thevortex maps, there is a pair of counter-rotating vortices. The flow is observedto be time periodic as canbe checkedin large field of view of our imaging technique allows us to Ultrafast ultrasonic imaging coupled to rheometry 10 (a) t=0s t=0.35s t=0.725s t=1.575s t=1.875s t=2.1s t=2.375s mm/s 0 120 10 ) 90 m m ( 60 20 z 30 30 0 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 0 1 2 r (mm) (b) 150 (c) 1.5 x 10−3 75 3.5 ) (Pa) 1 η(Pa.s)2.35 50(1/s) mm/s100 σ ˙γ ( 0.5 2 25 v 50 0 1 2 t(s) 0 0 0 00 00..55 11 11..55 22 22..55 0 1 2 t (s) r (mm) FIG. 8. Start-up of shear in a Newtonian suspension of hollow glass spheres at 1 wt. % in water and sheared at γ˙ = 80 s−1 in a vortex flow regime. (a) Velocity maps v(r,z,t) at different times t indicated on the top row. Each map corresponds to an average over 50 pulses sent every 0.5 ms (see also supplementary movie 4)31. (b) Stress response σ(t) (in black) recorded simultaneously to the velocity maps together with the instantaneous shear rate γ˙(t) (in red) imposed by the rheometer. The symbols indicate the times corresponding to the images shown in (a). Inset: apparent viscosity η(t)=σ(t)/γ˙(t). (c) Velocity profiles v(r,z,t) at t = 2.375 s and for z = 19.25 (white symbols, outflow boundary), 20.5 (gray symbols, in between outflow andinflow),and21.5mm(blacksymbols,inflowboundary). ThegraylineshowsthevelocityprofileexpectedforaNewtonian fluid in thelaminar regime [Eq. (10)]. visualize more than 7 wavelengths, yielding a value of ultrafast ultrasonic imaging technique provides a way to 4.1±0.1 mm, in agreement with the theoretical predic- monitor the flow over a large range of vertical positions tion λ ≃2e=4 mm computed by Taylor44. simultaneously and with a temporal resolution that is c To the best of our knowledge a characterizationof the fast enough to capture unsteady flows. Taylor-Couetteinstabilitysolelybasedonatimeresolved velocitymapoftheorthoradialvelocityprofilesv (r,z,t) θ at one single location along θ does not exist in the lit- erature. Wereley and Lueptow rather used PIV to mea- Note that according to Eq. (9) the data displayed in sure v and v in a slice of the gap at a given angle θ47. Fig. 8(a) and (c) are not exactly equal to the orthora- r z Then fromthe orthoradialcomponentof the momentum dial velocity component. The vertical oscillations on the balancetheycouldreconstructorthoradialvelocitymaps velocity maps are enhanced by the contribution of the similartothosemeasuredhere. Later,AkonurandLuep- radialvelocitytothemeasurement. Moreover,theveloc- tow used PIV on various slices to reconstruct a three ities measured near the inner and outer cylinders devi- dimensional velocity map48. Nonetheless, the measure- ate from the expected values more significantly than in ments at various locations along z were obtained inde- thepurelyorthoradialflowregimeusedforcalibrationin pendently at different times and required phase align- Fig. 6. Once again, this could be an artefact due to the ment48. A similar procedure was used by Raguin and procedureusedtoremovefixedechoes,oritcouldalsobe Georgiadis on magnetic resonance velocimetry data of a aconsequenceofthesecondaryflow. Indeed,thevortices Taylor-Couette-Poiseuille flow (i.e. with superimposed createlocalizedjetsnearthewallsthatcansegregatethe axialflow)49. Incontrasttotheseearlierresults,ournew tracers48.