loading

Logout succeed

Logout succeed. See you again!

ebook img

Using a coherent hydrophone array for observing sperm whale range, classification, and shallow ... PDF

pages13 Pages
release year2014
file size2.9 MB
languageEnglish

Preview Using a coherent hydrophone array for observing sperm whale range, classification, and shallow ...

Using a coherent hydrophone array for observing sperm whale range, classification, and shallow-water dive profiles The MIT Faculty has made this article openly available. Please share how this access benefits you. Your story matters. Citation Tran, Duong D., Wei Huang, Alexander C. Bohn, Delin Wang, Zheng Gong, Nicholas C. Makris, and Purnima Ratilal. “Using a Coherent Hydrophone Array for Observing Sperm Whale Range, Classification, and Shallow-Water Dive Profiles.” The Journal of the Acoustical Society of America 135, no. 6 (June 2014): 3352–3363. © 2014 Acoustical Society of America As Published http://dx.doi.org/10.1121/1.4874601 Publisher Acoustical Society of America (ASA) Version Final published version Accessed Tue Apr 09 20:31:37 EDT 2019 Citable Link http://hdl.handle.net/1721.1/97630 Terms of Use Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. Detailed Terms Using a coherent hydrophone array for observing sperm whale range, classification, and shallow-water dive profiles DuongD.Tran,WeiHuang,AlexanderC.Bohn,andDelinWang DepartmentofElectricalandComputerEngineering,NortheasternUniversity,360HuntingtonAvenue, Boston,Massachusetts02115 ZhengGongandNicholasC.Makris DepartmentofMechanicalEngineering,MassachusettsInstituteofTechnology,77MassachusettsAvenue, Cambridge,Massachusetts02139 PurnimaRatilala) DepartmentofElectricalandComputerEngineering,NortheasternUniversity,360HuntingtonAvenue, Boston,Massachusetts02115 (Received17September2013;revised20February2014;accepted11April2014) Sperm whales in the New England continental shelf and slope were passively localized, in both range and bearing, and classified using a single low-frequency (<2500 Hz), densely sampled, towedhorizontalcoherenthydrophonearraysystem.Whalebearingswereestimatedusingtime-do- main beamforming that provided highcoherent array gain in sperm whale click signal-to-noise ra- tio. Whale ranges from the receiver array center were estimated using the moving array triangulation technique from a sequence of whale bearing measurements. Multiple concurrently vocalizing sperm whales, in the far-field of the horizontal receiver array, were distinguished and classifiedbased on their horizontal spatial locations and the inter-pulse intervals of their vocalized clicksignals.ThediveprofilewasestimatedforaspermwhaleintheshallowwatersoftheGulfof Maine with 160m water-column depth located close to the array’s near-field where depth estima- tion was feasible by employing time difference of arrival of the direct and multiply reflected click signals received on the horizontal array. By accounting for transmission loss modeled using an ocean waveguide-acoustic propagation model, the sperm whale detection range was found to exceed60kminlowtomoderateseastateconditionsaftercoherentarrayprocessing. VC 2014AcousticalSocietyofAmerica.[http://dx.doi.org/10.1121/1.4874601] PACSnumber(s):43.30.Pc,43.30.Sf[AMT] Pages:3352–3363 I. INTRODUCTION 2004;Telonietal.,2007).Hereweshowthatitispossibleto distinguish and classify multiple vocalizing sperm whale Sperm whales (Physeter macrocephalus) in the individuals located in the far-field of a single, densely Northwest Atlantic during spring and summer are concen- sampled,towedhorizontalcoherenthydrophonearraysystem trated along continental slope regions from the Mid-Atlantic using the instantaneous sperm whale position estimates in BighttosouthofGeorgesBank(Whiteheadetal.,1992)and both range and bearing, and the IPIs of the vocalized click the Scotian shelf edge. While foraging, sperm whales per- signals. Most studies of the vocalization behavior and dive formdeepdiveslastingfromseveralminutestomorethanan profileofspermwhaleshavebeenconfinedtodeepcontinen- hour (Watwood et al., 2006), emitting short-duration broad- tal slope environments bounding the Pacific and Atlantic band clicks with frequencies ranging from several hundred ocean (Jacquet et al., 2001; Madsen et al., 2002b; Mathias hertz to more than 30kHz (Madsen et al., 2002b; Weilgart et al., 2012; Watwood et al., 2006). Here we provide esti- and Whitehead, 1988). Each click exhibits a multi-pulse mates of the three-dimensional (3D) dive profile of a sperm structure (Møhl, 2001; Norris and Harvey, 1972; Zimmer whaleindividualthevocalizationsofwhichwereopportunis- et al., 2004) arising from reflections of the acoustic signal ticallyrecordedintheshallowwaterenvironmentoftheGulf generatedbythephoniclipsoffthefrontalanddistalairsacs of Maine with roughly 160m water-column depth during a bounding the spermaceti organ of a sperm whale. The inter- sea test of a newly developed, densely sampled, towed hori- pulse interval (IPI) provides a measure of the length of the zontalcoherentreceiverarraysysteminMay2013. spermaceti organ that has been shown to be strongly corre- Localization of an acoustic source, such as a vocalizing lated with the size of a sperm whale individual (Antunes sperm whale, in the far-field of a single, densely sampled, et al., 2010; Gordon, 1990; Growcott et al., 2011; Mathias towed horizontal coherent hydrophone array system is often et al., 2009; Miller et al., 2013; Rhinelander and Dawson, atwo-stageprocess.First,thebearingorhorizontaldirection of arrival of the acoustic signal is determined by time-delay a)Author to whom correspondence should be addressed. Electronic mail: analysisor beamforming of thesignalsreceived onthe indi- [email protected] vidual hydrophone elements of the array. Second, the range 3352 J.Acoust.Soc.Am.135(6),June2014 0001-4966/2014/135(6)/3352/12/$30.00 VC 2014AcousticalSocietyofAmerica Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 or horizontal distance of the acoustic source from the re- the environment, suchasbathymetry orsound speed profile, ceiver array center is determined by tracking changes in the is needed to estimate source range in the far-field of the bearing of a series of acoustic emissions over time (Gong array. et al., 2013; Nardone et al., 1984; Oshman, 1999; Ristic Other approaches for localizing sperm whales include etal.,2004;Yardimetal.,2011).Short-aperture,towedhor- (a)hyperbolicrangingwithasmallnetworkofsinglehydro- izontal coherent hydrophone array systems have been previ- phones (Baggenstoss, 2011; Tiemann and Porter, 2003; ously used to record vocalizations from sperm whales. Watkins and Schevill, 1972) and (b) time-delay measure- However, the coherent receiver array data have only been ment of click reflections from ocean boundaries acquired applied to determine the bearing of a sperm whale. No sub- with a single hydrophone or a sparse array of hydrophones sequentrangeestimateshavebeenmadebasedsolelyonthe (Mathiasetal.,2013;Mathiasetal.,2012;NosalandFrazer, coherentreceiver arraymeasurements.Consequently,coher- 2006; Skarsoulis and Kalogerakis, 2006; Thode, 2004; entarraygainofdenselysampledhydrophonearraysystems Tiemannetal.,2006;Wahlberg,2002).Hereweutilizetime has not been previously exploited for range localization of difference ofarrivalsofthespermwhaledirectandmultiple sperm whales. In Teloni (2005), a 128-element horizontal bottom and surface reflected click [multiple-reflection based coherent hydrophone array system of the NATO Undersea time difference of arrival (MR-TDA)] signals after beam- Research Center (NURC) with an array aperture length of formingtoestimatethedepthandhencethediveprofileofa 11.6mwasemployedtodeterminespermwhalevocalization sperm whale in shallow waters of the Gulf of Maine with bearings and to separate whale clicks from different azi- 160m water-column depth. This sperm whale individual’s muthal directions, but no range estimates or range analysis horizontalranger¼1kmwasveryclosetothearray’snear- were provided. In Zimmer et al. (2004), click data from a field distance r (r (cid:2)L2=k(cid:3)750m, where L is the array N N singlespermwhale acquiredusingthesameNURC receiver aperture length and k is the wavelength) making it possible arraywereusedtodeterminethebearingsofthewhaleindi- to estimate its depth. Depth estimation for acoustic sources vidual.Thespermwhalewasprimarilytrackedusingadigi- at long ranges, in the far-field ðr (cid:4)L2=kÞ of a single, hori- tal tag (DTAG) attached to its body consisting of a zontalcoherentreceiverarraysystemischallengingbecause hydrophone used to record sounds directly from the whale the acoustic wavefield received by the array is multi-modal (Zimmeretal.,2004).Thespermwhalerangetothereceiver in nature having undergone many surface and bottom boun- array center was determined from click travel time differ- ces in a random ocean waveguide making the received field ence between the DTAG hydrophone and the towed array less sensitive to the source’s depth location, except in the hydrophones(Zimmeretal.,2004). endfiredirectionofthehorizontalarray. Here we localize multiple sperm whales in the far-field of a single low-frequency (<2.5 kHz), densely sampled, II. METHOD:EXPERIMENTALDATACOLLECTION towedhorizontalcoherenthydrophonearraysystem,provid- ANDANALYSIS ing estimates of both range and bearing for each sperm whale. Because no other acoustic sensors were available to A newly developed, densely sampled, towed horizontal usapartfromthetowedhorizontalreceiverarraysystem,the linear hydrophone array system funded by the National whale ranges were estimated from their bearing-time trajec- Science Foundation and the Office of Naval Research was tories. A review of methods that can be applied to passively deployed and tested in the continental slope region south of estimate the range of an acoustic source from a single, Cape Cod between 500 and 2000m water depth on May 13 denselysampled,towedhorizontalcoherentreceiverarrayis (site B in Fig. 1) and in the Gulf of Maine in 150–180m providedinSec.IofGongetal.(2013).Hereweemploythe water depth on May 14 and 15 (site A in Fig. 1). Passive moving array triangulation technique developed in Gong acoustic data were collected on a sub-aperture of the array etal.(2013)toestimate spermwhale rangesfromthemeas- with N¼32 elements having an inter-element spacing of ured click bearings. This technique combines bearing meas- 0.75m. The hydrophone elements, each having (cid:5)188dB re urements from spatially separated apertures of the towed lPa/V sensitivity were sampled at 5kHz with 24-bit digital horizontal coherent receiver array and employs the conven- resolution. The array was towed by the research vessel tionaltriangulationrangingalgorithmforlocalizingasource Endeavor at various speeds between 1 and 4kn. The water- that may be in the near- or far-field of the array. Because column sound speed at the experiment sites were monitored data from only a single towed horizontal coherent receiver using a conductivity-temperature-depth (CTD) sensor and array are used here to remotely and passively localize both expendable bathythermographs(XBT). The measured sound the range andbearing of sperm whales andto classify them, speed profiles are shown in Fig. 2 for the two test sites. The the methods and results developed here are highly relevant array depth was maintained between 60 and 80m near the andcanbedirectlyappliedtoaddressthefeasibilityofmoni- thermocline in the Gulf of Maine, and varied between 10 toringspermwhaleswithothertowedhorizontalcoherentre- and50matthecontinentalsloperegion. ceiver array systems, such as those employed in naval and Toinvestigatethepresenceofspermwhaleclicks,time- geophysical applications, where it may be important and frequency spectrograms of the received signal on each necessary to remotely sense marine mammal activity from hydrophone were first calculated, and the spectrogram inco- long ranges. An advantage of bearings-only range localiza- herentlyaveragedacrossseveralhydrophoneswereobtained. tion with a densely sampled, towed horizontal coherent re- Sperm whale clicks were consistently present in all 75min ceiver array system is that no additional information about of passive acoustic recordings on May 13 at the continental J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification 3353 Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 coverageofthebandwidthofthespermwhaleclickthatcan extend to 30kHz (Madsen et al., 2002a; Mathias et al., 2012; Teloni, 2005; Thode, 2004; Watwood et al., 2006; Zimmeretal.,2004). A. Spermwhalelocalizationinhorizontalrange andazimuthalbearing 1. Determiningclickarrivaltimeandazimuthal bearing The relative horizontal azimuthal direction or relative bearing b^0 of each sperm whale click, measured from array broadside,wasnextestimatedusingtime-domaindelay-and- sum beamforming (Johnson and Dudgeon, 1993). The pressure-time series data from each hydrophone of the array were first high-pass filtered with 300Hz cut-off frequency. Each two-dimensional (2D) matrix of high-pass filtered FIG. 1.Locations of the two test sites where the densely sampled, towed pressure-time series data from the 32 elements of the array horizontal coherent receiver array was deployed to collect ambient noise within roughly 13s duration was next converted to 2D datainMay2013.SiteAisintheGulfofMaineshallowwaterenvironment, beam-timedatabysteeringthearrayin400azimuthaldirec- andsiteBisinthedeepercontinentalslopeenvironment. tions equally spaced from (cid:5)1 to 1 in sin b0, where b0 is the azimuthalanglemeasuredfromarraybroadside.Anangleof slope region and 1h of passive acoustic recordings in the sinb0¼(cid:5)1correspondstothebackendfiredirectionandsin Gulf of Maine shallow waters. No active acoustic sound b0¼1correspondstotheforwardendfiredirection.Therela- sourceswereusedinthetowedreceiverarrayseatest. tive azimuthal direction and time of arrival of each sperm The maximum frequency of the acoustic data recorded whaleclickweredeterminedfromthelocalpeakenergylev- bythereceiverarraysystemhereis2.5kHz.Ouranalysisof els of the 2D beam-time data. In general, the sperm whale spermwhale clicksisthereforelimited tothelow-frequency clicks after high-pass filtering and beamforming stood component of the click signals in the several hundred hertz between 10 and 35dB above the background. A detection to a couple of kilohertz range that is more omnidirectional threshold of 10dB above the background was applied in the (Mathias et al., 2013; Tiemann et al., 2006; Zimmer et al., localpeakdetectiontoreducethefalsealarmrate. 2004)andsufferlesstransmissionloss.Incontrast,thesam- Spectrogram and time-series examples of the beam- pling frequencies of acoustic systems in previous sperm formed received click trains are shown in Figs. 3 and 4. whale studies were significantly higher, by at least a factor Because each sperm whale click contains multiple sharp of three (Mathias et al., 2013; Tiemann et al., 2006) to over pulseshighlylocalizedintimewithawidthoflessthan1ms ten times that used in this study to provide a more complete per pulse (see Fig. 5), the click signal resembles the output of a matched filter. This enables high resolution beamform- ing in the time domain because coherent addition of the pulses across all hydrophones decorrelates within a small timelagofroughly1/8ms,correspondingtobearingestima- tionaccuracies of approximately 1.7(cid:6) atarraybroadsideand 8(cid:6)neararrayendfire.Incontrast,thearrayangularresolution is much broader, roughly k=ðLcosb0Þ¼3.7(cid:6) at broadside pffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi and 2 0:886k=L¼22.7(cid:6) at endfire from planewave beam- forming of a time-harmonic signal, where k, L, and b0 are, respectively, the wavelength, array aperture and azimuthal directionfromarraybroadside(JohnsonandDudgeon,1993; Makrisetal.,1995)forthegivenarrayapertureL¼23.25m at a frequency of 2 kHz. Examples of the beam pattern obtainedfrombeamformingtwodistinctspermwhaleclicks, one located near array broadside and the other near array endfireareshowninFig.6.Thedirectionofarrivalisclearly distinguishable since the main lobe stands more than 8dB abovethegratinglobeinbothcases,mitigatinganypotential effectofspatialaliasing. Theestimatedrelativebearingsb^0 measuredwithrespect to array broadside were then converted to absolute bearings b^, measured from the array center with respect to true North FIG.2.MeasuredsoundspeedprofilesatthetwotestsitesshowninFig.1. by correcting for the corresponding array heading 3354 J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 FIG.3.(Coloronline)(A)Spectrogram ofaseriesofspermwhaleecholocation clicks recorded at frequencies up to 2.5 kHz inthe Gulfof Maine on May 14 starting at 17:19:07 EDT. The spectrogram was calculated using a short-time Fourier transform with win- dow size 256 and 75% overlap. (B) Beamformedpressuretimeseriesofthe clicks, bandpass filtered between 1500 and2500Hz.(C)Beamformedpressure timeseriesplottedindecibel(dB)scale. The solid curve with error bars shows the mean and standard deviation of beamformedbackgroundambientnoise level in the 1500–2500Hz band, esti- matedfromregionsoutsideofclicks. measurement a. To resolve the left-right ambiguity inherent of Gong et al. (2013). When the array is steered in the azi- in linear receiver array measurement of a source bearing, the muthofspermwhaleclicks,thearraygain(Kay,1998;Urick, left and right absolute bearing sequences were statistically 1983) obtained from coherent addition of the click signals correlated to the measured array headings. The true bearing measuredacrossallN¼32hydrophonescanenhancethesig- sequencewasselectedtobetheonewiththesmallercorrela- nal-to-noise ratio by approximately 10 log N (cid:3) 15dB over 10 tion coefficient because the ambiguous bearing sequence that of a single hydrophone [compare beamformed click sig- closely followsthe array heading changes asshown inFig.2 nals in Fig. 4(C) with single hydrophone measured click FIG.4.(Coloronline)(A)Spectrogram of three consecutive slow clicks fol- lowedbyatrainofecholocationclicks recordedatfrequenciesupto2.5kHzin theGulfofMaineonMay14startingat 17:16:15 EDT. (B) Beamformed pres- suretimeseriesoftheclicks,bandpass filtered between 500 and 2500Hz. (C) Beamformed pressure time series plottedindBscale.Thesolidcurvewith errorbarsshowsthemeanandstandard deviation of beamformed background ambientnoiselevelinthe500–2500Hz band,estimatedfromregionsoutsideof clicks. (D) Corresponding signal receivedonasinglehydrophone,band- passed filtered between 500 and 2500Hz. J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification 3355 Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 movement between pairs of whale bearing measurements in the MAT technique has to satisfy the near field condition, A2=k(cid:7)r , where r is the whale range from the receiver s w w centerandkisthewavelengthoftheclicksignal.Tolocalize and track sperm whales at ranges less than 5km from the array, with k set to be 0.75m, the synthetic aperture length shouldbeatleast60m.Thearraycanbetowedoverthisdis- tance in half a minute, so that near real-time tracking of sperm whales is feasible with this method. To track sperm whalesatlongerrangeswiththeMATtechnique,longerob- servationtimeswouldbenecessary. The sperm whale inter-click interval is approximately FIG.5.(Coloronline)Multiplereflectionarrivalpatternofthespermwhale clicks detected on May 14 in the Gulf of Maine. The order of arrival is: 1sorlessinaclicktrainandthereceiverarrayheadingwas Direct path; pairs of bottom and surface reflected, bottom-surface-bottom updated at roughly 12s intervals. The MAT technique was and surface-bottom-surface reflected, etc. Between 17:26:00 and 17:32:30 applied to pairs of click bearing measurements that were at EDT,reflectionsfromuptoseveninterfacebouncesaredetected. least 12s apart to estimate each whale range. The whale signalsinFig.4(D)].Thissignificantlyimprovesspermwhale range estimates obtained here are expected to have smaller click detectability and ranging capability. Note that an inco- fractional errors than the MAT localization fractional errors herentarrayofhydrophonesalsohasnoarraygainovernoise, reportedinGongetal.(2013).Thisisbecause,bythelawof regardless of the number of hydrophones, because coherence large numbers (Bertsekas and Tsitsiklis, 2002; Goodman, between sensors is necessary to accumulate array gain. 1985),thereareroughlysixtimesmorenumerousrangeesti- Subsequentanalysesonthetemporalandspectralcharacteris- mates derived from bearing measurements embedded in tics of the clicks were performed on the noise-suppressed noise which can be regarded as statistically uncorrelated beamformedclicks. acrosstime forthe spermwhaleproblemcompared to Gong etal.(2013)whereonlyonerangeestimate wasavailable at 2. Rangeestimationforspermwhalesinthenear-or every 75s interval for the source localization problem dis- far-fieldofthetowedhorizontalcoherentreceiver cussedthere. array 3. Simultaneousdepthandrangeestimationfora Each sperm whale individual was localized and tracked spermwhaleinshallowwater from its corresponding sequence of click bearing measure- mentsusingthemovingarraytriangulation(MAT)technique The range and depth of a sperm whale located approxi- (Gong, 2012; Gong et al., 2013), which combines bearing mately 1km from the receiver array in the Gulf of Maine measurements from spatially separated apertures of a towed were simultaneously estimated using MR-TDA of beam- horizontalreceiverarrayandemploystheconventionaltrian- formed direct and singly or multiply reflected click signals gulation ranging algorithm to localize a source in either the from sea bottom and surface. The concept for whale range near- or far-field of the array. The whale range from the re- and depth inference is similar to that presented in Thode ceiverarraycenterwascalculatedusingEqs.(1)through(3) et al. (2002). However, because the array depth was accu- ofGongetal.(2013)givenapairofwhalebearingmeasure- ratelyknownfromdepthsensormeasurementsampledevery ments. The synthetic aperture length A created by the array 10ms,therewasonefewerunknown.Asaresult,onlythree s arrivals: Direct path, bottom bounce, and surface bounce were required to solve for whale range and depth as derived and discussed in the appendix. When more than three arriv- als were present, the localization result could be obtained withhigheraccuracybyemployingallavailableinformation (see the appendix). The whale range estimates obtained using MR-TDA will be compared to those obtained with bearings-onlyMATmethodinSec.IV. B. InferringspermwhalesizefromIPIs The first 10-15ms of a sperm whale click usually con- sistsofmultiplepulsesafewmillisecondsapart(Backusand Schevill, 1966; Møhl, 2001; Møhl et al., 2003; Norris and Harvey, 1972), resulting from multiple reflection within the FIG.6.Arraybeamformeroutputasafunctionofsteeringanglefromarray whale head according to the bent-horn hypothesis (Norris broadside0(cid:6)shownfortwodistincttimeinstances.Spermwhaleclickswith and Harvey, 1972; Zimmer et al., 2003, 2004). The IPI has relativebearing3.7(cid:6)neararraybroadsideand73.7(cid:6)neararrayendfire.The beenshowntocorrelatewiththespermacetilength(Gordon, corresponding1-dBbeamwidthsareapproximately1.7(cid:6)nearbroadsideand 1990; Rhinelander and Dawson, 2004) and with the overall 8.0(cid:6) near endfire. Rectangular window was applied across the array aperture. body size (Antunes et al., 2010; Growcott et al., 2011; 3356 J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 Mathiasetal.,2009;Milleretal.,2013;Telonietal.,2007). following the approach of Andrews et al. (2009) and Gong An automated moving local peak energy detector with a etal.(2010). 1msaveraging-timewindowwasappliedtothebeamformed pressure-time series data to determine the arrival time of III. RESULTSI:ASPERMWHALEINSHALLOW each pulse within a spermwhaleclick signal to estimate the WATERSOFTHEGULFOFMAINE IPI. The result for each click was plotted and visually inspected for accuracy. This analysis was applied to high- A. Analysisofvocalizations pass filtered beamformed pressure-time series data to sup- VocalizationsfromaspermwhaleindividualatsiteAin press ambient noise and improve estimates of the IPI. Many theshallow-watersoftheGulfofMainewererecordedusing click signals from each whale were examined, and only the towed receiver array for over an hour from 16:35:00 to thosewithaclearmulti-pulsestructure wereincludedinour 17:40:00 EDT on May 14. An example of the beamformed analysis. IPI estimates were averaged over multiple clicks time series andspectrogram of anecholocationclick train is (roughly20–60perwhale)toreducetheerrorintheIPIesti- shown in Fig. 3. These measurements were made in water- mates.AscanbenotedfromTableII,thestandarddeviation column depths of roughly 160m where the receiver array in the IPI estimates for each sperm whale is comparatively was located at roughly 65m depth. The average inter-click small, less than 10%. The whale body length, L , was then w interval was approximately 0.7s; this implied that these estimated here using the methods proposed by Gordon clickscouldbecategorizedas“usualclicks”(Whiteheadand (1990)andGrowcottetal.(2011) Weilgart, 1990). Spectrogram analysis indicates that the clicks contain significant energy at low frequencies in the L ¼4:833þ1453(cid:8)IPI(cid:5)0:001(cid:8)IPI2; (1) w;Gordon 1.5–2.5kHz range. This enabled the beamformed, high-pass L ¼1:257(cid:8)IPIþ5:736: (2) filtered, time-series data of the clicks to stand between 15 w;Growcott and 30dB above the mean background ambient noise level The sampling frequency of the towed array hydrophones [Fig.3(C)].Clickrateswerefoundtovarywithinanecholo- limited our analysis of sperm whale click signal to cation click train, as shown in Fig. 3, where the inter-click frequencies(cid:2)2.5 kHz. In this low-frequency regime, the intervals and click amplitudes decrease slowly over a time sperm whale multipulsed-click signals are approximately interval of about 20s. This implied that the sperm whale omnidirectional. vocalizations could be transitioning from clicks to creaks, which area sequence of lowenergy clicks closelyspaced in time emitted when homing in on a prey (Madsen et al., C. Estimatingspermwhalemaximumdetectionrange 2002b;Milleretal.,2004). withthelow-frequencytowedcoherentreceiverarray system Besides these usual echolocation clicks, we also recorded intense broadband clicks with dominant energy The maximum detection range of a sperm whale with contained in the 0.5-2kHz frequency range. These loud our towed array system was determined as the range at clicks were separated by intervals of 5s or longer (see Fig. which the transmission loss correction led to a received 4)andcanbecategorizedasslowclicks(BarlowandTaylor, spermwhaleclicksignallevelthatstoodtwostandarddevia- 2005; Jacquet et al., 2001; Oliveira et al., 2013; Weilgart tions above the mean beamformed background noise level and Whitehead, 1993). The spectra of both the echolocation band-pass filtered between 300Hz and 2.5kHz. The two andslowclicksrecordedherecloselymatchthoseofDTAG- standard deviation signal excess enabled positive detection recordedspermwhaleclickvocalizationsshowninFig.1of ofspermwhaleswithover95%confidence. Oliveiraetal.(2013). The broadband transmission loss from the sperm whale Theoccurrencesoftherecordedvocalizationsareshown locationtothereceiverarraywascalculatedat10Hzinterval againsttimeinFig.7withclicktypesindicated.Eachecholo- in the bandwidth of the received clicks using the parabolic cationclicktrainlastedroughly2minwithperiodsofsilence equation-based range-dependent ocean waveguide-acoustic varying between 20s and several minutes. Longer periods of propagation model RAM (Collins, 1994). To simulate the silence lasting between 5 and 10min observed here may be effectofinternalwavesthatrandomizedtheacousticpropaga- associatedwiththespermwhale’sascentinthewater-column tion path, water-column sound speed profiles obtained from (Zimmeretal.,2004)andrestingnearthesurface. CTD and XBT measurements during the experiment were By analyzing each received click in the time interval randomly updated every 500m range, the approximate hori- from 17:18:00 to 17:33:00 EDT, we estimated the mean IPI zontalcorrelationlengthforlinearinternalwaves.Thebottom for this sperm whale individual to be 3.0ms with a standard wasassumedtobesandywithsoundspeed1800m/s,density deviation of 0.3ms. This corresponds to a sperm whale 1800kg/m3 and attenuation 0.8dB/k. The water-column lengthofapproximately9.3m,accordingtoEq.(2). attenuation was set to 6(cid:8)10(cid:5)5dB/k. These waveguide pa- rameters were previously found to provide the best-fit match B. Trackingrangeanddepthofaspermwhaleclose betweenmeasuredandmodeledtransmissionlossintheGulf toarraynear-field of Maine (Andrews et al., 2009; Gong et al., 2010). The broadbandtransmissionlossisobtainedbyincoherentlyaver- Theestimatedbearingsofthevocalizationsobtainedvia agingthereceivedintensityfrom50Monte-Carlorealizations time-domain beamforming are plotted in Fig. 7. The instan- overthebandwidthofaspermwhaleclickfrom1to2.5kHz, taneous sperm whale ranges were estimated from the J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification 3357 Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 EDT to 17:33:00 EDT. All estimated delay times were used for each recorded click, giving a maximum of 7C ¼21 2 range-depth estimates when seven reflections were detected, and a minimum of 4C ¼6 range-depth estimates when four 2 reflections were detected when employing the MR-TDA method. When ranges were available from the MAT tech- nique, between four and seven depth-estimates could be obtainedforeachclick,dependingonthenumberofavailable reflections. The results are plotted in Fig. 8 comparing the MATbasedresultswiththeMR-TDAbasedresults. Theanalysisindicatesthatasthereceiverarraywasbeing towedintheNorthbounddirection,thespermwhaleinitially locatedroughly0.5kmawayfromthearrayat17:08:00EDT FIG. 7.Measured bearings of sperm whale echolocation and slow clicks moved away to a range of about 1.5km in roughly 25min. detectedintheGulfofMaineonMay14overa1-hperiodfrom16:35to Thewhaleappearedtohoverwithinthewatercolumnwithout 17:35EDT. surfacingtobreathewithestimateddepthvaryingbetween70 and 100m over this time period. The increasing whale- measuredwhalebearingsusingthebearings-onlyMATtech- receiverseparationestimatedusingtheMR-TDAexplainsthe nique for the time interval from 17:08:00 to 17:33:00 EDT more compact arrival structure in Fig. 5 because when range andplottedinFig.8(A). increases, the reflection arrivals get closer to the direct path, In the shallow water Gulf of Maine environment, clicks asdemonstratedinFig.12.Thespermwhalerangeanddepth arriving at the receiver array from the sperm whale in close estimatesobtainedviatheMATandMR-TDAmethodsagree rangetothearraynear-fielddistancedisplayclearpatternsof well, especially near array broadside (between 17:23:00 and multiple reflection between the sea bottom and surface. The 17:28:00). At other time instances, the two methods yield evolutionofmultipatharrivaltimesisshownforalltheclicks results that are within 1 SD of each other. The whale range recordedbetween17:18:00and17:33:00EDTinFig.5.The estimatesobtainedviaMATareexpectedtobemorereliable direct arrival time of each click was first determined and than those obtained using MR-TDA. This is because in the alignedintimebeforethestackedsequenceofclickswascre- MR-TDA technique, the whale range estimates depend on ated. Between 17:18:00 and 17:23:00 EDT, the first-order otherparameterssuchastheunknownwhaledepthandwater bottom and surface reflected arrivals are distinguishable in columndepth.TherangeestimatesobtainedviaMATarenot time, crossing each other due to vertical displacement of the dependentontheseparameters,insteaditdependsonlyonthe whale.Atothertimeinstances,thebottomandsurfacereflec- measuredbearingchangeofthewhalewithtime. tions are not clearly distinguishable. The higher-order reflectedarrivalsaremoreprominentwithshortertime sepa- C. Spermwhaledetectionrangeinshallowwater ration for the later clicks in the time period analyzed. Multiple reflections in the shallow water waveguide extends The click signals from this sperm whale located at the received sperm whale click time duration from 10-30ms roughly 1km in range from the receiver array stood by as ofthedirectarrival(Møhl,2001)tomorethan250ms. much as 35dB over the mean background ambient noise The sperm whale range and depth were also simultane- level after beamforming [see Figs. 3(C) and 4(C)]. Because ously estimated by applying the MR-TDA technique thebackgroundambientnoiselevelinthebeamofthesperm describedintheappendixforthetimeintervalfrom17:18:00 whale after high pass filtering has roughly 5.5dB standard FIG. 8.(Color online) (A) Single sperm whale in Gulf of Maine localization result using the two methods, MAT and MR-TDA for the period between 17:15:20and17:32:40EDT.TheellipsesrepresentcontoursoflocalizationuncertaintyateachtimeinstancewithMAT(solidcurve)andwithMR-TDA (dashedcurve).Theoriginofthecoordinatesystemislocatedat(41(cid:6)48.780N,69(cid:6)0.060W).(B)RangeestimatesusingMATandMR-TDAbetween17:18:00 and17:32:40EDT.Theerrorbarsshowthestandarddeviationoftherangeestimatesina4-mintimewindow.(C)Depthestimatesforthesametimeperiod. 3358 J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 TABLE I.Correlation coefficients between receiver array heading change andclickbearingchangeforthecandidatepairsofleft-rightabsoluteclick bearingclustersshowninFig.10.Theselectedtrueclickbearingclusters areeachmarkedwithanasterisk. Correlationcoefficients,q Cluster Right Left N 1 0.64 0.32* 17 2 0.66 0.36* 25 3 0.63 0.09* 10 4 0.09* 0.60 16 5 0.44 0.08* 41 6 0.64 0.34* 9 7 0.63 0.26* 17 FIG. 9.Average broadband transmission loss in the frequency range of 8 0.37* 0.76 229 1.5–2.5kHzobtainedusingtheRAMmodelatdistancesupto80kmforthe 9 0.06* 0.27 42 GulfofMaineenvironment. deviation,thespermwhaleclicksignalshaveasignalexcess of (35-2(cid:8)5.5)¼24dB for our detector. The broadband continental slope south of Cape Cod. Both left-right bearing transmission loss from a whale located approximately 1km estimates of the detected clicks are shown for roughly an in range from the receiver array center and at a depth of hour of recording from 23:00:00 EDT on May 13 to 80m is roughly 55dB re 1m [see Fig. 9(A)]. The signal 00:02:30 EDT on May 14 in Fig. 10. The left-right ambigu- excess of 24dB implies that the sperm whale vocalizations ity of the linear receiver array is resolved for each group of can be detectable out to much longer ranges>60km, where clicks using the technique described in Sec. IIA1. The cor- thetransmissionlossis(55þ24)¼79dBre1m,afterbeam- relation coefficients between the change in bearings and the forming with the towed receiver array. In contrast, sperm changeinarrayheadingsfornineidentifiedclustersofclicks whale detection range with a single omnidirectional hydro- inFig.10arelistedinTableIforboththeleftandrightbear- phone is expected to be significantly limited [compare Fig. ingcandidates.Aseriesofclickbearingsisdeterminedtobe 4(C) showing the result after array beamforming with Fig. trueif(a)the correlation coefficient qisbelow 0.4,whereas 4(D) which is the result for a single hydrophone]. Because theambiguousgrouphasq>0.6,or(b)thecorrelationcoef- sperm whale detection range is dependent on ambient noise ficientqisatleastfivetimessmallerthanthatoftheambigu- level, the detection ranges given here are valid for low to ous group. When none of these criteria are met, the true moderate sea state of around two to three and wind speed click bearings could not be determined and no localization between 8 and 11kn, according to recorded measurements. resultisobtained. The detection ranges will be larger at lower sea states and smallerathigherseastates. A. Distinguishingspermwhaleindividualsusing temporal,spectral,andspatialcharacteristicsofclicks IV. RESULTSII:MULTIPLESPERMWHALESATTHE Wefurtherassociatethedifferentclickclusterstodistinct CONTINENTALSLOPESOUTHOFCAPECOD sperm whale individuals based on the mean and standard We identified over 1000 sperm whale clicks in about deviationofIPIofeachclickcluster.Themeanandstandard 75min of recording on May 13 at site B (Fig. 1) on the deviation of the IPI as wellas estimateofwhale bodylength based on Eqs. (1) and (2) are provided in Table II for all TABLEII.IPIforeachclusterandtheestimatedspermwhalebodylength. Cluster hIPIi r L L Whale IPI w,Gordon w,Growcott number (ms) (ms) (m) (m) group N 1 3.4 0.4 9.8 10.0 A 10 2 7.7 0.7 16.0 15.4 B 8 3 3.3 0.3 9.6 9.9 A 8 4 4.2 0.3 11.0 11.0 C 11 5 4.3 0.2 11.0 11.1 C 9 6 7.6 0.7 15.8 15.3 B 5 7 4.9 0.3 11.9 12.0 D 12 8-1 4.7 0.3 11.6 11.6 E 43 8-2 4.6 0.3 11.5 11.5 E 12 8-3 4.5 0.4 11.4 11.4 E 18 FIG.10.(Coloronline)Trueandambiguousbearingsofspermwhaleclicks receivedonthearrayonMay13atsiteBonthecontinentalslope.Whale 8-4 4.5 0.4 11.4 11.4 E 33 bearingsaregroupedintoclustersfrom1to9accordingtotheirtemporal, 9 6.9 0.5 14.8 14.4 F 17 spectral,andspatialcharacteristics. J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification 3359 Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21 FIG. 11.(Color online) Localization andtrackingresultformultiplesperm whaleswithbearingclustersshownin Fig.10onMay13atsiteBonthecon- tinentalslope.Thedashedcurveisthe trackofthereceiverarray.Theorigin of the coordinate system is located at (39(cid:6)50.940N,70(cid:6)19.550W). identifiedclickclusters.BasedonthemeasuredIPI,weasso- either CorD.From TableII,the estimatednumberofsperm ciate click clusters 1 and 3 (mean IPI (cid:3) 3.4ms) to the same whale individuals simultaneously and passively recorded by whaleA.Similarly,clickclusters2and6areassociatedwith thetowedreceiverarrayisatleast4orasmanyas6. whale B with much longer IPI of approximately 7.6ms. WhaleCisassociatedwithclickclusters4and5.Clickclus- ter 9 has very distinct IPI and corresponding whale size esti- B. Localizationandtrackingofmultiplespermwhales infar-fieldofthetowedhorizontalcoherentreceiver mate and is associated with whale F. Whale D is associated array withclick cluster 7,while whale E isassumed topossess the IPI measurement of click cluster 8, which is composed of The sperm whale click clusters from May 13 are local- sub-clusters 8-1, 8-2, 8-3 and 8-4. The IPI values measured ized using the bearings-only MAT technique and the results for clusters associated with whale E lie between those of are shown in Fig. 11 grouped according to the classification whale C and whale D, so whale E could also possibly be and association results obtained in Sec. IVA. Whale A FIG. 12.Calculated time delays from direct arrival for the bottom bounce Dt (upper left), surface bounce Dt b s (upper right), bottom-surface bounces Dt (lower left), and surface-bottom bs bounces Dt (lower right) as a func- sb tionofwhalerangeanddepth.There- ceiver depth is set at 65m and the waterdepthis160m. 3360 J.Acoust.Soc.Am.,Vol.135,No.6,June2014 Tranetal.:Spermwhalerangelocalizationandclassification Redistribution subject to ASA license or copyright; see http://acousticalsociety.org/content/terms. Download to IP: 18.51.1.88 On: Wed, 01 Jul 2015 18:28:21

See more

The list of books you might like